1NNQA

Rubrerythrin from pyrococcus furiosus pfu-1210814
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title Structural genomics of Pyrococcus furiosus: X-ray crystallography reveals 3D domain swapping in rubrerythrin
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 60
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1nnqA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1nnqA02
4LPNA 3QHBA 5HJHA 3O7RA 3WVWA 3Q4OA 3BVKA 4EVEA 4ETRA 1DX8A 4Y08A 1RCDA 1B71A 3PWQA 3NP0X 4ZL5A 1NFVA 3A44A 3HL1A 2GS4A 4POFA 4MN9A 4TOBA 4CMYV 1S3QA 3KYXA 1J30A 4OYNA 5GU3X 3MPSA 4M35A 5CMRA 1JKUA 1LTLA 2RDVA 4RC7B 4II4B 5D8SA 4PG0A 4RC5B 1NF6A 4AR4A 5E2DA 1RWDA 4LQJA 1R0HA 1MOJA 1E8JA 3SHXA 4CYBA 2FFXJ 2IB0A 4YKHA 2OH3A 2QL0A 4ITWA 3FSEA 5JACA 1EUMA 2OC5A 4POGA 5CZUA 2KKDA 3QD8A 3AF9X 3NP2X 3PWFA 3FI6A 3R2SA 1XZ3A 5HQOA 5IX6A 1VEQA 4REUA 3ISFA 5HJFA 2V2OA 3Q4QA 2X170 2ZA8A 1BRFA 1QCVA 2BKCA 2M4YA 2K2DA 2C2JA 4LPMA 5FFAA 4ML5A 7RXNA 3KA6A 3QB9A 2BJYA 3FVBA 3R2RA 1SQ3A 3BT5A 3GE4A 2ZG8X 3E6RA 5AI3A 2YW6A 3O7SA 4AR3A 3Q4RA 2WLAA 1T9PA 2PVEA 5FFCA 4II4A 3T9JA 3PVTA 4DI0A 4CVPA 5CMQA 2XKQA 3F35A 4RC5A 1R0FA 1IERA 3E1MA 2W0OA 5JKLG 3F37A 3E1NA 3Q4NA 1Z6OM 2V2SA 4ZLWA 1LKPA 3KA8A 3RE7A 1SMMA 4DZ0A 3EGMA 1BCFA 5D8RA 4ISMA 1IROA 3KX9A 4DE6A 3IS7A 6RXNA 3AJOA 1VLGA 2V2IA 2HR5A 1ZS3A 1YK5A 1F33A 2CHIA 4LPJA 1Z4AA 3BVLA 5I4JA 1LB3A 1RCEA 4CYAA 2V3BB 2FG8A 5D8YA 2VZBA 1F30A 2G4HA 3PW1B 3VNXA 5D8OA 3RZ6A 3A68A 1B13A 1IESA 3KYUA 3UOIA 1S2ZA 2WLUA 1MFRA 1JI4A 1VEIA 1S30A 2V2PA 1SMUA 4ME3A 3OGHA 5K52A 2C2UA 5ERJA 2CLBA 5GU1X 4TOEA 3RZTA 4DYYA 2ZA7A 4RXNA 1CADA 3U90A 3E1PA 2VXIA 3F34A 3E1JA 4TOGA 4ERUA 1R0GA 8RXNA 3UOFA 3KYVA 2F7NA 3SIDA 1R03A 2CN7A 2JD60 1OTKA 3RYGA 4ZTTA 2XJNA 4RC6B 5AI2A 3KA9A 2PYAA 4AR5A 1JTSA 5FFDA 1BFYA 2PYBA 1O9RA 5D8QA 1B2JA 1IU5A 1BFRA 4XKTA 2CIHA 3KXUA 1JKVA 1UVHA 3KYWA 3F33A 1JGCA 5J93A 3PW8C 4ZKWA 5LG2A 1FHAA 3AF8X 1L8IA 4LQHA 2RBDA 4LQNA 4TW3A 3HIUA 1HRSA 2QF9A 4K9FA 1KRQA 2Z90A 2FHAA 5E1UA 3RD0A 4PG1A 3OJ5A 4KVSA 1CAAA 2V15A 1GWGA 5D8XA 4AM5A 2KN9A 1DPSA 4IXKA 4KVQA 3RAVA 3QVDA 4DYUA 1VELA 4DYZA 5D8PA 3AF7X 3E1OA 5RXNA 4ISPA 2QQYA 1IRNA 5JKLA 4EVCA 2GYDA 4TOCA 1BE7A 4RC7A 2CLUA 1TJOA 2V2MA 3GVYA 3SH6A 1T9OA 3R2KA 4AM2A 2YJKA 1O9IA 2JD70 2Z5PA 4ITTA 2CHPA 2DSXA 4PGIA 1NNQA 2JD80 3TA8A 3F36A 2Z5QA 3PZAA 3R2HA 5FFBA 3PVYB 3KYYA 1YV1A 2BK6A 3PVRB 1UMNA 4R42A 2V2LA 4Z5SA 2GYQA 3R2MA 2IY4A 3R2OA 1ZRPA 4E6KA 2C6RA 1L8HA 3PW8A 5GN8B 1TKOA 3R2LA 5J8SA 2V2RA 3AK8A 2D5KA 3UNOA 1SMWA 3F39A 3RBCA 2HTNA 4TOAA 2CN6A 3AJPA 3EZUA 1JI5A 1JREA 1DATA 4DYXA 1IU6A 2FZFA 1RCCA 3WVUA 3SS2A 4U3GA 4AR6A 2Y3QA 3E1QA 2FKZA 3E1LA 2C2FA 5FFEA 5GOUA 2BW1A 4AM4A 5LG8A 4M34A 5LS9A 5LBHA 3WVVA 2C41A 4CVRA 4EVBA 4IWKA 3KA4A 4CVSA 3QZ3A 1BQ9A 5ERKA 2VL6A 2CEIA 5K53A 4MY7A 5J8WA 1R0IA 3QHCA 5AXSA 1C09A 3BVFA 4XGSA 1RDGA 2V2JA 4TO9A 5FEJA 3PVYA 1T9QA 4ZL6A 2Z6MA 1YK4A 2FL0A 3BVIA 3BVEA 2FG4A 2ZA6A 4P18A 3PVRA 1QYBA 2LCQA 1RYTA 2XJOA 4YWMA 3WNWA 1SOFA 2UX1A 1Z6OA 3PVTB 4KVRA 1VJXA 2V2NA 1NF4A 3F38A 4LYUA 3GHQA 4XKSA 3SE1A 4YWLA 5GN8A 4ZKXA 1FHHA 1RDVA 4CY9A 4MUDA 2MS3A 4CMYA 5J9VA 1YUXA 2FJCA 1B2OA 1JYBA 3E6SA 1ZUJA 4DASA 1TKPA 1LKOA 1TK6A 2WTLA 4TODA 2CF7A 3KWOA 3PW1A 1JIGA 3ISEA 5GU2X 3KA3A 1DVBA 3BKNA 4ZMCA 2YW7A 2IU2A 2XJMA 1QGHA 1BQ8A 1RCIA 4MKUA 4LQVA 3PWQC 5GU0X 3IS8A 4ZJKA 2ZG7X 3EZ0A 2GMGA 2Z5RA 3A9QA 1N1QA 2YJJA 1H7VA 1LKMA 3F32A 4Z3BA 1YUZA 1H96A 3E2CA 2ZURX 2PVXA 1VCXA 4PGKA 4RC6A 1RB9A 5JKMA 4M33A 3RGDA 4TOHA 4RC8A 4MJYA 3ES3A 4XKUA 1XZ1A 2XGWA 5C6FA 2ITBA 4A25A 3IQ1A 5JKMG 3NOZX 4EVDA 4QUWA 5IY0A 4LYXA 2ZG9X 4IWJA 1R0JA 4TPUA 2VXXA 3AJQA 3ERZA 4TOFA 1BG7A 1RCGA 4M32A 3AK9A 4CVTA 1FHMA 1S24A 3H7GA 4ZKHA 1AEWA
chains in the Genus database with same CATH superfamily
3S15L 3J7Y1 2L0ZA 4LPNA 3QHBA 5HJHA 3O7RA 3WVWA 2PSMC 3Q4OA 3P2AA 3BVKA 3PL5A 4EVEA 4ETRA 1DX8A 5MGNA 4Y08A 1RCDA 2V8TA 1B71A 3PWQA 3NP0X 4ZL5A 3HOZL 1NXGA 2JI2A 3LWOB 1NFVA 1PFUA 3A44A 3HL1A 3JZ9A 2GS4A 4POFA 4MN9A 4TOBA 4CMYV 1S3QA 3KYXA 3S1ML 4BBSL 1SFOL 3HJWB 1J30A 4OYNA 5GU3X 3MPSA 1TWGL 4A3LL 4M35A 5CMRA 1I50L 1JKUA 4AI3A 2O5JD 1LTLA 2RDVA 4RC7B 3HOVL 2V0EA 4II4B 2BE5D 4JAEA 3FRRA 5D8SA 4PG0A 4RC5B 1P7PA 1NF6A 3PKJA 4AR4A 2ERJA 5E2DA 1RWDA 2CR8A 4LQJA 1R0HA 1NXEA 1MOJA 3L0MA 1E8JA 3LKDA 3SHXA 3LWRB 4CYBA 2FFXJ 2V0FA 2IB0A 2OKCA 4YKHA 4BXXL 2OH3A 2QL0A 4ITWA 3HJYB 3FSEA 5IYDL 5JACA 1EUMA 3VPBE 2OC5A 5C4JL 4POGA 3PKIA 5CZUA 2KKDA 3QD8A 3AF9X 3NP2X 3PWFA 5M3ML 5EIOC 3H3VM 3FI6A 3R2SA 1XZ3A 5HQOA 5IX6A 1VEQA 2MGYA 2Z3RB 4REUA 3KHKA 3ISFA 5HJFA 2V2OA 2PPTA 4MXPA 5IYCL 3Q4QA 2APOB 2X170 3FRSA 2ZA8A 3H97A 1BRFA 1PFYA 2R93L 3S14L 1QCVA 4AHYA 2BKCA 2M4YA 2K2DA 4C3IL 2C2JA 4W4LB 4LPMA 4C3HL 5FFAA 2JA7L 4A93L 4ML5A 7RXNA 3KA6A 3QB9A 2BJYA 3FVBA 3R2RA 3C1YA 5FLML 1SQ3A 3BT5A 3GE4A 2ZG8X 3E6RA 5MFZA 3S17L 2XJQA 5AI3A 2YW6A 3O7SA 4AR3A 3Q4RA 2WLAA 5HU6D 3LPEB 4A3EL 3LWPB 1T9PA 1TWCL 5JDOB 5FFCA 2PVEA 3H9BA 3S2HL 4II4A 3T9JA 3PVTA 4DI0A 4CVPA 3LNLA 3HOUL 5CMQA 2XKQA 3F35A 4RC5A 1R0FA 1IERA 3HOWL 3E1MA 2W0OA 5M5YL 5JKLG 3F37A 3E1NA 5IYBL 3GTJL 3Q4NA 1Z6OM 2R92L 2NVQL 5JVG1 2V2SA 4ZLWA 1LKPA 3KA8A 3RE7A 4AHXA 1SMMA 4AYBP 4A3BL 4DZ0A 3EGMA 1Y1WL 1BCFA 1TWFL 5D8RA 4ISMA 1IROA 3KX9A 4DE6A 3IS7A 6RXNA 2WWXB 3AJOA 1VLGA 1PFVA 2V2IA 2HR5A 1ZS3A 2Y44A 1F33A 1YK5A 3S1QL 2CHIA 4TVMA 3M6JA 4LPJA 2H12A 3PIP1 1Z4AA 3BVLA 5M5XL 4AI1A 3GTOL 5I4JA 1LB3A 5MF6A 4BY1L 1RCEA 4CYAA 2A69D 2V3BB 2FG8A 5D8YA 2N02A 2AQCA 2VZBA 1F30A 2G4HA 3PW1B 3VNXA 5D8OA 3RZ6A 1Y1VL 3A68A 1B13A 1I6HL 5GAGc 2A6HD 2RFKB 1IESA 3KYUA 3UOIA 1S2ZA 2WLUA 2A6ED 4LHLA 1MFRA 1JI4A 1VEIA 1S30A 2V2PA 5IP9L 3D19A 1SMUA 4ME3A 3OGHA 2XJUA 2CWLA 4Y52L 5K52A 2C2UA 3DBYA 5ERJA 2CLBA 5GU1X 4TOEA 3RZTA 4DYYA 2ZA7A 5H1Sc 4RXNA 5JDOA 4C2M1 1CADA 1PZXA 4BY7L 3U90A 3E1PA 4A3GL 2VXIA 3F34A 3E1JA 4TOGA 4ERUA 3H0GL 1R0GA 8RXNA 3PO3L 3UOFA 3KYVA 2F7NA 2NYDA 4UY81 3SIDA 1R03A 4JADA 3GTKL 2CN7A 2JD60 4GS7D 3HOXL 1OTKA 3RYGA 5DM71 4ZTTA 2XJNA 4RC6B 5AI2A 3KA9A 2PYAA 4AR5A 1JTSA 5FFDA 3S2DL 2PYBA 2ZIXA 1O9RA 1BFYA 5D8QA 1B2JA 1IU5A 3CQZL 1BFRA 2XJSA 3C1ZA 5C44L 4XKTA 4X6AL 2CIHA 3KXUA 1JKVA 1UVHA 3GGZA 3F33A 2XJTA 1JGCA 5J93A 3KYWA 5IP7L 3S1RL 3PW8C 2JI1A 4ZKWA 5LG2A 1FHAA 2XJPA 3AF8X 1L8IA 4LQHA 2RBDA 3UFBA 2NVXL 5M5WL 4KXRB 4LQNA 4TW3A 3HIUA 1HRSA 2QF9A 4G6BA 4K9FA 1KRQA 2Z90A 2FHAA 5E1UA 3RD0A 2B5ID 4PG1A 2YU9L 3OJ5A 4KVSA 5GADc 1CAAA 3GTPL 1VZGA 3GTML 2AYJA 2V15A 1GWGA 5D8XA 4AM5A 2AUSB 2KN9A 3HOYL 1DPSA 4BBRL 4IXKA 1R9TL 4KVQA 3RAVA 1WJVA 3WWNB 3QVDA 4DYUA 2C6BA 4WFN1 2EY4E 3QQCE 5DM61 1VELA 3HAXC 4DYZA 4A3JL 5D8PA 1Z92B 3AF7X 2J9UB 3B08B 3E1OA 5RXNA 3I4NL 4ISPA 2JI3A 2QQYA 3LWVB 1VZHA 1IRNA 3N6OA 5JKLA 4EVCA 2GYDA 2ERSA 4TOCA 1BE7A 4RC7A 2CLUA 3JZAB 1TJOA 2V2MA 3GVYA 3SH6A 1T9OA 3GTGL 3R2KA 4AM2A 2YJKA 1O9IA 2JD70 2Z5PA 1WCML 4ITTA 1IW7D 4V196 2CHPA 2DSXA 4PGIA 1NNQA 2JD80 3TA8A 5AN9H 3F36A 2Z5QA 3PZAA 3R2HA 5FFBA 3PVYB 4AI2A 3KYYA 1YV1A 5FJ8L 2BK6A 3J7Z1 3K7AL 3PVRB 1UMNA 4R42A 2V2LA 4Z5SA 2GYQA 3R2MA 1OWBA 2IY4A 3R2OA 4YVZA 1ZRPA 4E6KA 2C6RA 1L8HA 2WAQP 5EINC 3GGYA 3PW8A 5GN8B 1TKOA 3R2LA 5J8SA 2V2RA 3AK8A 2V8UA 4XXBB 2D5KA 2Y0SP 1F4LA 4WJG4 3UNOA 4C3JL 1RYQA 1SMWA 4A3KL 3F39A 3WWLA 3NFPI 2E2HL 3RBCA 2E2JL 2HTNA 4TOAA 5GAEc 2CN6A 3AJPA 3EZUA 1JI5A 1JREA 1DATA 4DYXA 1IU6A 2JA5L 3C23A 2FZFA 1RCCA 3WVUA 1PFWA 3SS2A 2A68D 4U3GA 4AR6A 2Y3QA 3E1QA 3RZDL 3C21A 5GAHc 5C4XL 2JA6L 2FKZA 3E1LA 4A3IL 2E2IL 2C2FA 5FFEA 5GOUA 2BW1A 4AM4A 5LG8A 4M34A 3FDJA 5LS9A 5LBHA 3VV9A 3WVVA 2C41A 4CVRA 4EVBA 4IWKA 3KA4A 2G38B 4CVSA 3HKZP 3H9CA 3QZ3A 1BQ9A 4A3DL 5M3FL 5ERKA 2VL6A 2CEIA 5K53A 5MFPA 2XJVA 4A3ML 4A3CL 4MY7A 5J8WA 4XGHA 3JR7A 1R0IA 3QHCA 5AXSA 1OWCA 1C09A 3BVFA 4XGSA 1RDGA 2V2JA 3M3YL 4W4KB 4TO9A 5FEJA 5K2ME 3PVYA 1T9QA 4ZL6A 2Z6MA 1YK4A 2FL0A 3BVIA 3BVEA 2FG4A 2ZA6A 4P18A 2M6OA 3PVRA 1QYBA 2LCQA 1RYTA 2XJOA 4YWMA 3WNWA 1SOFA 4B8CD 2UX1A 1Z6OA 3PVTB 4QIWP 4KVRA 1VJXA 2V2NA 1NF4A 3F38A 4LYUA 3GHQA 2JA8L 4XKSA 3SE1A 4YWLA 5GN8A 2XJRA 4ZKXA 1FHHA 1RDVA 2R7ZL 2WB1P 4ZN1B 4CY9A 4X0JA 3H99A 4MUDA 2MS3A 4CMYA 5J9VA 1YUXA 2FJCA 1B2OA 1I3QL 1JYBA 3E6SA 1ZUJA 3K35A 4DASA 1TKPA 1LKOA 1TK6A 4JAFA 2WTLA 2M4VA 4TODA 2CF7A 3KWOA 3PW1A 1JIGA 3ISEA 4YXMA 1TWHL 5GU2X 3KA3A 1DVBA 3BKNA 1K83L 4ZMCA 2YW7A 2IU2A 2CKAA 2XJMA 2Z3QB 1QGHA 3IU3I 1BQ8A 3S16L 1RCIA 4MKUA 4LQVA 3MQKB 3PWQC 3FKIL 5GU0X 3IS8A 1QQTA 3M4OL 4YXJA 4ZJKA 2ZG7X 3EZ0A 2GMGA 2Z5RA 4E40A 3ZG6A 3V3KB 1VZIA 3RZOL 3A9QA 1N1QA 2YJJA 4U671 2B63L 2NVYL 1LKMA 3F32A 4Z3BA 1YUZA 1H7VA 4A3FL 1H96A 3E2CA 3W54A 2C6AA 2ZURX 2PVXA 3LWQB 4AI0A 2M6PA 4LHNA 4E6YA 1VCXA 4PGKA 4RC6A 3VVAA 2AR0A 1RB9A 5JKMA 3GTLL 4M33A 3I4ML 3RGDA 3GTQL 1ODHA 4TOHA 4RC8A 4MJYA 3ES3A 4XKUA 3PO2L 1XZ1A 2XGWA 5C6FA 2ITBA 4A25A 3IQ1A 5JKMG 3NOZX 4EVDA 3B0AB 4QUWA 5IY0A 4LYXA 4Y7NL 2ZG9X 3P8BA 2NVTL 4AHZA 4IWJA 1TWAL 1R0JA 4TPUA 2VXXA 4AHWA 3AJQA 3ERZA 4TOFA 1BG7A 1RCGA 4M32A 2PMZP 3PIO1 2VUML 3KDQA 2CKCA 5MLC3 5JVH1 3AK9A 4CVTA 1FHMA 1S24A 5C3EL 3H7GA 3MSUA 4ZN3B 4ZKHA 3S1NL 2HVYC 4JAGA 1AEWA
chains in the Genus database with same CATH topology
3J7Y1 2L0ZA 4LPNA 3QHBA 5HJHA 3O7RA 3WVWA 2PSMC 3Q4OA 3P2AA 3BVKA 4EVEA 4ETRA 1DX8A 5MGNA 4Y08A 1RCDA 2V8TA 1B71A 3PWQA 3NP0X 4ZL5A 1NXGA 2JI2A 1NFVA 3A44A 3HL1A 3JZ9A 2GS4A 4POFA 4MN9A 4TOBA 4CMYV 1S3QA 3KYXA 1J30A 4OYNA 5GU3X 3MPSA 4M35A 5CMRA 1JKUA 4AI3A 2O5JD 1LTLA 2RDVA 4RC7B 2V0EA 4II4B 2BE5D 4JAEA 3FRRA 5D8SA 4PG0A 4RC5B 1NF6A 3PKJA 4AR4A 2ERJA 5E2DA 1RWDA 2CR8A 4LQJA 1R0HA 1NXEA 1MOJA 3L0MA 1E8JA 3LKDA 3SHXA 4CYBA 2FFXJ 2V0FA 2IB0A 2OKCA 4YKHA 2OH3A 2QL0A 4ITWA 3FSEA 5JACA 1EUMA 3VPBE 2OC5A 4POGA 3PKIA 5CZUA 2KKDA 3QD8A 3AF9X 3NP2X 3PWFA 5EIOC 3FI6A 3R2SA 1XZ3A 5HQOA 5IX6A 1VEQA 2MGYA 2Z3RB 4REUA 3KHKA 3ISFA 5HJFA 2V2OA 2PPTA 4MXPA 3Q4QA 2X170 3FRSA 2ZA8A 1BRFA 1QCVA 4AHYA 2BKCA 2M4YA 2K2DA 2C2JA 4W4LB 4LPMA 5FFAA 4ML5A 7RXNA 3KA6A 3QB9A 2BJYA 3FVBA 3R2RA 3C1YA 1SQ3A 3BT5A 3GE4A 2ZG8X 3E6RA 5MFZA 2XJQA 5AI3A 2YW6A 3O7SA 4AR3A 3Q4RA 2WLAA 5HU6D 3LPEB 1T9PA 5JDOB 5FFCA 2PVEA 4II4A 3T9JA 3PVTA 4DI0A 4CVPA 3LNLA 5CMQA 2XKQA 3F35A 4RC5A 1R0FA 1IERA 3E1MA 2W0OA 5JKLG 3F37A 3E1NA 3Q4NA 1Z6OM 5JVG1 2V2SA 4ZLWA 1LKPA 3KA8A 3RE7A 4AHXA 1SMMA 4DZ0A 3EGMA 1BCFA 5D8RA 4ISMA 1IROA 3KX9A 4DE6A 3IS7A 6RXNA 2WWXB 3AJOA 1VLGA 2V2IA 2HR5A 1ZS3A 2Y44A 1F33A 1YK5A 2CHIA 4TVMA 3M6JA 4LPJA 2H12A 3PIP1 1Z4AA 3BVLA 4AI1A 5I4JA 1LB3A 5MF6A 1RCEA 4CYAA 2A69D 2V3BB 2FG8A 5D8YA 2N02A 2VZBA 1F30A 2G4HA 3PW1B 3VNXA 5D8OA 3RZ6A 3A68A 1B13A 5GAGc 2A6HD 1IESA 3KYUA 3UOIA 1S2ZA 2WLUA 2A6ED 4LHLA 1MFRA 1JI4A 1VEIA 1S30A 2V2PA 3D19A 1SMUA 4ME3A 3OGHA 2XJUA 2CWLA 5K52A 2C2UA 3DBYA 5ERJA 2CLBA 5GU1X 4TOEA 3RZTA 4DYYA 2ZA7A 5H1Sc 4RXNA 5JDOA 1CADA 3U90A 3E1PA 2VXIA 3F34A 3E1JA 4TOGA 4ERUA 1R0GA 8RXNA 3UOFA 3KYVA 2F7NA 2NYDA 4UY81 3SIDA 1R03A 4JADA 2CN7A 2JD60 4GS7D 1OTKA 3RYGA 5DM71 4ZTTA 2XJNA 4RC6B 5AI2A 3KA9A 2PYAA 4AR5A 1JTSA 5FFDA 1BFYA 2PYBA 2ZIXA 1O9RA 5D8QA 1B2JA 1IU5A 1BFRA 2XJSA 3C1ZA 4XKTA 2CIHA 3KXUA 1JKVA 1UVHA 3GGZA 3F33A 2XJTA 1JGCA 5J93A 3KYWA 3PW8C 2JI1A 4ZKWA 5LG2A 1FHAA 2XJPA 3AF8X 1L8IA 4LQHA 2RBDA 3UFBA 4KXRB 4LQNA 4TW3A 3HIUA 1HRSA 2QF9A 4G6BA 4K9FA 1KRQA 2Z90A 2FHAA 5E1UA 3RD0A 2B5ID 4PG1A 3OJ5A 4KVSA 5GADc 1CAAA 1VZGA 2AYJA 2V15A 1GWGA 5D8XA 4AM5A 2KN9A 1DPSA 4IXKA 4KVQA 3RAVA 1WJVA 3WWNB 3QVDA 4DYUA 2C6BA 4WFN1 3QQCE 5DM61 1VELA 4DYZA 5D8PA 1Z92B 3AF7X 2J9UB 3B08B 3E1OA 5RXNA 4ISPA 2JI3A 2QQYA 1VZHA 1IRNA 3N6OA 5JKLA 4EVCA 2GYDA 2ERSA 4TOCA 1BE7A 4RC7A 2CLUA 3JZAB 1TJOA 2V2MA 3GVYA 3SH6A 1T9OA 3R2KA 4AM2A 2YJKA 1O9IA 2JD70 2Z5PA 4ITTA 1IW7D 4V196 2CHPA 2DSXA 4PGIA 1NNQA 2JD80 3TA8A 5AN9H 3F36A 2Z5QA 3PZAA 3R2HA 5FFBA 3PVYB 4AI2A 3KYYA 1YV1A 2BK6A 3J7Z1 3PVRB 1UMNA 4R42A 2V2LA 4Z5SA 2GYQA 3R2MA 1OWBA 2IY4A 3R2OA 4YVZA 1ZRPA 4E6KA 2C6RA 1L8HA 5EINC 3GGYA 3PW8A 5GN8B 1TKOA 3R2LA 5J8SA 2V2RA 3AK8A 2V8UA 4XXBB 2D5KA 4WJG4 3UNOA 1RYQA 1SMWA 3F39A 3WWLA 3NFPI 3RBCA 2HTNA 4TOAA 5GAEc 2CN6A 3AJPA 3EZUA 1JI5A 1JREA 1DATA 4DYXA 1IU6A 3C23A 2FZFA 1RCCA 3WVUA 3SS2A 2A68D 4U3GA 4AR6A 2Y3QA 3E1QA 3C21A 5GAHc 2FKZA 3E1LA 2C2FA 5FFEA 5GOUA 2BW1A 4AM4A 5LG8A 4M34A 5LS9A 5LBHA 3VV9A 3WVVA 2C41A 4CVRA 4EVBA 4IWKA 3KA4A 2G38B 4CVSA 3QZ3A 1BQ9A 5ERKA 2VL6A 2CEIA 5K53A 5MFPA 2XJVA 4MY7A 5J8WA 4XGHA 1R0IA 3QHCA 5AXSA 1OWCA 1C09A 3BVFA 4XGSA 1RDGA 2V2JA 4W4KB 4TO9A 5FEJA 5K2ME 3PVYA 1T9QA 4ZL6A 2Z6MA 1YK4A 2FL0A 3BVIA 3BVEA 2FG4A 2ZA6A 4P18A 2M6OA 3PVRA 1QYBA 2LCQA 1RYTA 2XJOA 4YWMA 3WNWA 1SOFA 4B8CD 2UX1A 1Z6OA 3PVTB 4KVRA 1VJXA 2V2NA 1NF4A 3F38A 4LYUA 3GHQA 4XKSA 3SE1A 4YWLA 5GN8A 2XJRA 4ZKXA 1FHHA 1RDVA 4ZN1B 4CY9A 4X0JA 4MUDA 2MS3A 4CMYA 5J9VA 1YUXA 2FJCA 1B2OA 1JYBA 3E6SA 1ZUJA 3K35A 4DASA 1TKPA 1LKOA 1TK6A 4JAFA 2WTLA 2M4VA 4TODA 2CF7A 3KWOA 3PW1A 1JIGA 3ISEA 4YXMA 5GU2X 3KA3A 1DVBA 3BKNA 4ZMCA 2YW7A 2IU2A 2CKAA 2XJMA 2Z3QB 1QGHA 3IU3I 1BQ8A 1RCIA 4MKUA 4LQVA 3PWQC 5GU0X 3IS8A 4YXJA 4ZJKA 2ZG7X 3EZ0A 2GMGA 2Z5RA 4E40A 3ZG6A 3V3KB 1VZIA 3A9QA 1N1QA 2YJJA 4U671 1H7VA 1LKMA 3F32A 4Z3BA 1YUZA 1H96A 3E2CA 3W54A 2C6AA 2ZURX 2PVXA 4AI0A 2M6PA 4LHNA 4E6YA 1VCXA 4PGKA 4RC6A 3VVAA 2AR0A 1RB9A 5JKMA 4M33A 3RGDA 1ODHA 4TOHA 4RC8A 4MJYA 3ES3A 4XKUA 1XZ1A 2XGWA 5C6FA 2ITBA 4A25A 3IQ1A 5JKMG 3NOZX 4EVDA 3B0AB 4QUWA 5IY0A 4LYXA 2ZG9X 3P8BA 4AHZA 4IWJA 1R0JA 4TPUA 2VXXA 4AHWA 3AJQA 3ERZA 4TOFA 1BG7A 1RCGA 4M32A 3PIO1 3KDQA 2CKCA 5MLC3 5JVH1 3AK9A 4CVTA 1FHMA 1S24A 3H7GA 3MSUA 4ZN3B 4ZKHA 4JAGA 1AEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LPN A;  3QHB A;  5HJH A;  3O7R A;  3WVW A;  3Q4O A;  3BVK A;  4EVE A;  4ETR A;  1DX8 A;  4Y08 A;  1RCD A;  1B71 A;  3PWQ A;  3NP0 X;  4ZL5 A;  1NFV A;  3A44 A;  3HL1 A;  2GS4 A;  4POF A;  4MN9 A;  4TOB A;  4CMY V;  1S3Q A;  3KYX A;  1J30 A;  4OYN A;  5GU3 X;  3MPS A;  4M35 A;  5CMR A;  1JKU A;  1LTL A;  2RDV A;  4RC7 B;  4II4 B;  5D8S A;  4PG0 A;  4RC5 B;  1NF6 A;  4AR4 A;  5E2D A;  1RWD A;  4LQJ A;  1R0H A;  1MOJ A;  1E8J A;  3SHX A;  4CYB A;  2FFX J;  2IB0 A;  4YKH A;  2OH3 A;  2QL0 A;  4ITW A;  3FSE A;  5JAC A;  1EUM A;  2OC5 A;  4POG A;  5CZU A;  2KKD A;  3QD8 A;  3AF9 X;  3NP2 X;  3PWF A;  3FI6 A;  3R2S A;  1XZ3 A;  5HQO A;  5IX6 A;  1VEQ A;  4REU A;  3ISF A;  5HJF A;  2V2O A;  3Q4Q A;  2X17 0;  2ZA8 A;  1BRF A;  1QCV A;  2BKC A;  2M4Y A;  2K2D A;  2C2J A;  4LPM A;  5FFA A;  4ML5 A;  7RXN A;  3KA6 A;  3QB9 A;  2BJY A;  3FVB A;  3R2R A;  1SQ3 A;  3BT5 A;  3GE4 A;  2ZG8 X;  3E6R A;  5AI3 A;  2YW6 A;  3O7S A;  4AR3 A;  3Q4R A;  2WLA A;  1T9P A;  2PVE A;  5FFC A;  4II4 A;  3T9J A;  3PVT A;  4DI0 A;  4CVP A;  5CMQ A;  2XKQ A;  3F35 A;  4RC5 A;  1R0F A;  1IER A;  3E1M A;  2W0O A;  5JKL G;  3F37 A;  3E1N A;  3Q4N A;  1Z6O M;  2V2S A;  4ZLW A;  1LKP A;  3KA8 A;  3RE7 A;  1SMM A;  4DZ0 A;  3EGM A;  1BCF A;  5D8R A;  4ISM A;  1IRO A;  3KX9 A;  4DE6 A;  3IS7 A;  6RXN A;  3AJO A;  1VLG A;  2V2I A;  2HR5 A;  1ZS3 A;  1YK5 A;  1F33 A;  2CHI A;  4LPJ A;  1Z4A A;  3BVL A;  5I4J A;  1LB3 A;  1RCE A;  4CYA A;  2V3B B;  2FG8 A;  5D8Y A;  2VZB A;  1F30 A;  2G4H A;  3PW1 B;  3VNX A;  5D8O A;  3RZ6 A;  3A68 A;  1B13 A;  1IES A;  3KYU A;  3UOI A;  1S2Z A;  2WLU A;  1MFR A;  1JI4 A;  1VEI A;  1S30 A;  2V2P A;  1SMU A;  4ME3 A;  3OGH A;  5K52 A;  2C2U A;  5ERJ A;  2CLB A;  5GU1 X;  4TOE A;  3RZT A;  4DYY A;  2ZA7 A;  4RXN A;  1CAD A;  3U90 A;  3E1P A;  2VXI A;  3F34 A;  3E1J A;  4TOG A;  4ERU A;  1R0G A;  8RXN A;  3UOF A;  3KYV A;  2F7N A;  3SID A;  1R03 A;  2CN7 A;  2JD6 0;  1OTK A;  3RYG A;  4ZTT A;  2XJN A;  4RC6 B;  5AI2 A;  3KA9 A;  2PYA A;  4AR5 A;  1JTS A;  5FFD A;  1BFY A;  2PYB A;  1O9R A;  5D8Q A;  1B2J A;  1IU5 A;  1BFR A;  4XKT A;  2CIH A;  3KXU A;  1JKV A;  1UVH A;  3KYW A;  3F33 A;  1JGC A;  5J93 A;  3PW8 C;  4ZKW A;  5LG2 A;  1FHA A;  3AF8 X;  1L8I A;  4LQH A;  2RBD A;  4LQN A;  4TW3 A;  3HIU A;  1HRS A;  2QF9 A;  4K9F A;  1KRQ A;  2Z90 A;  2FHA A;  5E1U A;  3RD0 A;  4PG1 A;  3OJ5 A;  4KVS A;  1CAA A;  2V15 A;  1GWG A;  5D8X A;  4AM5 A;  2KN9 A;  1DPS A;  4IXK A;  4KVQ A;  3RAV A;  3QVD A;  4DYU A;  1VEL A;  4DYZ A;  5D8P A;  3AF7 X;  3E1O A;  5RXN A;  4ISP A;  2QQY A;  1IRN A;  5JKL A;  4EVC A;  2GYD A;  4TOC A;  1BE7 A;  4RC7 A;  2CLU A;  1TJO A;  2V2M A;  3GVY A;  3SH6 A;  1T9O A;  3R2K A;  4AM2 A;  2YJK A;  1O9I A;  2JD7 0;  2Z5P A;  4ITT A;  2CHP A;  2DSX A;  4PGI A;  1NNQ A;  2JD8 0;  3TA8 A;  3F36 A;  2Z5Q A;  3PZA A;  3R2H A;  5FFB A;  3PVY B;  3KYY A;  1YV1 A;  2BK6 A;  3PVR B;  1UMN A;  4R42 A;  2V2L A;  4Z5S A;  2GYQ A;  3R2M A;  2IY4 A;  3R2O A;  1ZRP A;  4E6K A;  2C6R A;  1L8H A;  3PW8 A;  5GN8 B;  1TKO A;  3R2L A;  5J8S A;  2V2R A;  3AK8 A;  2D5K A;  3UNO A;  1SMW A;  3F39 A;  3RBC A;  2HTN A;  4TOA A;  2CN6 A;  3AJP A;  3EZU A;  1JI5 A;  1JRE A;  1DAT A;  4DYX A;  1IU6 A;  2FZF A;  1RCC A;  3WVU A;  3SS2 A;  4U3G A;  4AR6 A;  2Y3Q A;  3E1Q A;  2FKZ A;  3E1L A;  2C2F A;  5FFE A;  5GOU A;  2BW1 A;  4AM4 A;  5LG8 A;  4M34 A;  5LS9 A;  5LBH A;  3WVV A;  2C41 A;  4CVR A;  4EVB A;  4IWK A;  3KA4 A;  4CVS A;  3QZ3 A;  1BQ9 A;  5ERK A;  2VL6 A;  2CEI A;  5K53 A;  4MY7 A;  5J8W A;  1R0I A;  3QHC A;  5AXS A;  1C09 A;  3BVF A;  4XGS A;  1RDG A;  2V2J A;  4TO9 A;  5FEJ A;  3PVY A;  1T9Q A;  4ZL6 A;  2Z6M A;  1YK4 A;  2FL0 A;  3BVI A;  3BVE A;  2FG4 A;  2ZA6 A;  4P18 A;  3PVR A;  1QYB A;  2LCQ A;  1RYT A;  2XJO A;  4YWM A;  3WNW A;  1SOF A;  2UX1 A;  1Z6O A;  3PVT B;  4KVR A;  1VJX A;  2V2N A;  1NF4 A;  3F38 A;  4LYU A;  3GHQ A;  4XKS A;  3SE1 A;  4YWL A;  5GN8 A;  4ZKX A;  1FHH A;  1RDV A;  4CY9 A;  4MUD A;  2MS3 A;  4CMY A;  5J9V A;  1YUX A;  2FJC A;  1B2O A;  1JYB A;  3E6S A;  1ZUJ A;  4DAS A;  1TKP A;  1LKO A;  1TK6 A;  2WTL A;  4TOD A;  2CF7 A;  3KWO A;  3PW1 A;  1JIG A;  3ISE A;  5GU2 X;  3KA3 A;  1DVB A;  3BKN A;  4ZMC A;  2YW7 A;  2IU2 A;  2XJM A;  1QGH A;  1BQ8 A;  1RCI A;  4MKU A;  4LQV A;  3PWQ C;  5GU0 X;  3IS8 A;  4ZJK A;  2ZG7 X;  3EZ0 A;  2GMG A;  2Z5R A;  3A9Q A;  1N1Q A;  2YJJ A;  1H7V A;  1LKM A;  3F32 A;  4Z3B A;  1YUZ A;  1H96 A;  3E2C A;  2ZUR X;  2PVX A;  1VCX A;  4PGK A;  4RC6 A;  1RB9 A;  5JKM A;  4M33 A;  3RGD A;  4TOH A;  4RC8 A;  4MJY A;  3ES3 A;  4XKU A;  1XZ1 A;  2XGW A;  5C6F A;  2ITB A;  4A25 A;  3IQ1 A;  5JKM G;  3NOZ X;  4EVD A;  4QUW A;  5IY0 A;  4LYX A;  2ZG9 X;  4IWJ A;  1R0J A;  4TPU A;  2VXX A;  3AJQ A;  3ERZ A;  4TOF A;  1BG7 A;  1RCG A;  4M32 A;  3AK9 A;  4CVT A;  1FHM A;  1S24 A;  3H7G A;  4ZKH A;  1AEW A; 
#chains in the Genus database with same CATH topology
 3S15 L;  3J7Y 1;  2L0Z A;  4LPN A;  3QHB A;  5HJH A;  3O7R A;  3WVW A;  2PSM C;  3Q4O A;  3P2A A;  3BVK A;  3PL5 A;  4EVE A;  4ETR A;  1DX8 A;  5MGN A;  4Y08 A;  1RCD A;  2V8T A;  1B71 A;  3PWQ A;  3NP0 X;  4ZL5 A;  3HOZ L;  1NXG A;  2JI2 A;  3LWO B;  1NFV A;  1PFU A;  3A44 A;  3HL1 A;  3JZ9 A;  2GS4 A;  4POF A;  4MN9 A;  4TOB A;  4CMY V;  1S3Q A;  3KYX A;  3S1M L;  4BBS L;  1SFO L;  3HJW B;  1J30 A;  4OYN A;  5GU3 X;  3MPS A;  1TWG L;  4A3L L;  4M35 A;  5CMR A;  1I50 L;  1JKU A;  4AI3 A;  2O5J D;  1LTL A;  2RDV A;  4RC7 B;  3HOV L;  2V0E A;  4II4 B;  2BE5 D;  4JAE A;  3FRR A;  5D8S A;  4PG0 A;  4RC5 B;  1P7P A;  1NF6 A;  3PKJ A;  4AR4 A;  2ERJ A;  5E2D A;  1RWD A;  2CR8 A;  4LQJ A;  1R0H A;  1NXE A;  1MOJ A;  3L0M A;  1E8J A;  3LKD A;  3SHX A;  3LWR B;  4CYB A;  2FFX J;  2V0F A;  2IB0 A;  2OKC A;  4YKH A;  4BXX L;  2OH3 A;  2QL0 A;  4ITW A;  3HJY B;  3FSE A;  5IYD L;  5JAC A;  1EUM A;  3VPB E;  2OC5 A;  5C4J L;  4POG A;  3PKI A;  5CZU A;  2KKD A;  3QD8 A;  3AF9 X;  3NP2 X;  3PWF A;  5M3M L;  5EIO C;  3H3V M;  3FI6 A;  3R2S A;  1XZ3 A;  5HQO A;  5IX6 A;  1VEQ A;  2MGY A;  2Z3R B;  4REU A;  3KHK A;  3ISF A;  5HJF A;  2V2O A;  2PPT A;  4MXP A;  5IYC L;  3Q4Q A;  2APO B;  2X17 0;  3FRS A;  2ZA8 A;  3H97 A;  1BRF A;  1PFY A;  2R93 L;  3S14 L;  1QCV A;  4AHY A;  2BKC A;  2M4Y A;  2K2D A;  4C3I L;  2C2J A;  4W4L B;  4LPM A;  4C3H L;  5FFA A;  2JA7 L;  4A93 L;  4ML5 A;  7RXN A;  3KA6 A;  3QB9 A;  2BJY A;  3FVB A;  3R2R A;  3C1Y A;  5FLM L;  1SQ3 A;  3BT5 A;  3GE4 A;  2ZG8 X;  3E6R A;  5MFZ A;  3S17 L;  2XJQ A;  5AI3 A;  2YW6 A;  3O7S A;  4AR3 A;  3Q4R A;  2WLA A;  5HU6 D;  3LPE B;  4A3E L;  3LWP B;  1T9P A;  1TWC L;  5JDO B;  5FFC A;  2PVE A;  3H9B A;  3S2H L;  4II4 A;  3T9J A;  3PVT A;  4DI0 A;  4CVP A;  3LNL A;  3HOU L;  5CMQ A;  2XKQ A;  3F35 A;  4RC5 A;  1R0F A;  1IER A;  3HOW L;  3E1M A;  2W0O A;  5M5Y L;  5JKL G;  3F37 A;  3E1N A;  5IYB L;  3GTJ L;  3Q4N A;  1Z6O M;  2R92 L;  2NVQ L;  5JVG 1;  2V2S A;  4ZLW A;  1LKP A;  3KA8 A;  3RE7 A;  4AHX A;  1SMM A;  4AYB P;  4A3B L;  4DZ0 A;  3EGM A;  1Y1W L;  1BCF A;  1TWF L;  5D8R A;  4ISM A;  1IRO A;  3KX9 A;  4DE6 A;  3IS7 A;  6RXN A;  2WWX B;  3AJO A;  1VLG A;  1PFV A;  2V2I A;  2HR5 A;  1ZS3 A;  2Y44 A;  1F33 A;  1YK5 A;  3S1Q L;  2CHI A;  4TVM A;  3M6J A;  4LPJ A;  2H12 A;  3PIP 1;  1Z4A A;  3BVL A;  5M5X L;  4AI1 A;  3GTO L;  5I4J A;  1LB3 A;  5MF6 A;  4BY1 L;  1RCE A;  4CYA A;  2A69 D;  2V3B B;  2FG8 A;  5D8Y A;  2N02 A;  2AQC A;  2VZB A;  1F30 A;  2G4H A;  3PW1 B;  3VNX A;  5D8O A;  3RZ6 A;  1Y1V L;  3A68 A;  1B13 A;  1I6H L;  5GAG c;  2A6H D;  2RFK B;  1IES A;  3KYU A;  3UOI A;  1S2Z A;  2WLU A;  2A6E D;  4LHL A;  1MFR A;  1JI4 A;  1VEI A;  1S30 A;  2V2P A;  5IP9 L;  3D19 A;  1SMU A;  4ME3 A;  3OGH A;  2XJU A;  2CWL A;  4Y52 L;  5K52 A;  2C2U A;  3DBY A;  5ERJ A;  2CLB A;  5GU1 X;  4TOE A;  3RZT A;  4DYY A;  2ZA7 A;  5H1S c;  4RXN A;  5JDO A;  4C2M 1;  1CAD A;  1PZX A;  4BY7 L;  3U90 A;  3E1P A;  4A3G L;  2VXI A;  3F34 A;  3E1J A;  4TOG A;  4ERU A;  3H0G L;  1R0G A;  8RXN A;  3PO3 L;  3UOF A;  3KYV A;  2F7N A;  2NYD A;  4UY8 1;  3SID A;  1R03 A;  4JAD A;  3GTK L;  2CN7 A;  2JD6 0;  4GS7 D;  3HOX L;  1OTK A;  3RYG A;  5DM7 1;  4ZTT A;  2XJN A;  4RC6 B;  5AI2 A;  3KA9 A;  2PYA A;  4AR5 A;  1JTS A;  5FFD A;  3S2D L;  2PYB A;  2ZIX A;  1O9R A;  1BFY A;  5D8Q A;  1B2J A;  1IU5 A;  3CQZ L;  1BFR A;  2XJS A;  3C1Z A;  5C44 L;  4XKT A;  4X6A L;  2CIH A;  3KXU A;  1JKV A;  1UVH A;  3GGZ A;  3F33 A;  2XJT A;  1JGC A;  5J93 A;  3KYW A;  5IP7 L;  3S1R L;  3PW8 C;  2JI1 A;  4ZKW A;  5LG2 A;  1FHA A;  2XJP A;  3AF8 X;  1L8I A;  4LQH A;  2RBD A;  3UFB A;  2NVX L;  5M5W L;  4KXR B;  4LQN A;  4TW3 A;  3HIU A;  1HRS A;  2QF9 A;  4G6B A;  4K9F A;  1KRQ A;  2Z90 A;  2FHA A;  5E1U A;  3RD0 A;  2B5I D;  4PG1 A;  2YU9 L;  3OJ5 A;  4KVS A;  5GAD c;  1CAA A;  3GTP L;  1VZG A;  3GTM L;  2AYJ A;  2V15 A;  1GWG A;  5D8X A;  4AM5 A;  2AUS B;  2KN9 A;  3HOY L;  1DPS A;  4BBR L;  4IXK A;  1R9T L;  4KVQ A;  3RAV A;  1WJV A;  3WWN B;  3QVD A;  4DYU A;  2C6B A;  4WFN 1;  2EY4 E;  3QQC E;  5DM6 1;  1VEL A;  3HAX C;  4DYZ A;  4A3J L;  5D8P A;  1Z92 B;  3AF7 X;  2J9U B;  3B08 B;  3E1O A;  5RXN A;  3I4N L;  4ISP A;  2JI3 A;  2QQY A;  3LWV B;  1VZH A;  1IRN A;  3N6O A;  5JKL A;  4EVC A;  2GYD A;  2ERS A;  4TOC A;  1BE7 A;  4RC7 A;  2CLU A;  3JZA B;  1TJO A;  2V2M A;  3GVY A;  3SH6 A;  1T9O A;  3GTG L;  3R2K A;  4AM2 A;  2YJK A;  1O9I A;  2JD7 0;  2Z5P A;  1WCM L;  4ITT A;  1IW7 D;  4V19 6;  2CHP A;  2DSX A;  4PGI A;  1NNQ A;  2JD8 0;  3TA8 A;  5AN9 H;  3F36 A;  2Z5Q A;  3PZA A;  3R2H A;  5FFB A;  3PVY B;  4AI2 A;  3KYY A;  1YV1 A;  5FJ8 L;  2BK6 A;  3J7Z 1;  3K7A L;  3PVR B;  1UMN A;  4R42 A;  2V2L A;  4Z5S A;  2GYQ A;  3R2M A;  1OWB A;  2IY4 A;  3R2O A;  4YVZ A;  1ZRP A;  4E6K A;  2C6R A;  1L8H A;  2WAQ P;  5EIN C;  3GGY A;  3PW8 A;  5GN8 B;  1TKO A;  3R2L A;  5J8S A;  2V2R A;  3AK8 A;  2V8U A;  4XXB B;  2D5K A;  2Y0S P;  1F4L A;  4WJG 4;  3UNO A;  4C3J L;  1RYQ A;  1SMW A;  4A3K L;  3F39 A;  3WWL A;  3NFP I;  2E2H L;  3RBC A;  2E2J L;  2HTN A;  4TOA A;  5GAE c;  2CN6 A;  3AJP A;  3EZU A;  1JI5 A;  1JRE A;  1DAT A;  4DYX A;  1IU6 A;  2JA5 L;  3C23 A;  2FZF A;  1RCC A;  3WVU A;  1PFW A;  3SS2 A;  2A68 D;  4U3G A;  4AR6 A;  2Y3Q A;  3E1Q A;  3RZD L;  3C21 A;  5GAH c;  5C4X L;  2JA6 L;  2FKZ A;  3E1L A;  4A3I L;  2E2I L;  2C2F A;  5FFE A;  5GOU A;  2BW1 A;  4AM4 A;  5LG8 A;  4M34 A;  3FDJ A;  5LS9 A;  5LBH A;  3VV9 A;  3WVV A;  2C41 A;  4CVR A;  4EVB A;  4IWK A;  3KA4 A;  2G38 B;  4CVS A;  3HKZ P;  3H9C A;  3QZ3 A;  1BQ9 A;  4A3D L;  5M3F L;  5ERK A;  2VL6 A;  2CEI A;  5K53 A;  5MFP A;  2XJV A;  4A3M L;  4A3C L;  4MY7 A;  5J8W A;  4XGH A;  3JR7 A;  1R0I A;  3QHC A;  5AXS A;  1OWC A;  1C09 A;  3BVF A;  4XGS A;  1RDG A;  2V2J A;  3M3Y L;  4W4K B;  4TO9 A;  5FEJ A;  5K2M E;  3PVY A;  1T9Q A;  4ZL6 A;  2Z6M A;  1YK4 A;  2FL0 A;  3BVI A;  3BVE A;  2FG4 A;  2ZA6 A;  4P18 A;  2M6O A;  3PVR A;  1QYB A;  2LCQ A;  1RYT A;  2XJO A;  4YWM A;  3WNW A;  1SOF A;  4B8C D;  2UX1 A;  1Z6O A;  3PVT B;  4QIW P;  4KVR A;  1VJX A;  2V2N A;  1NF4 A;  3F38 A;  4LYU A;  3GHQ A;  2JA8 L;  4XKS A;  3SE1 A;  4YWL A;  5GN8 A;  2XJR A;  4ZKX A;  1FHH A;  1RDV A;  2R7Z L;  2WB1 P;  4ZN1 B;  4CY9 A;  4X0J A;  3H99 A;  4MUD A;  2MS3 A;  4CMY A;  5J9V A;  1YUX A;  2FJC A;  1B2O A;  1I3Q L;  1JYB A;  3E6S A;  1ZUJ A;  3K35 A;  4DAS A;  1TKP A;  1LKO A;  1TK6 A;  4JAF A;  2WTL A;  2M4V A;  4TOD A;  2CF7 A;  3KWO A;  3PW1 A;  1JIG A;  3ISE A;  4YXM A;  1TWH L;  5GU2 X;  3KA3 A;  1DVB A;  3BKN A;  1K83 L;  4ZMC A;  2YW7 A;  2IU2 A;  2CKA A;  2XJM A;  2Z3Q B;  1QGH A;  3IU3 I;  1BQ8 A;  3S16 L;  1RCI A;  4MKU A;  4LQV A;  3MQK B;  3PWQ C;  3FKI L;  5GU0 X;  3IS8 A;  1QQT A;  3M4O L;  4YXJ A;  4ZJK A;  2ZG7 X;  3EZ0 A;  2GMG A;  2Z5R A;  4E40 A;  3ZG6 A;  3V3K B;  1VZI A;  3RZO L;  3A9Q A;  1N1Q A;  2YJJ A;  4U67 1;  2B63 L;  2NVY L;  1LKM A;  3F32 A;  4Z3B A;  1YUZ A;  1H7V A;  4A3F L;  1H96 A;  3E2C A;  3W54 A;  2C6A A;  2ZUR X;  2PVX A;  3LWQ B;  4AI0 A;  2M6P A;  4LHN A;  4E6Y A;  1VCX A;  4PGK A;  4RC6 A;  3VVA A;  2AR0 A;  1RB9 A;  5JKM A;  3GTL L;  4M33 A;  3I4M L;  3RGD A;  3GTQ L;  1ODH A;  4TOH A;  4RC8 A;  4MJY A;  3ES3 A;  4XKU A;  3PO2 L;  1XZ1 A;  2XGW A;  5C6F A;  2ITB A;  4A25 A;  3IQ1 A;  5JKM G;  3NOZ X;  4EVD A;  3B0A B;  4QUW A;  5IY0 A;  4LYX A;  4Y7N L;  2ZG9 X;  3P8B A;  2NVT L;  4AHZ A;  4IWJ A;  1TWA L;  1R0J A;  4TPU A;  2VXX A;  4AHW A;  3AJQ A;  3ERZ A;  4TOF A;  1BG7 A;  1RCG A;  4M32 A;  2PMZ P;  3PIO 1;  2VUM L;  3KDQ A;  2CKC A;  5MLC 3;  5JVH 1;  3AK9 A;  4CVT A;  1FHM A;  1S24 A;  5C3E L;  3H7G A;  3MSU A;  4ZN3 B;  4ZKH A;  3S1N L;  2HVY C;  4JAG A;  1AEW A; 
#chains in the Genus database with same CATH homology
 3J7Y 1;  2L0Z A;  4LPN A;  3QHB A;  5HJH A;  3O7R A;  3WVW A;  2PSM C;  3Q4O A;  3P2A A;  3BVK A;  4EVE A;  4ETR A;  1DX8 A;  5MGN A;  4Y08 A;  1RCD A;  2V8T A;  1B71 A;  3PWQ A;  3NP0 X;  4ZL5 A;  1NXG A;  2JI2 A;  1NFV A;  3A44 A;  3HL1 A;  3JZ9 A;  2GS4 A;  4POF A;  4MN9 A;  4TOB A;  4CMY V;  1S3Q A;  3KYX A;  1J30 A;  4OYN A;  5GU3 X;  3MPS A;  4M35 A;  5CMR A;  1JKU A;  4AI3 A;  2O5J D;  1LTL A;  2RDV A;  4RC7 B;  2V0E A;  4II4 B;  2BE5 D;  4JAE A;  3FRR A;  5D8S A;  4PG0 A;  4RC5 B;  1NF6 A;  3PKJ A;  4AR4 A;  2ERJ A;  5E2D A;  1RWD A;  2CR8 A;  4LQJ A;  1R0H A;  1NXE A;  1MOJ A;  3L0M A;  1E8J A;  3LKD A;  3SHX A;  4CYB A;  2FFX J;  2V0F A;  2IB0 A;  2OKC A;  4YKH A;  2OH3 A;  2QL0 A;  4ITW A;  3FSE A;  5JAC A;  1EUM A;  3VPB E;  2OC5 A;  4POG A;  3PKI A;  5CZU A;  2KKD A;  3QD8 A;  3AF9 X;  3NP2 X;  3PWF A;  5EIO C;  3FI6 A;  3R2S A;  1XZ3 A;  5HQO A;  5IX6 A;  1VEQ A;  2MGY A;  2Z3R B;  4REU A;  3KHK A;  3ISF A;  5HJF A;  2V2O A;  2PPT A;  4MXP A;  3Q4Q A;  2X17 0;  3FRS A;  2ZA8 A;  1BRF A;  1QCV A;  4AHY A;  2BKC A;  2M4Y A;  2K2D A;  2C2J A;  4W4L B;  4LPM A;  5FFA A;  4ML5 A;  7RXN A;  3KA6 A;  3QB9 A;  2BJY A;  3FVB A;  3R2R A;  3C1Y A;  1SQ3 A;  3BT5 A;  3GE4 A;  2ZG8 X;  3E6R A;  5MFZ A;  2XJQ A;  5AI3 A;  2YW6 A;  3O7S A;  4AR3 A;  3Q4R A;  2WLA A;  5HU6 D;  3LPE B;  1T9P A;  5JDO B;  5FFC A;  2PVE A;  4II4 A;  3T9J A;  3PVT A;  4DI0 A;  4CVP A;  3LNL A;  5CMQ A;  2XKQ A;  3F35 A;  4RC5 A;  1R0F A;  1IER A;  3E1M A;  2W0O A;  5JKL G;  3F37 A;  3E1N A;  3Q4N A;  1Z6O M;  5JVG 1;  2V2S A;  4ZLW A;  1LKP A;  3KA8 A;  3RE7 A;  4AHX A;  1SMM A;  4DZ0 A;  3EGM A;  1BCF A;  5D8R A;  4ISM A;  1IRO A;  3KX9 A;  4DE6 A;  3IS7 A;  6RXN A;  2WWX B;  3AJO A;  1VLG A;  2V2I A;  2HR5 A;  1ZS3 A;  2Y44 A;  1F33 A;  1YK5 A;  2CHI A;  4TVM A;  3M6J A;  4LPJ A;  2H12 A;  3PIP 1;  1Z4A A;  3BVL A;  4AI1 A;  5I4J A;  1LB3 A;  5MF6 A;  1RCE A;  4CYA A;  2A69 D;  2V3B B;  2FG8 A;  5D8Y A;  2N02 A;  2VZB A;  1F30 A;  2G4H A;  3PW1 B;  3VNX A;  5D8O A;  3RZ6 A;  3A68 A;  1B13 A;  5GAG c;  2A6H D;  1IES A;  3KYU A;  3UOI A;  1S2Z A;  2WLU A;  2A6E D;  4LHL A;  1MFR A;  1JI4 A;  1VEI A;  1S30 A;  2V2P A;  3D19 A;  1SMU A;  4ME3 A;  3OGH A;  2XJU A;  2CWL A;  5K52 A;  2C2U A;  3DBY A;  5ERJ A;  2CLB A;  5GU1 X;  4TOE A;  3RZT A;  4DYY A;  2ZA7 A;  5H1S c;  4RXN A;  5JDO A;  1CAD A;  3U90 A;  3E1P A;  2VXI A;  3F34 A;  3E1J A;  4TOG A;  4ERU A;  1R0G A;  8RXN A;  3UOF A;  3KYV A;  2F7N A;  2NYD A;  4UY8 1;  3SID A;  1R03 A;  4JAD A;  2CN7 A;  2JD6 0;  4GS7 D;  1OTK A;  3RYG A;  5DM7 1;  4ZTT A;  2XJN A;  4RC6 B;  5AI2 A;  3KA9 A;  2PYA A;  4AR5 A;  1JTS A;  5FFD A;  1BFY A;  2PYB A;  2ZIX A;  1O9R A;  5D8Q A;  1B2J A;  1IU5 A;  1BFR A;  2XJS A;  3C1Z A;  4XKT A;  2CIH A;  3KXU A;  1JKV A;  1UVH A;  3GGZ A;  3F33 A;  2XJT A;  1JGC A;  5J93 A;  3KYW A;  3PW8 C;  2JI1 A;  4ZKW A;  5LG2 A;  1FHA A;  2XJP A;  3AF8 X;  1L8I A;  4LQH A;  2RBD A;  3UFB A;  4KXR B;  4LQN A;  4TW3 A;  3HIU A;  1HRS A;  2QF9 A;  4G6B A;  4K9F A;  1KRQ A;  2Z90 A;  2FHA A;  5E1U A;  3RD0 A;  2B5I D;  4PG1 A;  3OJ5 A;  4KVS A;  5GAD c;  1CAA A;  1VZG A;  2AYJ A;  2V15 A;  1GWG A;  5D8X A;  4AM5 A;  2KN9 A;  1DPS A;  4IXK A;  4KVQ A;  3RAV A;  1WJV A;  3WWN B;  3QVD A;  4DYU A;  2C6B A;  4WFN 1;  3QQC E;  5DM6 1;  1VEL A;  4DYZ A;  5D8P A;  1Z92 B;  3AF7 X;  2J9U B;  3B08 B;  3E1O A;  5RXN A;  4ISP A;  2JI3 A;  2QQY A;  1VZH A;  1IRN A;  3N6O A;  5JKL A;  4EVC A;  2GYD A;  2ERS A;  4TOC A;  1BE7 A;  4RC7 A;  2CLU A;  3JZA B;  1TJO A;  2V2M A;  3GVY A;  3SH6 A;  1T9O A;  3R2K A;  4AM2 A;  2YJK A;  1O9I A;  2JD7 0;  2Z5P A;  4ITT A;  1IW7 D;  4V19 6;  2CHP A;  2DSX A;  4PGI A;  1NNQ A;  2JD8 0;  3TA8 A;  5AN9 H;  3F36 A;  2Z5Q A;  3PZA A;  3R2H A;  5FFB A;  3PVY B;  4AI2 A;  3KYY A;  1YV1 A;  2BK6 A;  3J7Z 1;  3PVR B;  1UMN A;  4R42 A;  2V2L A;  4Z5S A;  2GYQ A;  3R2M A;  1OWB A;  2IY4 A;  3R2O A;  4YVZ A;  1ZRP A;  4E6K A;  2C6R A;  1L8H A;  5EIN C;  3GGY A;  3PW8 A;  5GN8 B;  1TKO A;  3R2L A;  5J8S A;  2V2R A;  3AK8 A;  2V8U A;  4XXB B;  2D5K A;  4WJG 4;  3UNO A;  1RYQ A;  1SMW A;  3F39 A;  3WWL A;  3NFP I;  3RBC A;  2HTN A;  4TOA A;  5GAE c;  2CN6 A;  3AJP A;  3EZU A;  1JI5 A;  1JRE A;  1DAT A;  4DYX A;  1IU6 A;  3C23 A;  2FZF A;  1RCC A;  3WVU A;  3SS2 A;  2A68 D;  4U3G A;  4AR6 A;  2Y3Q A;  3E1Q A;  3C21 A;  5GAH c;  2FKZ A;  3E1L A;  2C2F A;  5FFE A;  5GOU A;  2BW1 A;  4AM4 A;  5LG8 A;  4M34 A;  5LS9 A;  5LBH A;  3VV9 A;  3WVV A;  2C41 A;  4CVR A;  4EVB A;  4IWK A;  3KA4 A;  2G38 B;  4CVS A;  3QZ3 A;  1BQ9 A;  5ERK A;  2VL6 A;  2CEI A;  5K53 A;  5MFP A;  2XJV A;  4MY7 A;  5J8W A;  4XGH A;  1R0I A;  3QHC A;  5AXS A;  1OWC A;  1C09 A;  3BVF A;  4XGS A;  1RDG A;  2V2J A;  4W4K B;  4TO9 A;  5FEJ A;  5K2M E;  3PVY A;  1T9Q A;  4ZL6 A;  2Z6M A;  1YK4 A;  2FL0 A;  3BVI A;  3BVE A;  2FG4 A;  2ZA6 A;  4P18 A;  2M6O A;  3PVR A;  1QYB A;  2LCQ A;  1RYT A;  2XJO A;  4YWM A;  3WNW A;  1SOF A;  4B8C D;  2UX1 A;  1Z6O A;  3PVT B;  4KVR A;  1VJX A;  2V2N A;  1NF4 A;  3F38 A;  4LYU A;  3GHQ A;  4XKS A;  3SE1 A;  4YWL A;  5GN8 A;  2XJR A;  4ZKX A;  1FHH A;  1RDV A;  4ZN1 B;  4CY9 A;  4X0J A;  4MUD A;  2MS3 A;  4CMY A;  5J9V A;  1YUX A;  2FJC A;  1B2O A;  1JYB A;  3E6S A;  1ZUJ A;  3K35 A;  4DAS A;  1TKP A;  1LKO A;  1TK6 A;  4JAF A;  2WTL A;  2M4V A;  4TOD A;  2CF7 A;  3KWO A;  3PW1 A;  1JIG A;  3ISE A;  4YXM A;  5GU2 X;  3KA3 A;  1DVB A;  3BKN A;  4ZMC A;  2YW7 A;  2IU2 A;  2CKA A;  2XJM A;  2Z3Q B;  1QGH A;  3IU3 I;  1BQ8 A;  1RCI A;  4MKU A;  4LQV A;  3PWQ C;  5GU0 X;  3IS8 A;  4YXJ A;  4ZJK A;  2ZG7 X;  3EZ0 A;  2GMG A;  2Z5R A;  4E40 A;  3ZG6 A;  3V3K B;  1VZI A;  3A9Q A;  1N1Q A;  2YJJ A;  4U67 1;  1H7V A;  1LKM A;  3F32 A;  4Z3B A;  1YUZ A;  1H96 A;  3E2C A;  3W54 A;  2C6A A;  2ZUR X;  2PVX A;  4AI0 A;  2M6P A;  4LHN A;  4E6Y A;  1VCX A;  4PGK A;  4RC6 A;  3VVA A;  2AR0 A;  1RB9 A;  5JKM A;  4M33 A;  3RGD A;  1ODH A;  4TOH A;  4RC8 A;  4MJY A;  3ES3 A;  4XKU A;  1XZ1 A;  2XGW A;  5C6F A;  2ITB A;  4A25 A;  3IQ1 A;  5JKM G;  3NOZ X;  4EVD A;  3B0A B;  4QUW A;  5IY0 A;  4LYX A;  2ZG9 X;  3P8B A;  4AHZ A;  4IWJ A;  1R0J A;  4TPU A;  2VXX A;  4AHW A;  3AJQ A;  3ERZ A;  4TOF A;  1BG7 A;  1RCG A;  4M32 A;  3PIO 1;  3KDQ A;  2CKC A;  5MLC 3;  5JVH 1;  3AK9 A;  4CVT A;  1FHM A;  1S24 A;  3H7G A;  3MSU A;  4ZN3 B;  4ZKH A;  4JAG A;  1AEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...