1NNQA

Rubrerythrin from pyrococcus furiosus pfu-1210814
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Rubrerythrin
publication title Structural genomics of Pyrococcus furiosus: X-ray crystallography reveals 3D domain swapping in rubrerythrin
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 60
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1nnqA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1nnqA02
4ZLWA 2Z6MA 4ETRA 2GYQA 4KVRA 4YKHA 1VJXA 5CMRA 3Q4NA 3R2OA 2Z5QA 3KX9A 2PVEA 3KYWA 4RC6A 3BVIA 1T9OA 3KA4A 1MOJA 3PW1B 2GMGA 1FHMA 2RBDA 4RC8A 3NP2X 3HL1A 4RC5A 5GU2X 1LKOA 2QF9A 3F34A 4LYXA 1RWDA 3Q4RA 1S3QA 3EZ0A 3SS2A 2KN9A 4TW3A 4DYUA 5JKLA 4TO9A 3VNXA 5C6FA 4ZMCA 3EGMA 4DYXA 2CIHA 2V3BB 3RE7A 1LTLA 1JKUA 3AJQA 5J8WA 4TOGA 2G4HA 1IRNA 1SMMA 2OH3A 2ZG7X 2BK6A 2WLUA 4DI0A 1JYBA 1R0GA 1O9IA 4AM2A 5JACA 2IU2A 1AEWA 5K52A 5ERKA 5CMQA 4AM5A 3QHCA 3E1QA 2CHIA 2QQYA 4EVDA 1YK5A 4II4A 1FHHA 5IX6A 2WTLA 1YK4A 2KKDA 3E1JA 3PWQA 5GU3X 4XKUA 3O7RA 2HTNA 2GS4A 4PGIA 3PZAA 4MUDA 3FI6A 5GU0X 2Z5PA 5CZUA 7RXNA 2M4YA 3GVYA 1S24A 2FG4A 4DASA 8RXNA 3BVFA 2V2SA 3UOFA 1F30A 3E1PA 1YUXA 2FL0A 3ISEA 5LBHA 2W0OA 1QYBA 3KA8A 4TOEA 2FZFA 1ZRPA 5GN8A 5GN8B 5J8SA 4IWJA 4Y08A 5JKMA 3AJOA 3E1NA 3E1OA 3RGDA 2CN7A 2WLAA 1RDVA 3BVEA 1LKMA 1JI5A 3PWFA 2CLUA 1JKVA 3R2LA 4IWKA 4CMYA 3ISFA 3TA8A 4PGKA 4RC6B 4E6KA 2QL0A 1Z6OA 5ERJA 4M35A 1T9PA 1IU6A 1T9QA 4LQVA 4LQNA 4RC5B 2JD60 3AK8A 5D8OA 2ZG9X 3ES3A 2BKCA 3KA6A 1BCFA 3SIDA 1XZ3A 5FFEA 4ML5A 3RD0A 3WVWA 4ZL6A 4MKUA 4LQJA 1CADA 4YWLA 3SHXA 5J9VA 3IQ1A 1YV1A 2C6RA 3F33A 4U3GA 1R03A 3H7GA 3WVUA 2ZURX 1RCDA 4MJYA 2VXXA 2JD70 4TOHA 4LQHA 1BE7A 4TPUA 3GE4A 4II4B 5FFAA 2X170 3U90A 4TOBA 2V2MA 3F32A 2V2NA 2IY4A 4CY9A 3KYYA 2BW1A 1OTKA 3T9JA 4M34A 1RDGA 2FFXJ 2VL6A 1LKPA 5GOUA 1TK6A 2C2JA 3RBCA 4XKSA 5AXSA 1B2JA 4XGSA 2LCQA 4YWMA 3R2MA 4ITWA 4IXKA 4ZTTA 3SE1A 1H7VA 2YW6A 4LPJA 3AK9A 3BVLA 1DPSA 3BVKA 2V2IA 4CVSA 3KWOA 4RC7A 4KVQA 5LS9A 1EUMA 3E1MA 1Z6OM 2CF7A 2XGWA 3KYUA 3PW8A 2V2JA 1IROA 1TKPA 4CVRA 4CYBA 4DYYA 1FHAA 3HIUA 2FKZA 2ZG8X 2ZA7A 1SQ3A 2V2RA 5K53A 4ITTA 5E2DA 2DSXA 1JGCA 2C41A 3BKNA 5JKLG 3EZUA 3RZ6A 1GWGA 4TODA 4EVCA 1VEIA 3PVYB 1RYTA 1MFRA 2C2FA 2V2LA 1VCXA 1QCVA 3E1LA 4AR5A 2V2PA 5IY0A 4TOFA 1HRSA 2FJCA 4AM4A 1SMWA 1BFRA 3F35A 3QHBA 1RB9A 4QUWA 3F39A 5FFBA 1NF4A 1ZUJA 1IU5A 3QD8A 1UMNA 1DATA 3Q4QA 3QB9A 2CN6A 5LG2A 1O9RA 1UVHA 4ZKXA 2ITBA 1Z4AA 3NOZX 2Y3QA 4KVSA 1R0HA 3PVYA 2IB0A 1DVBA 3A68A 5D8SA 2Z5RA 3UOIA 5GU1X 1XZ1A 3WVVA 3R2HA 4RC7B 3BT5A 3UNOA 5I4JA 4AR3A 5D8YA 2FHAA 1R0IA 5LG8A 1R0FA 4ZJKA 1RCCA 3E6SA 3A44A 4POFA 2V2OA 4ERUA 3Q4OA 4XKTA 1NF6A 2RDVA 3KXUA 3AF9X 1B2OA 1F33A 5E1UA 5FFDA 4ISMA 1C09A 3PVTA 2PVXA 3R2KA 2ZA6A 3E6RA 4DE6A 5HJHA 2ZA8A 3RAVA 1BG7A 3RZTA 2YJJA 2OC5A 1L8IA 1N1QA 3OJ5A 3PVRA 1QGHA 2XJOA 1LB3A 3R2SA 1RCGA 4RXNA 4TOCA 4Z5SA 3MPSA 5AI2A 2CHPA 1B71A 2HR5A 1CAAA 5RXNA 1BRFA 1YUZA 1RCEA 2XJNA 1JI4A 3NP0X 4ISPA 2YW7A 4TOAA 4A25A 5HQOA 5D8RA 2Z90A 3AF7X 4P18A 4AR6A 1VELA 1IERA 2V15A 4CYAA 2CLBA 3IS7A 3A9QA 4CVTA 1VLGA 3GHQA 4ZKHA 3QZ3A 3KYXA 5AI3A 3PW8C 1JREA 3KA3A 3AJPA 4ZL5A 2UX1A 3KA9A 3OGHA 3IS8A 4MN9A 1B13A 3O7SA 2CEIA 3PWQC 1JTSA 5HJFA 2D5KA 1BQ9A 2FG8A 6RXNA 3KYVA 4K9FA 4LYUA 2PYBA 3ERZA 4ZKWA 3PW1A 2GYDA 4R42A 2PYAA 5J93A 2XKQA 4MY7A 1BQ8A 1NFVA 4AR4A 3SH6A 3R2RA 3WNWA 4LPNA 2MS3A 1JIGA 3QVDA 2BJYA 5D8PA 1VEQA 1DX8A 2VZBA 4DYZA 3PVTB 1S30A 4POGA 1TKOA 2K2DA 4M33A 4CMYV 5FEJA 1SOFA 4EVBA 4ME3A 2YJKA 1E8JA 2XJMA 4OYNA 4CVPA 3RYGA 4DZ0A 1ZS3A 3F36A 1IESA 3PVRB 1L8HA 1KRQA 2VXIA 1S2ZA 3F38A 5FFCA 2JD80 5D8QA 4Z3BA 2F7NA 1RCIA 1BFYA 1J30A 3FVBA 5D8XA 2C2UA 5JKMG 4LPMA 3E2CA 1H96A 4M32A 4EVEA 1R0JA 1SMUA 4PG0A 3FSEA 3AF8X 1TJOA 4PG1A 1NNQA 4REUA 3F37A
chains in the Genus database with same CATH superfamily
4AHZA 4ZLWA 3LWQB 4WJG4 1TWAL 4A3IL 2Z6MA 4ETRA 2NVQL 2GYQA 4KVRA 3CQZL 4YKHA 2PSMC 1VJXA 5CMRA 3Q4NA 3R2OA 3QQCE 2Z5QA 2M6PA 4QIWP 4A3FL 3J7Y1 3KX9A 2C6AA 2PVEA 2Z3QB 3KYWA 2VUML 4RC6A 3BVIA 3S1QL 1T9OA 3KA4A 4A3EL 1MOJA 3PW1B 2PPTA 2GMGA 1TWCL 1FHMA 2RBDA 4RC8A 3NP2X 3HL1A 4RC5A 5GU2X 2B5ID 1LKOA 2QF9A 3F34A 4LYXA 2ERSA 3MSUA 1RWDA 1Z92B 2L0ZA 3Q4RA 5IP7L 1S3QA 3EZ0A 4C2M1 3SS2A 5AN9H 4C3IL 2KN9A 4TW3A 4DYUA 5JKLA 1P7PA 5M3ML 4TO9A 3VNXA 5C6FA 4ZMCA 3EGMA 4DYXA 2CIHA 2V3BB 3GTPL 3PKIA 1RYQA 3RE7A 1LTLA 1JKUA 3AJQA 2XJUA 5J8WA 4JAFA 1Y1WL 4TOGA 2G4HA 3V3KB 1IRNA 1SMMA 1TWHL 4BBRL 2OH3A 2ZG7X 2RFKB 2BK6A 2NVTL 2WLUA 4DI0A 1JYBA 3C1ZA 1R0GA 2NVYL 4AI3A 1O9IA 4AM2A 5JACA 2IU2A 4A3BL 1AEWA 5GAHc 5K52A 5ERKA 4BXXL 5CMQA 2E2IL 4AM5A 3B0AB 3QHCA 3E1QA 3JZAB 2CHIA 3LNLA 2QQYA 4A3JL 4EVDA 1YK5A 4II4A 1FHHA 5C44L 5IX6A 2WTLA 1YK4A 2KKDA 5JDOB 5IP9L 5JVG1 3E1JA 2E2HL 3PWQA 5GU3X 3HOWL 4A3DL 4XKUA 3S14L 3O7RA 2HTNA 2GS4A 2AYJA 3D19A 3PZAA 4MUDA 4PGIA 3FI6A 5GU0X 2Z5PA 5CZUA 2N02A 7RXNA 1IW7D 2M4YA 3GVYA 5IYDL 5MFZA 1S24A 2FG4A 4DASA 8RXNA 3BVFA 2V2SA 3UOFA 1PFVA 3M6JA 1F30A 3E1PA 1YUXA 2FL0A 3ISEA 5LBHA 5IYBL 2W0OA 1QYBA 3KA8A 4TOEA 2NYDA 2FZFA 1ZRPA 5GN8A 5GN8B 5J8SA 3I4NL 4YVZA 4IWJA 3LPEB 4Y08A 5JKMA 3AJOA 3E1NA 3E1OA 3RGDA 2CN7A 2WLAA 1RDVA 3BVEA 4ZN1B 1LKMA 1JI5A 2EY4E 4A3GL 5HU6D 3PWFA 2CLUA 1JKVA 3R2LA 4IWKA 4CMYA 1F4LA 5MLC3 3ISFA 3TA8A 4PGKA 1PZXA 4RC6B 4E6KA 2QL0A 3L0MA 1Z6OA 5ERJA 4C3HL 4M35A 1T9PA 1IU6A 1T9QA 4LQVA 4LQNA 4RC5B 2JD60 3AK8A 2MGYA 5D8OA 2CKAA 2ZG9X 4C3JL 3ES3A 2BKCA 2B63L 3KA6A 1BCFA 3SIDA 3W54A 1XZ3A 3PO2L 5GADc 5FFEA 4ML5A 3RD0A 3WVWA 4ZL6A 2APOB 4MKUA 4E6YA 4LQJA 1CADA 4YWLA 3SHXA 1Y1VL 2ERJA 5J9VA 3IQ1A 1WCML 1YV1A 2C6RA 3F33A 3P2AA 4Y7NL 4U3GA 5C4JL 2R93L 1R03A 3H7GA 1VZGA 3WVUA 2ZURX 3PL5A 3K7AL 5IYCL 5DM71 1RCDA 3S2HL 2O5JD 4MJYA 2VXXA 2JD70 4TOHA 4LQHA 1BE7A 4ZN3B 5M5YL 4TPUA 3GE4A 4II4B 5H1Sc 4XXBB 5FFAA 2X170 3S16L 3U90A 1PFWA 4TOBA 2V2MA 3F32A 3H99A 4A3KL 3M3YL 2V2NA 2IY4A 4CY9A 3KYYA 2BW1A 2CWLA 1OTKA 3T9JA 4M34A 1RDGA 2FFXJ 5EINC 2Y44A 2VL6A 1LKPA 5M5WL 5GOUA 1TK6A 2C2JA 3RBCA 4XKSA 5AXSA 1B2JA 2NVXL 4XGSA 2LCQA 4YWMA 3R2MA 4ITWA 4IXKA 2XJVA 4ZTTA 3SE1A 4AHYA 1H7VA 2YW6A 4LPJA 3AK9A 3BVLA 1DPSA 3S1ML 3BVKA 4YXMA 4BBSL 2V2IA 4CVSA 3KWOA 4RC7A 4KVQA 5LS9A 1EUMA 1I6HL 3E1MA 1Z6OM 2CF7A 2XGWA 3KHKA 4E40A 2CKCA 2XJPA 3KYUA 3PW8A 5EIOC 1R9TL 2AUSB 3S1RL 2V2JA 1IROA 1TKPA 4CVRA 5MF6A 4CYBA 3GGZA 3GTKL 4DYYA 1FHAA 3HIUA 2H12A 1K83L 2FKZA 2Y0SP 2ZG8X 2ZA7A 4GS7D 1SQ3A 2V2RA 5K53A 4ITTA 5E2DA 1OWCA 2DSXA 1JGCA 3N6OA 2C41A 2A69D 4AHWA 3BKNA 5JKLG 3C21A 3EZUA 3S1NL 3RZ6A 5JVH1 1GWGA 4A93L 3HOUL 4MXPA 4TODA 3LWOB 4EVCA 1VZIA 1VEIA 3PVYB 2AQCA 2R92L 1RYTA 1MFRA 4AHXA 2C2FA 3HOXL 2V2LA 3FDJA 1VCXA 3C23A 4AI2A 1QCVA 4LHLA 1PFUA 3E1LA 3PKJA 4AR5A 3KDQA 2V2PA 2JI1A 5IY0A 4TOFA 4AI1A 1TWFL 1HRSA 2FJCA 3LWVB 3LKDA 4AM4A 1ODHA 2E2JL 3S15L 1SMWA 1BFRA 3F35A 3QHBA 1RB9A 5M5XL 4QUWA 2V0FA 3S2DL 3F39A 5FFBA 5FLML 1NF4A 4A3CL 3C1YA 1ZUJA 4G6BA 1IU5A 3GTOL 3HOYL 3QD8A 1UMNA 5C3EL 1DATA 3Q4QA 3QB9A 2XJSA 3HOVL 2CN6A 5LG2A 4U671 3H9CA 1O9RA 1UVHA 4ZKXA 3PIO1 4BY1L 3GTGL 4BY7L 2ITBA 1Z4AA 4AI0A 4A3ML 2V0EA 3S17L 2BE5D 2WWXB 4AYBP 3NOZX 2Y3QA 4KVSA 3K35A 3PVYA 1R0HA 2IB0A 1DVBA 2M4VA 3A68A 5D8SA 2Z5RA 2OKCA 3UOIA 5GU1X 1XZ1A 3WVVA 3R2HA 4RC7B 3BT5A 3UNOA 2V8TA 5I4JA 4WFN1 1SFOL 4AR3A 5D8YA 3GTLL 2FHAA 1R0IA 5LG8A 1R0FA 1VZHA 4ZJKA 1RCCA 3E6SA 4JADA 2XJTA 2A6ED 3A44A 4LHNA 4POFA 2V2OA 4ERUA 5M3FL 3Q4OA 4XKTA 1NF6A 2RDVA 2HVYC 3VPBE 3KXUA 3AF9X 1B2OA 1F33A 1OWBA 5E1UA 5FFDA 4ISMA 1C09A 3PVTA 2PVXA 3PIP1 3R2KA 1NXEA 2ZA6A 3E6RA 4DE6A 1NXGA 5HJHA 4Y52L 2ZA8A 3RAVA 2A6HD 4JAGA 2V8UA 1BG7A 3RZTA 4B8CD 2YJJA 2OC5A 1L8IA 3JR7A 1N1QA 3H97A 3OJ5A 3PVRA 1QGHA 3NFPI 4UY81 2XJOA 3DBYA 3FRSA 2XJRA 3J7Z1 1LB3A 3R2SA 1RCGA 2A68D 3WWLA 3GTJL 4RXNA 4TOCA 3WWNB 4Z5SA 3H3VM 2JA6L 3HJYB 3MQKB 4JAEA 3MPSA 5AI2A 2CHPA 3GTQL 1B71A 2HR5A 1CAAA 5RXNA 1BRFA 1YUZA 2G38B 1RCEA 2XJNA 1JI4A 3NP0X 4ISPA 2YW7A 4TOAA 4A25A 3GTML 3PO3L 5HQOA 5D8RA 2Z90A 3AF7X 4P18A 4AR6A 3UFBA 1WJVA 1VELA 1IERA 2V15A 4CYAA 2CLBA 3IS7A 3A9QA 4CVTA 1VLGA 3GHQA 3GGYA 3QZ3A 4ZKHA 5MFPA 3KYXA 2JA8L 5AI3A 4KXRB 3PW8C 1JREA 3KA3A 3AJPA 4ZL5A 2UX1A 3IU3I 3KA9A 3OGHA 4V196 3IS8A 4MN9A 1B13A 3O7SA 3H9BA 2CEIA 3PWQC 1JTSA 5MGNA 5GAGc 5HJFA 2D5KA 1BQ9A 2FG8A 6RXNA 1I50L 2JI2A 3KYVA 4LYUA 4K9FA 2PYBA 3ERZA 4ZKWA 3M4OL 4X6AL 2AR0A 1QQTA 3PW1A 2GYDA 4R42A 2PYAA 2WAQP 5J93A 3HAXC 2XKQA 4MY7A 1BQ8A 4A3LL 2J9UB 3P8BA 1NFVA 4AR4A 3SH6A 4W4LB 3R2RA 3I4ML 3WNWA 4LPNA 1I3QL 2MS3A 1JIGA 4TVMA 2CR8A 3JZ9A 3QVDA 2BJYA 5D8PA 1VEQA 1DX8A 2VZBA 3HJWB 5K2ME 4DYZA 3PVTB 2R7ZL 3B08B 1S30A 4POGA 1TKOA 2M6OA 3FRRA 2K2DA 4M33A 3RZDL 2ZIXA 3LWRB 4CMYV 5FEJA 1SOFA 4EVBA 4ME3A 2YJKA 2JA7L 1E8JA 2XJMA 3LWPB 4OYNA 4CVPA 3RYGA 4DZ0A 4W4KB 2JI3A 5DM61 1ZS3A 3F36A 2JA5L 1IESA 3PVRB 1TWGL 1L8HA 2Z3RB 1KRQA 2VXIA 3RZOL 1S2ZA 3VVAA 2PMZP 3F38A 3H0GL 5FFCA 3HKZP 2JD80 5GAEc 5JDOA 1PFYA 5D8QA 4Z3BA 2F7NA 1RCIA 2WB1P 5C4XL 1BFYA 1J30A 3FVBA 5D8XA 5FJ8L 2C2UA 4X0JA 3ZG6A 5JKMG 4LPMA 3E2CA 2XJQA 4XGHA 3HOZL 1H96A 3FKIL 4M32A 2YU9L 4EVEA 1R0JA 3VV9A 4YXJA 1SMUA 4PG0A 3FSEA 3AF8X 1TJOA 4PG1A 2C6BA 1NNQA 4REUA 3F37A
chains in the Genus database with same CATH topology
4AHZA 4ZLWA 4WJG4 2Z6MA 4ETRA 2GYQA 4KVRA 4YKHA 2PSMC 1VJXA 5CMRA 3Q4NA 3R2OA 3QQCE 2Z5QA 2M6PA 3J7Y1 3KX9A 2C6AA 2PVEA 3KYWA 4RC6A 3BVIA 1T9OA 3KA4A 1MOJA 3PW1B 2PPTA 2GMGA 1FHMA 2RBDA 4RC8A 3NP2X 3HL1A 4RC5A 5GU2X 2B5ID 1LKOA 2QF9A 3F34A 4LYXA 2ERSA 3MSUA 1RWDA 1Z92B 2L0ZA 3Q4RA 1S3QA 3EZ0A 3SS2A 5AN9H 2KN9A 4TW3A 4DYUA 5JKLA 4TO9A 3VNXA 5C6FA 4ZMCA 3EGMA 4DYXA 2CIHA 2V3BB 3PKIA 1RYQA 3RE7A 1LTLA 1JKUA 3AJQA 2XJUA 5J8WA 4JAFA 4TOGA 2G4HA 3V3KB 1IRNA 1SMMA 2OH3A 2ZG7X 2BK6A 2WLUA 4DI0A 1JYBA 3C1ZA 1R0GA 4AI3A 1O9IA 4AM2A 5JACA 2IU2A 1AEWA 5GAHc 5K52A 5ERKA 5CMQA 4AM5A 3B0AB 3QHCA 3E1QA 3JZAB 2CHIA 3LNLA 2QQYA 4EVDA 1YK5A 4II4A 1FHHA 5IX6A 2WTLA 1YK4A 2KKDA 5JDOB 5JVG1 3E1JA 3PWQA 5GU3X 4XKUA 3O7RA 2HTNA 2GS4A 2AYJA 3D19A 3PZAA 4MUDA 4PGIA 3FI6A 5GU0X 2Z5PA 5CZUA 2N02A 7RXNA 1IW7D 2M4YA 3GVYA 5MFZA 1S24A 2FG4A 4DASA 8RXNA 3BVFA 2V2SA 3UOFA 2Z3QB 3M6JA 1F30A 3E1PA 1YUXA 2FL0A 3ISEA 5LBHA 2W0OA 1QYBA 3KA8A 4TOEA 2NYDA 2FZFA 1ZRPA 5GN8A 5GN8B 5J8SA 4YVZA 4IWJA 3LPEB 4Y08A 5JKMA 3AJOA 3E1NA 3E1OA 3RGDA 2CN7A 2WLAA 1RDVA 3BVEA 4ZN1B 1LKMA 1JI5A 5HU6D 3PWFA 2CLUA 1JKVA 3R2LA 4IWKA 4CMYA 5MLC3 3ISFA 3TA8A 4PGKA 4RC6B 4E6KA 2QL0A 3L0MA 1Z6OA 5ERJA 4M35A 1T9PA 1IU6A 1T9QA 4LQVA 4LQNA 4RC5B 2JD60 3AK8A 2MGYA 5D8OA 2CKAA 2ZG9X 3ES3A 2BKCA 3KA6A 1BCFA 3SIDA 3W54A 1XZ3A 5GADc 5FFEA 4ML5A 3RD0A 3WVWA 4ZL6A 4MKUA 4E6YA 4LQJA 1CADA 4YWLA 3SHXA 2ERJA 5J9VA 3IQ1A 3P2AA 1YV1A 2C6RA 3F33A 4U3GA 1R03A 3H7GA 1VZGA 3WVUA 2ZURX 5DM71 1RCDA 2O5JD 4MJYA 2VXXA 2JD70 4TOHA 4LQHA 1BE7A 4ZN3B 4TPUA 3GE4A 4II4B 5H1Sc 4XXBB 5FFAA 2X170 3U90A 4TOBA 2V2MA 3F32A 2V2NA 2IY4A 4CY9A 3KYYA 2BW1A 2CWLA 1OTKA 3T9JA 4M34A 1RDGA 2FFXJ 5EINC 2Y44A 2VL6A 1LKPA 5GOUA 1TK6A 2C2JA 3RBCA 4XKSA 5AXSA 1B2JA 4XGSA 2LCQA 4YWMA 3R2MA 4ITWA 4IXKA 2XJVA 4ZTTA 3SE1A 4AHYA 1H7VA 2YW6A 4LPJA 3AK9A 3BVLA 1DPSA 3BVKA 4YXMA 2V2IA 4CVSA 3KWOA 4RC7A 4KVQA 5LS9A 1EUMA 3E1MA 1Z6OM 2CF7A 2XGWA 3KHKA 4E40A 2CKCA 2XJPA 3KYUA 3PW8A 5EIOC 2V2JA 1IROA 1TKPA 4CVRA 5MF6A 4CYBA 3GGZA 4DYYA 1FHAA 3HIUA 2H12A 2FKZA 2ZG8X 2ZA7A 4GS7D 1SQ3A 2V2RA 5K53A 4ITTA 5E2DA 1OWCA 2DSXA 1JGCA 3N6OA 2C41A 2A69D 4AHWA 3BKNA 5JKLG 3C21A 3EZUA 3RZ6A 5JVH1 1GWGA 4MXPA 4TODA 4EVCA 1VZIA 1VEIA 3PVYB 1RYTA 1MFRA 4AHXA 2C2FA 2V2LA 1VCXA 3C23A 4AI2A 1QCVA 4LHLA 3E1LA 3PKJA 4AR5A 3KDQA 2V2PA 2JI1A 5IY0A 4TOFA 4AI1A 1HRSA 2FJCA 3LKDA 4AM4A 1ODHA 1SMWA 1BFRA 3F35A 3QHBA 1RB9A 4QUWA 2V0FA 3F39A 5FFBA 1NF4A 3C1YA 1ZUJA 4G6BA 1IU5A 3QD8A 1UMNA 1DATA 3Q4QA 3QB9A 2XJSA 2CN6A 5LG2A 4U671 1O9RA 1UVHA 4ZKXA 3PIO1 2ITBA 1Z4AA 4AI0A 2V0EA 2BE5D 2WWXB 3NOZX 2Y3QA 4KVSA 3K35A 3PVYA 1R0HA 2IB0A 1DVBA 2M4VA 3A68A 5D8SA 2Z5RA 2OKCA 3UOIA 5GU1X 1XZ1A 3WVVA 3R2HA 4RC7B 3BT5A 3UNOA 2V8TA 5I4JA 4WFN1 4AR3A 5D8YA 2FHAA 1R0IA 5LG8A 1R0FA 1VZHA 4ZJKA 1RCCA 3E6SA 4JADA 2XJTA 2A6ED 3A44A 4LHNA 4POFA 2V2OA 4ERUA 3Q4OA 4XKTA 1NF6A 2RDVA 3VPBE 3KXUA 3AF9X 1B2OA 1F33A 1OWBA 5E1UA 5FFDA 4ISMA 1C09A 3PVTA 2PVXA 3PIP1 3R2KA 1NXEA 2ZA6A 3E6RA 4DE6A 1NXGA 5HJHA 2ZA8A 3RAVA 2A6HD 4JAGA 2V8UA 1BG7A 3RZTA 4B8CD 2YJJA 2OC5A 1L8IA 1N1QA 3OJ5A 3PVRA 1QGHA 3NFPI 4UY81 2XJOA 3DBYA 3FRSA 2XJRA 3J7Z1 1LB3A 3R2SA 1RCGA 2A68D 3WWLA 4RXNA 4TOCA 3WWNB 4Z5SA 4JAEA 3MPSA 5AI2A 2CHPA 1B71A 2HR5A 1CAAA 5RXNA 1BRFA 1YUZA 2G38B 1RCEA 2XJNA 1JI4A 3NP0X 4ISPA 2YW7A 4TOAA 4A25A 5HQOA 5D8RA 2Z90A 3AF7X 4P18A 4AR6A 3UFBA 1WJVA 1VELA 1IERA 2V15A 4CYAA 2CLBA 3IS7A 3A9QA 4CVTA 1VLGA 3GHQA 3GGYA 3QZ3A 4ZKHA 5MFPA 3KYXA 5AI3A 4KXRB 3PW8C 1JREA 3KA3A 3AJPA 4ZL5A 2UX1A 3IU3I 3KA9A 3OGHA 4V196 3IS8A 4MN9A 1B13A 3O7SA 2CEIA 3PWQC 1JTSA 5MGNA 5GAGc 5HJFA 2D5KA 1BQ9A 2FG8A 6RXNA 2JI2A 3KYVA 4K9FA 4LYUA 2PYBA 3ERZA 4ZKWA 2AR0A 3PW1A 2GYDA 4R42A 2PYAA 5J93A 2XKQA 4MY7A 1BQ8A 2J9UB 3P8BA 1NFVA 4AR4A 3SH6A 4W4LB 3R2RA 3WNWA 4LPNA 2MS3A 1JIGA 4TVMA 2CR8A 3JZ9A 3QVDA 2BJYA 5D8PA 1VEQA 1DX8A 2VZBA 5K2ME 4DYZA 3PVTB 3B08B 1S30A 4POGA 1TKOA 2M6OA 3FRRA 2K2DA 4M33A 2ZIXA 4CMYV 5FEJA 1SOFA 4EVBA 4ME3A 2YJKA 1E8JA 2XJMA 4OYNA 4CVPA 3RYGA 4DZ0A 4W4KB 2JI3A 5DM61 1ZS3A 3F36A 1IESA 3PVRB 1L8HA 2Z3RB 1KRQA 2VXIA 1S2ZA 3VVAA 3F38A 5FFCA 2JD80 5GAEc 5JDOA 5D8QA 4Z3BA 2F7NA 1RCIA 1BFYA 1J30A 3FVBA 5D8XA 2C2UA 4X0JA 3ZG6A 5JKMG 4LPMA 3E2CA 2XJQA 4XGHA 1H96A 4M32A 4EVEA 1R0JA 3VV9A 4YXJA 1SMUA 4PG0A 3FSEA 3AF8X 1TJOA 4PG1A 2C6BA 1NNQA 4REUA 3F37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZLW A;  2Z6M A;  4ETR A;  2GYQ A;  4KVR A;  4YKH A;  1VJX A;  5CMR A;  3Q4N A;  3R2O A;  2Z5Q A;  3KX9 A;  2PVE A;  3KYW A;  4RC6 A;  3BVI A;  1T9O A;  3KA4 A;  1MOJ A;  3PW1 B;  2GMG A;  1FHM A;  2RBD A;  4RC8 A;  3NP2 X;  3HL1 A;  4RC5 A;  5GU2 X;  1LKO A;  2QF9 A;  3F34 A;  4LYX A;  1RWD A;  3Q4R A;  1S3Q A;  3EZ0 A;  3SS2 A;  2KN9 A;  4TW3 A;  4DYU A;  5JKL A;  4TO9 A;  3VNX A;  5C6F A;  4ZMC A;  3EGM A;  4DYX A;  2CIH A;  2V3B B;  3RE7 A;  1LTL A;  1JKU A;  3AJQ A;  5J8W A;  4TOG A;  2G4H A;  1IRN A;  1SMM A;  2OH3 A;  2ZG7 X;  2BK6 A;  2WLU A;  4DI0 A;  1JYB A;  1R0G A;  1O9I A;  4AM2 A;  5JAC A;  2IU2 A;  1AEW A;  5K52 A;  5ERK A;  5CMQ A;  4AM5 A;  3QHC A;  3E1Q A;  2CHI A;  2QQY A;  4EVD A;  1YK5 A;  4II4 A;  1FHH A;  5IX6 A;  2WTL A;  1YK4 A;  2KKD A;  3E1J A;  3PWQ A;  5GU3 X;  4XKU A;  3O7R A;  2HTN A;  2GS4 A;  4PGI A;  3PZA A;  4MUD A;  3FI6 A;  5GU0 X;  2Z5P A;  5CZU A;  7RXN A;  2M4Y A;  3GVY A;  1S24 A;  2FG4 A;  4DAS A;  8RXN A;  3BVF A;  2V2S A;  3UOF A;  1F30 A;  3E1P A;  1YUX A;  2FL0 A;  3ISE A;  5LBH A;  2W0O A;  1QYB A;  3KA8 A;  4TOE A;  2FZF A;  1ZRP A;  5GN8 A;  5GN8 B;  5J8S A;  4IWJ A;  4Y08 A;  5JKM A;  3AJO A;  3E1N A;  3E1O A;  3RGD A;  2CN7 A;  2WLA A;  1RDV A;  3BVE A;  1LKM A;  1JI5 A;  3PWF A;  2CLU A;  1JKV A;  3R2L A;  4IWK A;  4CMY A;  3ISF A;  3TA8 A;  4PGK A;  4RC6 B;  4E6K A;  2QL0 A;  1Z6O A;  5ERJ A;  4M35 A;  1T9P A;  1IU6 A;  1T9Q A;  4LQV A;  4LQN A;  4RC5 B;  2JD6 0;  3AK8 A;  5D8O A;  2ZG9 X;  3ES3 A;  2BKC A;  3KA6 A;  1BCF A;  3SID A;  1XZ3 A;  5FFE A;  4ML5 A;  3RD0 A;  3WVW A;  4ZL6 A;  4MKU A;  4LQJ A;  1CAD A;  4YWL A;  3SHX A;  5J9V A;  3IQ1 A;  1YV1 A;  2C6R A;  3F33 A;  4U3G A;  1R03 A;  3H7G A;  3WVU A;  2ZUR X;  1RCD A;  4MJY A;  2VXX A;  2JD7 0;  4TOH A;  4LQH A;  1BE7 A;  4TPU A;  3GE4 A;  4II4 B;  5FFA A;  2X17 0;  3U90 A;  4TOB A;  2V2M A;  3F32 A;  2V2N A;  2IY4 A;  4CY9 A;  3KYY A;  2BW1 A;  1OTK A;  3T9J A;  4M34 A;  1RDG A;  2FFX J;  2VL6 A;  1LKP A;  5GOU A;  1TK6 A;  2C2J A;  3RBC A;  4XKS A;  5AXS A;  1B2J A;  4XGS A;  2LCQ A;  4YWM A;  3R2M A;  4ITW A;  4IXK A;  4ZTT A;  3SE1 A;  1H7V A;  2YW6 A;  4LPJ A;  3AK9 A;  3BVL A;  1DPS A;  3BVK A;  2V2I A;  4CVS A;  3KWO A;  4RC7 A;  4KVQ A;  5LS9 A;  1EUM A;  3E1M A;  1Z6O M;  2CF7 A;  2XGW A;  3KYU A;  3PW8 A;  2V2J A;  1IRO A;  1TKP A;  4CVR A;  4CYB A;  4DYY A;  1FHA A;  3HIU A;  2FKZ A;  2ZG8 X;  2ZA7 A;  1SQ3 A;  2V2R A;  5K53 A;  4ITT A;  5E2D A;  2DSX A;  1JGC A;  2C41 A;  3BKN A;  5JKL G;  3EZU A;  3RZ6 A;  1GWG A;  4TOD A;  4EVC A;  1VEI A;  3PVY B;  1RYT A;  1MFR A;  2C2F A;  2V2L A;  1VCX A;  1QCV A;  3E1L A;  4AR5 A;  2V2P A;  5IY0 A;  4TOF A;  1HRS A;  2FJC A;  4AM4 A;  1SMW A;  1BFR A;  3F35 A;  3QHB A;  1RB9 A;  4QUW A;  3F39 A;  5FFB A;  1NF4 A;  1ZUJ A;  1IU5 A;  3QD8 A;  1UMN A;  1DAT A;  3Q4Q A;  3QB9 A;  2CN6 A;  5LG2 A;  1O9R A;  1UVH A;  4ZKX A;  2ITB A;  1Z4A A;  3NOZ X;  2Y3Q A;  4KVS A;  1R0H A;  3PVY A;  2IB0 A;  1DVB A;  3A68 A;  5D8S A;  2Z5R A;  3UOI A;  5GU1 X;  1XZ1 A;  3WVV A;  3R2H A;  4RC7 B;  3BT5 A;  3UNO A;  5I4J A;  4AR3 A;  5D8Y A;  2FHA A;  1R0I A;  5LG8 A;  1R0F A;  4ZJK A;  1RCC A;  3E6S A;  3A44 A;  4POF A;  2V2O A;  4ERU A;  3Q4O A;  4XKT A;  1NF6 A;  2RDV A;  3KXU A;  3AF9 X;  1B2O A;  1F33 A;  5E1U A;  5FFD A;  4ISM A;  1C09 A;  3PVT A;  2PVX A;  3R2K A;  2ZA6 A;  3E6R A;  4DE6 A;  5HJH A;  2ZA8 A;  3RAV A;  1BG7 A;  3RZT A;  2YJJ A;  2OC5 A;  1L8I A;  1N1Q A;  3OJ5 A;  3PVR A;  1QGH A;  2XJO A;  1LB3 A;  3R2S A;  1RCG A;  4RXN A;  4TOC A;  4Z5S A;  3MPS A;  5AI2 A;  2CHP A;  1B71 A;  2HR5 A;  1CAA A;  5RXN A;  1BRF A;  1YUZ A;  1RCE A;  2XJN A;  1JI4 A;  3NP0 X;  4ISP A;  2YW7 A;  4TOA A;  4A25 A;  5HQO A;  5D8R A;  2Z90 A;  3AF7 X;  4P18 A;  4AR6 A;  1VEL A;  1IER A;  2V15 A;  4CYA A;  2CLB A;  3IS7 A;  3A9Q A;  4CVT A;  1VLG A;  3GHQ A;  4ZKH A;  3QZ3 A;  3KYX A;  5AI3 A;  3PW8 C;  1JRE A;  3KA3 A;  3AJP A;  4ZL5 A;  2UX1 A;  3KA9 A;  3OGH A;  3IS8 A;  4MN9 A;  1B13 A;  3O7S A;  2CEI A;  3PWQ C;  1JTS A;  5HJF A;  2D5K A;  1BQ9 A;  2FG8 A;  6RXN A;  3KYV A;  4K9F A;  4LYU A;  2PYB A;  3ERZ A;  4ZKW A;  3PW1 A;  2GYD A;  4R42 A;  2PYA A;  5J93 A;  2XKQ A;  4MY7 A;  1BQ8 A;  1NFV A;  4AR4 A;  3SH6 A;  3R2R A;  3WNW A;  4LPN A;  2MS3 A;  1JIG A;  3QVD A;  2BJY A;  5D8P A;  1VEQ A;  1DX8 A;  2VZB A;  4DYZ A;  3PVT B;  1S30 A;  4POG A;  1TKO A;  2K2D A;  4M33 A;  4CMY V;  5FEJ A;  1SOF A;  4EVB A;  4ME3 A;  2YJK A;  1E8J A;  2XJM A;  4OYN A;  4CVP A;  3RYG A;  4DZ0 A;  1ZS3 A;  3F36 A;  1IES A;  3PVR B;  1L8H A;  1KRQ A;  2VXI A;  1S2Z A;  3F38 A;  5FFC A;  2JD8 0;  5D8Q A;  4Z3B A;  2F7N A;  1RCI A;  1BFY A;  1J30 A;  3FVB A;  5D8X A;  2C2U A;  5JKM G;  4LPM A;  3E2C A;  1H96 A;  4M32 A;  4EVE A;  1R0J A;  1SMU A;  4PG0 A;  3FSE A;  3AF8 X;  1TJO A;  4PG1 A;  1NNQ A;  4REU A;  3F37 A; 
#chains in the Genus database with same CATH topology
 4AHZ A;  4ZLW A;  3LWQ B;  4WJG 4;  1TWA L;  4A3I L;  2Z6M A;  4ETR A;  2NVQ L;  2GYQ A;  4KVR A;  3CQZ L;  4YKH A;  2PSM C;  1VJX A;  5CMR A;  3Q4N A;  3R2O A;  3QQC E;  2Z5Q A;  2M6P A;  4QIW P;  4A3F L;  3J7Y 1;  3KX9 A;  2C6A A;  2PVE A;  2Z3Q B;  3KYW A;  2VUM L;  4RC6 A;  3BVI A;  3S1Q L;  1T9O A;  3KA4 A;  4A3E L;  1MOJ A;  3PW1 B;  2PPT A;  2GMG A;  1TWC L;  1FHM A;  2RBD A;  4RC8 A;  3NP2 X;  3HL1 A;  4RC5 A;  5GU2 X;  2B5I D;  1LKO A;  2QF9 A;  3F34 A;  4LYX A;  2ERS A;  3MSU A;  1RWD A;  1Z92 B;  2L0Z A;  3Q4R A;  5IP7 L;  1S3Q A;  3EZ0 A;  4C2M 1;  3SS2 A;  5AN9 H;  4C3I L;  2KN9 A;  4TW3 A;  4DYU A;  5JKL A;  1P7P A;  5M3M L;  4TO9 A;  3VNX A;  5C6F A;  4ZMC A;  3EGM A;  4DYX A;  2CIH A;  2V3B B;  3GTP L;  3PKI A;  1RYQ A;  3RE7 A;  1LTL A;  1JKU A;  3AJQ A;  2XJU A;  5J8W A;  4JAF A;  1Y1W L;  4TOG A;  2G4H A;  3V3K B;  1IRN A;  1SMM A;  1TWH L;  4BBR L;  2OH3 A;  2ZG7 X;  2RFK B;  2BK6 A;  2NVT L;  2WLU A;  4DI0 A;  1JYB A;  3C1Z A;  1R0G A;  2NVY L;  4AI3 A;  1O9I A;  4AM2 A;  5JAC A;  2IU2 A;  4A3B L;  1AEW A;  5GAH c;  5K52 A;  5ERK A;  4BXX L;  5CMQ A;  2E2I L;  4AM5 A;  3B0A B;  3QHC A;  3E1Q A;  3JZA B;  2CHI A;  3LNL A;  2QQY A;  4A3J L;  4EVD A;  1YK5 A;  4II4 A;  1FHH A;  5C44 L;  5IX6 A;  2WTL A;  1YK4 A;  2KKD A;  5JDO B;  5IP9 L;  5JVG 1;  3E1J A;  2E2H L;  3PWQ A;  5GU3 X;  3HOW L;  4A3D L;  4XKU A;  3S14 L;  3O7R A;  2HTN A;  2GS4 A;  2AYJ A;  3D19 A;  3PZA A;  4MUD A;  4PGI A;  3FI6 A;  5GU0 X;  2Z5P A;  5CZU A;  2N02 A;  7RXN A;  1IW7 D;  2M4Y A;  3GVY A;  5IYD L;  5MFZ A;  1S24 A;  2FG4 A;  4DAS A;  8RXN A;  3BVF A;  2V2S A;  3UOF A;  1PFV A;  3M6J A;  1F30 A;  3E1P A;  1YUX A;  2FL0 A;  3ISE A;  5LBH A;  5IYB L;  2W0O A;  1QYB A;  3KA8 A;  4TOE A;  2NYD A;  2FZF A;  1ZRP A;  5GN8 A;  5GN8 B;  5J8S A;  3I4N L;  4YVZ A;  4IWJ A;  3LPE B;  4Y08 A;  5JKM A;  3AJO A;  3E1N A;  3E1O A;  3RGD A;  2CN7 A;  2WLA A;  1RDV A;  3BVE A;  4ZN1 B;  1LKM A;  1JI5 A;  2EY4 E;  4A3G L;  5HU6 D;  3PWF A;  2CLU A;  1JKV A;  3R2L A;  4IWK A;  4CMY A;  1F4L A;  5MLC 3;  3ISF A;  3TA8 A;  4PGK A;  1PZX A;  4RC6 B;  4E6K A;  2QL0 A;  3L0M A;  1Z6O A;  5ERJ A;  4C3H L;  4M35 A;  1T9P A;  1IU6 A;  1T9Q A;  4LQV A;  4LQN A;  4RC5 B;  2JD6 0;  3AK8 A;  2MGY A;  5D8O A;  2CKA A;  2ZG9 X;  4C3J L;  3ES3 A;  2BKC A;  2B63 L;  3KA6 A;  1BCF A;  3SID A;  3W54 A;  1XZ3 A;  3PO2 L;  5GAD c;  5FFE A;  4ML5 A;  3RD0 A;  3WVW A;  4ZL6 A;  2APO B;  4MKU A;  4E6Y A;  4LQJ A;  1CAD A;  4YWL A;  3SHX A;  1Y1V L;  2ERJ A;  5J9V A;  3IQ1 A;  1WCM L;  1YV1 A;  2C6R A;  3F33 A;  3P2A A;  4Y7N L;  4U3G A;  5C4J L;  2R93 L;  1R03 A;  3H7G A;  1VZG A;  3WVU A;  2ZUR X;  3PL5 A;  3K7A L;  5IYC L;  5DM7 1;  1RCD A;  3S2H L;  2O5J D;  4MJY A;  2VXX A;  2JD7 0;  4TOH A;  4LQH A;  1BE7 A;  4ZN3 B;  5M5Y L;  4TPU A;  3GE4 A;  4II4 B;  5H1S c;  4XXB B;  5FFA A;  2X17 0;  3S16 L;  3U90 A;  1PFW A;  4TOB A;  2V2M A;  3F32 A;  3H99 A;  4A3K L;  3M3Y L;  2V2N A;  2IY4 A;  4CY9 A;  3KYY A;  2BW1 A;  2CWL A;  1OTK A;  3T9J A;  4M34 A;  1RDG A;  2FFX J;  5EIN C;  2Y44 A;  2VL6 A;  1LKP A;  5M5W L;  5GOU A;  1TK6 A;  2C2J A;  3RBC A;  4XKS A;  5AXS A;  1B2J A;  2NVX L;  4XGS A;  2LCQ A;  4YWM A;  3R2M A;  4ITW A;  4IXK A;  2XJV A;  4ZTT A;  3SE1 A;  4AHY A;  1H7V A;  2YW6 A;  4LPJ A;  3AK9 A;  3BVL A;  1DPS A;  3S1M L;  3BVK A;  4YXM A;  4BBS L;  2V2I A;  4CVS A;  3KWO A;  4RC7 A;  4KVQ A;  5LS9 A;  1EUM A;  1I6H L;  3E1M A;  1Z6O M;  2CF7 A;  2XGW A;  3KHK A;  4E40 A;  2CKC A;  2XJP A;  3KYU A;  3PW8 A;  5EIO C;  1R9T L;  2AUS B;  3S1R L;  2V2J A;  1IRO A;  1TKP A;  4CVR A;  5MF6 A;  4CYB A;  3GGZ A;  3GTK L;  4DYY A;  1FHA A;  3HIU A;  2H12 A;  1K83 L;  2FKZ A;  2Y0S P;  2ZG8 X;  2ZA7 A;  4GS7 D;  1SQ3 A;  2V2R A;  5K53 A;  4ITT A;  5E2D A;  1OWC A;  2DSX A;  1JGC A;  3N6O A;  2C41 A;  2A69 D;  4AHW A;  3BKN A;  5JKL G;  3C21 A;  3EZU A;  3S1N L;  3RZ6 A;  5JVH 1;  1GWG A;  4A93 L;  3HOU L;  4MXP A;  4TOD A;  3LWO B;  4EVC A;  1VZI A;  1VEI A;  3PVY B;  2AQC A;  2R92 L;  1RYT A;  1MFR A;  4AHX A;  2C2F A;  3HOX L;  2V2L A;  3FDJ A;  1VCX A;  3C23 A;  4AI2 A;  1QCV A;  4LHL A;  1PFU A;  3E1L A;  3PKJ A;  4AR5 A;  3KDQ A;  2V2P A;  2JI1 A;  5IY0 A;  4TOF A;  4AI1 A;  1TWF L;  1HRS A;  2FJC A;  3LWV B;  3LKD A;  4AM4 A;  1ODH A;  2E2J L;  3S15 L;  1SMW A;  1BFR A;  3F35 A;  3QHB A;  1RB9 A;  5M5X L;  4QUW A;  2V0F A;  3S2D L;  3F39 A;  5FFB A;  5FLM L;  1NF4 A;  4A3C L;  3C1Y A;  1ZUJ A;  4G6B A;  1IU5 A;  3GTO L;  3HOY L;  3QD8 A;  1UMN A;  5C3E L;  1DAT A;  3Q4Q A;  3QB9 A;  2XJS A;  3HOV L;  2CN6 A;  5LG2 A;  4U67 1;  3H9C A;  1O9R A;  1UVH A;  4ZKX A;  3PIO 1;  4BY1 L;  3GTG L;  4BY7 L;  2ITB A;  1Z4A A;  4AI0 A;  4A3M L;  2V0E A;  3S17 L;  2BE5 D;  2WWX B;  4AYB P;  3NOZ X;  2Y3Q A;  4KVS A;  3K35 A;  3PVY A;  1R0H A;  2IB0 A;  1DVB A;  2M4V A;  3A68 A;  5D8S A;  2Z5R A;  2OKC A;  3UOI A;  5GU1 X;  1XZ1 A;  3WVV A;  3R2H A;  4RC7 B;  3BT5 A;  3UNO A;  2V8T A;  5I4J A;  4WFN 1;  1SFO L;  4AR3 A;  5D8Y A;  3GTL L;  2FHA A;  1R0I A;  5LG8 A;  1R0F A;  1VZH A;  4ZJK A;  1RCC A;  3E6S A;  4JAD A;  2XJT A;  2A6E D;  3A44 A;  4LHN A;  4POF A;  2V2O A;  4ERU A;  5M3F L;  3Q4O A;  4XKT A;  1NF6 A;  2RDV A;  2HVY C;  3VPB E;  3KXU A;  3AF9 X;  1B2O A;  1F33 A;  1OWB A;  5E1U A;  5FFD A;  4ISM A;  1C09 A;  3PVT A;  2PVX A;  3PIP 1;  3R2K A;  1NXE A;  2ZA6 A;  3E6R A;  4DE6 A;  1NXG A;  5HJH A;  4Y52 L;  2ZA8 A;  3RAV A;  2A6H D;  4JAG A;  2V8U A;  1BG7 A;  3RZT A;  4B8C D;  2YJJ A;  2OC5 A;  1L8I A;  3JR7 A;  1N1Q A;  3H97 A;  3OJ5 A;  3PVR A;  1QGH A;  3NFP I;  4UY8 1;  2XJO A;  3DBY A;  3FRS A;  2XJR A;  3J7Z 1;  1LB3 A;  3R2S A;  1RCG A;  2A68 D;  3WWL A;  3GTJ L;  4RXN A;  4TOC A;  3WWN B;  4Z5S A;  3H3V M;  2JA6 L;  3HJY B;  3MQK B;  4JAE A;  3MPS A;  5AI2 A;  2CHP A;  3GTQ L;  1B71 A;  2HR5 A;  1CAA A;  5RXN A;  1BRF A;  1YUZ A;  2G38 B;  1RCE A;  2XJN A;  1JI4 A;  3NP0 X;  4ISP A;  2YW7 A;  4TOA A;  4A25 A;  3GTM L;  3PO3 L;  5HQO A;  5D8R A;  2Z90 A;  3AF7 X;  4P18 A;  4AR6 A;  3UFB A;  1WJV A;  1VEL A;  1IER A;  2V15 A;  4CYA A;  2CLB A;  3IS7 A;  3A9Q A;  4CVT A;  1VLG A;  3GHQ A;  3GGY A;  3QZ3 A;  4ZKH A;  5MFP A;  3KYX A;  2JA8 L;  5AI3 A;  4KXR B;  3PW8 C;  1JRE A;  3KA3 A;  3AJP A;  4ZL5 A;  2UX1 A;  3IU3 I;  3KA9 A;  3OGH A;  4V19 6;  3IS8 A;  4MN9 A;  1B13 A;  3O7S A;  3H9B A;  2CEI A;  3PWQ C;  1JTS A;  5MGN A;  5GAG c;  5HJF A;  2D5K A;  1BQ9 A;  2FG8 A;  6RXN A;  1I50 L;  2JI2 A;  3KYV A;  4LYU A;  4K9F A;  2PYB A;  3ERZ A;  4ZKW A;  3M4O L;  4X6A L;  2AR0 A;  1QQT A;  3PW1 A;  2GYD A;  4R42 A;  2PYA A;  2WAQ P;  5J93 A;  3HAX C;  2XKQ A;  4MY7 A;  1BQ8 A;  4A3L L;  2J9U B;  3P8B A;  1NFV A;  4AR4 A;  3SH6 A;  4W4L B;  3R2R A;  3I4M L;  3WNW A;  4LPN A;  1I3Q L;  2MS3 A;  1JIG A;  4TVM A;  2CR8 A;  3JZ9 A;  3QVD A;  2BJY A;  5D8P A;  1VEQ A;  1DX8 A;  2VZB A;  3HJW B;  5K2M E;  4DYZ A;  3PVT B;  2R7Z L;  3B08 B;  1S30 A;  4POG A;  1TKO A;  2M6O A;  3FRR A;  2K2D A;  4M33 A;  3RZD L;  2ZIX A;  3LWR B;  4CMY V;  5FEJ A;  1SOF A;  4EVB A;  4ME3 A;  2YJK A;  2JA7 L;  1E8J A;  2XJM A;  3LWP B;  4OYN A;  4CVP A;  3RYG A;  4DZ0 A;  4W4K B;  2JI3 A;  5DM6 1;  1ZS3 A;  3F36 A;  2JA5 L;  1IES A;  3PVR B;  1TWG L;  1L8H A;  2Z3R B;  1KRQ A;  2VXI A;  3RZO L;  1S2Z A;  3VVA A;  2PMZ P;  3F38 A;  3H0G L;  5FFC A;  3HKZ P;  2JD8 0;  5GAE c;  5JDO A;  1PFY A;  5D8Q A;  4Z3B A;  2F7N A;  1RCI A;  2WB1 P;  5C4X L;  1BFY A;  1J30 A;  3FVB A;  5D8X A;  5FJ8 L;  2C2U A;  4X0J A;  3ZG6 A;  5JKM G;  4LPM A;  3E2C A;  2XJQ A;  4XGH A;  3HOZ L;  1H96 A;  3FKI L;  4M32 A;  2YU9 L;  4EVE A;  1R0J A;  3VV9 A;  4YXJ A;  1SMU A;  4PG0 A;  3FSE A;  3AF8 X;  1TJO A;  4PG1 A;  2C6B A;  1NNQ A;  4REU A;  3F37 A; 
#chains in the Genus database with same CATH homology
 4AHZ A;  4ZLW A;  4WJG 4;  2Z6M A;  4ETR A;  2GYQ A;  4KVR A;  4YKH A;  2PSM C;  1VJX A;  5CMR A;  3Q4N A;  3R2O A;  3QQC E;  2Z5Q A;  2M6P A;  3J7Y 1;  3KX9 A;  2C6A A;  2PVE A;  3KYW A;  4RC6 A;  3BVI A;  1T9O A;  3KA4 A;  1MOJ A;  3PW1 B;  2PPT A;  2GMG A;  1FHM A;  2RBD A;  4RC8 A;  3NP2 X;  3HL1 A;  4RC5 A;  5GU2 X;  2B5I D;  1LKO A;  2QF9 A;  3F34 A;  4LYX A;  2ERS A;  3MSU A;  1RWD A;  1Z92 B;  2L0Z A;  3Q4R A;  1S3Q A;  3EZ0 A;  3SS2 A;  5AN9 H;  2KN9 A;  4TW3 A;  4DYU A;  5JKL A;  4TO9 A;  3VNX A;  5C6F A;  4ZMC A;  3EGM A;  4DYX A;  2CIH A;  2V3B B;  3PKI A;  1RYQ A;  3RE7 A;  1LTL A;  1JKU A;  3AJQ A;  2XJU A;  5J8W A;  4JAF A;  4TOG A;  2G4H A;  3V3K B;  1IRN A;  1SMM A;  2OH3 A;  2ZG7 X;  2BK6 A;  2WLU A;  4DI0 A;  1JYB A;  3C1Z A;  1R0G A;  4AI3 A;  1O9I A;  4AM2 A;  5JAC A;  2IU2 A;  1AEW A;  5GAH c;  5K52 A;  5ERK A;  5CMQ A;  4AM5 A;  3B0A B;  3QHC A;  3E1Q A;  3JZA B;  2CHI A;  3LNL A;  2QQY A;  4EVD A;  1YK5 A;  4II4 A;  1FHH A;  5IX6 A;  2WTL A;  1YK4 A;  2KKD A;  5JDO B;  5JVG 1;  3E1J A;  3PWQ A;  5GU3 X;  4XKU A;  3O7R A;  2HTN A;  2GS4 A;  2AYJ A;  3D19 A;  3PZA A;  4MUD A;  4PGI A;  3FI6 A;  5GU0 X;  2Z5P A;  5CZU A;  2N02 A;  7RXN A;  1IW7 D;  2M4Y A;  3GVY A;  5MFZ A;  1S24 A;  2FG4 A;  4DAS A;  8RXN A;  3BVF A;  2V2S A;  3UOF A;  2Z3Q B;  3M6J A;  1F30 A;  3E1P A;  1YUX A;  2FL0 A;  3ISE A;  5LBH A;  2W0O A;  1QYB A;  3KA8 A;  4TOE A;  2NYD A;  2FZF A;  1ZRP A;  5GN8 A;  5GN8 B;  5J8S A;  4YVZ A;  4IWJ A;  3LPE B;  4Y08 A;  5JKM A;  3AJO A;  3E1N A;  3E1O A;  3RGD A;  2CN7 A;  2WLA A;  1RDV A;  3BVE A;  4ZN1 B;  1LKM A;  1JI5 A;  5HU6 D;  3PWF A;  2CLU A;  1JKV A;  3R2L A;  4IWK A;  4CMY A;  5MLC 3;  3ISF A;  3TA8 A;  4PGK A;  4RC6 B;  4E6K A;  2QL0 A;  3L0M A;  1Z6O A;  5ERJ A;  4M35 A;  1T9P A;  1IU6 A;  1T9Q A;  4LQV A;  4LQN A;  4RC5 B;  2JD6 0;  3AK8 A;  2MGY A;  5D8O A;  2CKA A;  2ZG9 X;  3ES3 A;  2BKC A;  3KA6 A;  1BCF A;  3SID A;  3W54 A;  1XZ3 A;  5GAD c;  5FFE A;  4ML5 A;  3RD0 A;  3WVW A;  4ZL6 A;  4MKU A;  4E6Y A;  4LQJ A;  1CAD A;  4YWL A;  3SHX A;  2ERJ A;  5J9V A;  3IQ1 A;  3P2A A;  1YV1 A;  2C6R A;  3F33 A;  4U3G A;  1R03 A;  3H7G A;  1VZG A;  3WVU A;  2ZUR X;  5DM7 1;  1RCD A;  2O5J D;  4MJY A;  2VXX A;  2JD7 0;  4TOH A;  4LQH A;  1BE7 A;  4ZN3 B;  4TPU A;  3GE4 A;  4II4 B;  5H1S c;  4XXB B;  5FFA A;  2X17 0;  3U90 A;  4TOB A;  2V2M A;  3F32 A;  2V2N A;  2IY4 A;  4CY9 A;  3KYY A;  2BW1 A;  2CWL A;  1OTK A;  3T9J A;  4M34 A;  1RDG A;  2FFX J;  5EIN C;  2Y44 A;  2VL6 A;  1LKP A;  5GOU A;  1TK6 A;  2C2J A;  3RBC A;  4XKS A;  5AXS A;  1B2J A;  4XGS A;  2LCQ A;  4YWM A;  3R2M A;  4ITW A;  4IXK A;  2XJV A;  4ZTT A;  3SE1 A;  4AHY A;  1H7V A;  2YW6 A;  4LPJ A;  3AK9 A;  3BVL A;  1DPS A;  3BVK A;  4YXM A;  2V2I A;  4CVS A;  3KWO A;  4RC7 A;  4KVQ A;  5LS9 A;  1EUM A;  3E1M A;  1Z6O M;  2CF7 A;  2XGW A;  3KHK A;  4E40 A;  2CKC A;  2XJP A;  3KYU A;  3PW8 A;  5EIO C;  2V2J A;  1IRO A;  1TKP A;  4CVR A;  5MF6 A;  4CYB A;  3GGZ A;  4DYY A;  1FHA A;  3HIU A;  2H12 A;  2FKZ A;  2ZG8 X;  2ZA7 A;  4GS7 D;  1SQ3 A;  2V2R A;  5K53 A;  4ITT A;  5E2D A;  1OWC A;  2DSX A;  1JGC A;  3N6O A;  2C41 A;  2A69 D;  4AHW A;  3BKN A;  5JKL G;  3C21 A;  3EZU A;  3RZ6 A;  5JVH 1;  1GWG A;  4MXP A;  4TOD A;  4EVC A;  1VZI A;  1VEI A;  3PVY B;  1RYT A;  1MFR A;  4AHX A;  2C2F A;  2V2L A;  1VCX A;  3C23 A;  4AI2 A;  1QCV A;  4LHL A;  3E1L A;  3PKJ A;  4AR5 A;  3KDQ A;  2V2P A;  2JI1 A;  5IY0 A;  4TOF A;  4AI1 A;  1HRS A;  2FJC A;  3LKD A;  4AM4 A;  1ODH A;  1SMW A;  1BFR A;  3F35 A;  3QHB A;  1RB9 A;  4QUW A;  2V0F A;  3F39 A;  5FFB A;  1NF4 A;  3C1Y A;  1ZUJ A;  4G6B A;  1IU5 A;  3QD8 A;  1UMN A;  1DAT A;  3Q4Q A;  3QB9 A;  2XJS A;  2CN6 A;  5LG2 A;  4U67 1;  1O9R A;  1UVH A;  4ZKX A;  3PIO 1;  2ITB A;  1Z4A A;  4AI0 A;  2V0E A;  2BE5 D;  2WWX B;  3NOZ X;  2Y3Q A;  4KVS A;  3K35 A;  3PVY A;  1R0H A;  2IB0 A;  1DVB A;  2M4V A;  3A68 A;  5D8S A;  2Z5R A;  2OKC A;  3UOI A;  5GU1 X;  1XZ1 A;  3WVV A;  3R2H A;  4RC7 B;  3BT5 A;  3UNO A;  2V8T A;  5I4J A;  4WFN 1;  4AR3 A;  5D8Y A;  2FHA A;  1R0I A;  5LG8 A;  1R0F A;  1VZH A;  4ZJK A;  1RCC A;  3E6S A;  4JAD A;  2XJT A;  2A6E D;  3A44 A;  4LHN A;  4POF A;  2V2O A;  4ERU A;  3Q4O A;  4XKT A;  1NF6 A;  2RDV A;  3VPB E;  3KXU A;  3AF9 X;  1B2O A;  1F33 A;  1OWB A;  5E1U A;  5FFD A;  4ISM A;  1C09 A;  3PVT A;  2PVX A;  3PIP 1;  3R2K A;  1NXE A;  2ZA6 A;  3E6R A;  4DE6 A;  1NXG A;  5HJH A;  2ZA8 A;  3RAV A;  2A6H D;  4JAG A;  2V8U A;  1BG7 A;  3RZT A;  4B8C D;  2YJJ A;  2OC5 A;  1L8I A;  1N1Q A;  3OJ5 A;  3PVR A;  1QGH A;  3NFP I;  4UY8 1;  2XJO A;  3DBY A;  3FRS A;  2XJR A;  3J7Z 1;  1LB3 A;  3R2S A;  1RCG A;  2A68 D;  3WWL A;  4RXN A;  4TOC A;  3WWN B;  4Z5S A;  4JAE A;  3MPS A;  5AI2 A;  2CHP A;  1B71 A;  2HR5 A;  1CAA A;  5RXN A;  1BRF A;  1YUZ A;  2G38 B;  1RCE A;  2XJN A;  1JI4 A;  3NP0 X;  4ISP A;  2YW7 A;  4TOA A;  4A25 A;  5HQO A;  5D8R A;  2Z90 A;  3AF7 X;  4P18 A;  4AR6 A;  3UFB A;  1WJV A;  1VEL A;  1IER A;  2V15 A;  4CYA A;  2CLB A;  3IS7 A;  3A9Q A;  4CVT A;  1VLG A;  3GHQ A;  3GGY A;  3QZ3 A;  4ZKH A;  5MFP A;  3KYX A;  5AI3 A;  4KXR B;  3PW8 C;  1JRE A;  3KA3 A;  3AJP A;  4ZL5 A;  2UX1 A;  3IU3 I;  3KA9 A;  3OGH A;  4V19 6;  3IS8 A;  4MN9 A;  1B13 A;  3O7S A;  2CEI A;  3PWQ C;  1JTS A;  5MGN A;  5GAG c;  5HJF A;  2D5K A;  1BQ9 A;  2FG8 A;  6RXN A;  2JI2 A;  3KYV A;  4K9F A;  4LYU A;  2PYB A;  3ERZ A;  4ZKW A;  2AR0 A;  3PW1 A;  2GYD A;  4R42 A;  2PYA A;  5J93 A;  2XKQ A;  4MY7 A;  1BQ8 A;  2J9U B;  3P8B A;  1NFV A;  4AR4 A;  3SH6 A;  4W4L B;  3R2R A;  3WNW A;  4LPN A;  2MS3 A;  1JIG A;  4TVM A;  2CR8 A;  3JZ9 A;  3QVD A;  2BJY A;  5D8P A;  1VEQ A;  1DX8 A;  2VZB A;  5K2M E;  4DYZ A;  3PVT B;  3B08 B;  1S30 A;  4POG A;  1TKO A;  2M6O A;  3FRR A;  2K2D A;  4M33 A;  2ZIX A;  4CMY V;  5FEJ A;  1SOF A;  4EVB A;  4ME3 A;  2YJK A;  1E8J A;  2XJM A;  4OYN A;  4CVP A;  3RYG A;  4DZ0 A;  4W4K B;  2JI3 A;  5DM6 1;  1ZS3 A;  3F36 A;  1IES A;  3PVR B;  1L8H A;  2Z3R B;  1KRQ A;  2VXI A;  1S2Z A;  3VVA A;  3F38 A;  5FFC A;  2JD8 0;  5GAE c;  5JDO A;  5D8Q A;  4Z3B A;  2F7N A;  1RCI A;  1BFY A;  1J30 A;  3FVB A;  5D8X A;  2C2U A;  4X0J A;  3ZG6 A;  5JKM G;  4LPM A;  3E2C A;  2XJQ A;  4XGH A;  1H96 A;  4M32 A;  4EVE A;  1R0J A;  3VV9 A;  4YXJ A;  1SMU A;  4PG0 A;  3FSE A;  3AF8 X;  1TJO A;  4PG1 A;  2C6B A;  1NNQ A;  4REU A;  3F37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...