1NNQA

Rubrerythrin from pyrococcus furiosus pfu-1210814
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title Structural genomics of Pyrococcus furiosus: X-ray crystallography reveals 3D domain swapping in rubrerythrin
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 60
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1nnqA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1nnqA02
2CEIA 2V2PA 4Y08A 5E2DA 2CIHA 4M32A 4M33A 2FG8A 2PYAA 3EGMA 2V2RA 3AJQA 2ZG8X 4XKSA 2PVEA 2C2UA 2OC5A 3AF9X 4TOEA 4PGKA 3VNXA 1RCGA 3GVYA 4ITTA 1JGCA 3WVWA 4LQJA 1H96A 3RD0A 2Z6MA 3KA4A 3QB9A 2D5KA 1IROA 2M4YA 1R0GA 3E1NA 2HTNA 2WTLA 5LBHA 2G4HA 4DE6A 1YV1A 2FL0A 4TW3A 1RCCA 3RYGA 2CN7A 1CADA 2C41A 4CMYV 3UNOA 4TOCA 2FFXJ 1DVBA 5D8RA 4ISMA 3SIDA 3AF8X 3KXUA 3BVIA 1LTLA 2F7NA 1L8HA 3AJOA 5JACA 4POFA 1XZ3A 2CN6A 3ISEA 3UOFA 4CVRA 4II4A 4RC6A 3A44A 1LKPA 4RC5A 5D8PA 2FG4A 1T9QA 5D8SA 5C6FA 1DPSA 2IY4A 2BW1A 3F38A 4YKHA 5JKMG 4EVEA 5JKLA 4DI0A 1CAAA 1O9IA 3PVTA 4IWJA 3R2LA 3F35A 4CVSA 1R0HA 1F30A 4KVRA 4E6KA 2GYDA 3KA9A 2XJNA 1IERA 2JD80 5GN8A 1IRNA 1VEIA 2XJMA 2ZA6A 3QHBA 3WVVA 4LYUA 1BG7A 4DYZA 3BKNA 3PW8A 3KYWA 2V2JA 4REUA 2IB0A 1YUXA 3HL1A 2C6RA 2YJKA 3OJ5A 1BQ9A 1R0FA 5AXSA 1YK4A 1RCDA 3IS7A 4ML5A 5GOUA 3PWQA 3Q4RA 2CLUA 1SOFA 5AI2A 1Z6OM 2ZA7A 4TOBA 3ES3A 4DYYA 4XKUA 5HQOA 4CYBA 4KVSA 2BKCA 2ZURX 3Q4OA 3F36A 1EUMA 2Z90A 3PVTB 3R2OA 2IU2A 4OYNA 4K9FA 2YW6A 2JD60 4MN9A 2V2OA 3BVEA 2LCQA 3WVUA 3NP0X 1IESA 3PWFA 2V2NA 1VCXA 2X170 3PVYA 4ITWA 4TOHA 5ERKA 1T9OA 4ZMCA 1FHMA 2CHIA 2PVXA 5GN8B 7RXNA 3PW1A 4YWLA 3ERZA 1SMUA 3R2MA 2K2DA 4TOFA 2ZG9X 1DATA 3E1QA 4CMYA 2ZA8A 3E6RA 2YW7A 2Z5RA 5IY0A 6RXNA 1VLGA 3H7GA 4XGSA 2VZBA 3OGHA 1QCVA 3BVKA 4AR5A 3E1OA 1UMNA 1LKMA 4IWKA 3R2RA 3KYUA 4MKUA 1BFRA 3F34A 4P18A 4M35A 5J8SA 3KYYA 4DZ0A 1VJXA 4U3GA 1RCIA 1FHAA 4TOGA 1B2JA 5ERJA 2FHAA 4Z5SA 2FJCA 1DX8A 1BQ8A 4AR6A 1SQ3A 2Z5QA 1O9RA 4PG1A 4A25A 4EVDA 4IXKA 4M34A 3BVLA 2QF9A 1S24A 1L8IA 3R2SA 5GU2X 3PVYB 2MS3A 1VEQA 3PVRA 1Z4AA 3KYVA 3PW1B 1ZUJA 1N1QA 4AM5A 3UOIA 4ETRA 1TJOA 4PGIA 5FEJA 4LPNA 1RCEA 3T9JA 1T9PA 3RGDA 1NFVA 1BCFA 3HIUA 1J30A 5LG2A 3RE7A 5JKLG 4TPUA 2W0OA 3SH6A 3R2KA 3Q4NA 2C2JA 3E6SA 3QHCA 4EVCA 3KX9A 1FHHA 2RDVA 2KN9A 1NF4A 2CF7A 3RZ6A 1KRQA 1JI5A 2V2IA 4DASA 1S30A 3E1JA 1YUZA 1GWGA 2BK6A 4ZKHA 4ISPA 5LS9A 1IU6A 4ZL6A 2WLAA 3R2HA 8RXNA 1VELA 1YK5A 1B71A 2V2MA 1LB3A 2ZG7X 4AM4A 1R0IA 3PVRB 4TODA 4RC8A 1E8JA 4POGA 4ZTTA 1JI4A 3SHXA 5FFBA 3E1PA 1RWDA 1BFYA 1H7VA 2VXXA 2YJJA 3KYXA 3QZ3A 1JYBA 5GU3X 1TKOA 4LYXA 1ZRPA 3RAVA 3O7RA 3EZ0A 5CMRA 5FFCA 4EVBA 2V3BB 2FKZA 2VL6A 4CY9A 3AF7X 3AK8A 3E2CA 3A9QA 5RXNA 5HJFA 3KA6A 5GU0X 1OTKA 4MUDA 1Z6OA 3FSEA 5D8XA 2GYQA 3KA3A 2DSXA 3SE1A 4ZL5A 4DYUA 2WLUA 5E1UA 1IU5A 4LPMA 2GMGA 5LG8A 4TOAA 3U90A 1RDGA 1JTSA 2V2LA 1UVHA 2QQYA 1QYBA 2GS4A 4R42A 3PW8C 3IS8A 2FZFA 2PYBA 5CMQA 1JIGA 4ERUA 2UX1A 1XZ1A 3AJPA 3QD8A 5I4JA 1B13A 4CVPA 3BVFA 3Q4QA 2RBDA 4ME3A 3PWQC 5HJHA 1AEWA 4AM2A 1MOJA 3GE4A 1S2ZA 3NOZX 5J8WA 1RYTA 1S3QA 3WNWA 1QGHA 1BE7A 3KA8A 3ISFA 3EZUA 1JREA 1MFRA 5IX6A 3F37A 1F33A 3NP2X 4LPJA 3AK9A 4MJYA 3SS2A 2CLBA 3QVDA 3A68A 3F39A 1B2OA 2XJOA 2Z5PA 1JKUA 4CVTA 4YWMA 4CYAA 5FFAA 2OH3A 1ZS3A 3IQ1A 2BJYA 5D8YA 5FFDA 5AI3A 2JD70 4ZLWA 5K53A 1BRFA 3FVBA 3TA8A 3RZTA 5JKMA 4RC7A 1TKPA 2HR5A 2V2SA 4ZKXA 1SMWA 1NNQA 3FI6A 1R0JA 1LKOA 5D8QA 5GU1X 4QUWA 4PG0A 1JKVA 1C09A 1TK6A 4AR3A 2Y3QA 1NF6A 2V15A 5J93A 2XKQA 3KWOA 2QL0A 4TO9A 3PZAA 4LQVA 4RXNA 3F33A 3GHQA 4MY7A 2CHPA 3RBCA 3MPSA 2VXIA 5J9VA 2XGWA 3E1LA 4DYXA 1RB9A 1RDVA 5FFEA 3BT5A 4ZJKA 3E1MA 3O7SA 5D8OA 2KKDA 4XKTA 2C2FA 4II4B 5CZUA 1R03A 4RC6B 2ITBA 4RC5B 4Z3BA 4LQNA 4RC7B 1HRSA 1SMMA 4ZKWA 3F32A 5K52A 4KVQA 4LQHA 4AR4A
chains in the Genus database with same CATH superfamily
2CEIA 2V2PA 4Y08A 5E2DA 2CIHA 4M32A 4E6YA 4M33A 1VZIA 1WCML 5H1Sc 2FG8A 2PYAA 3EGMA 2V2RA 3AJQA 2ZG8X 4ZN1B 4XKSA 2PVEA 2C2UA 2OC5A 3AF9X 4TOEA 4PGKA 3VNXA 2CKCA 4Y52L 3S1ML 1RCGA 2Y0SP 3GVYA 4ITTA 3VVAA 1JGCA 3WVWA 2WB1P 4LQJA 1I6HL 1H96A 3RD0A 2Z6MA 3KA4A 3QB9A 4JADA 2D5KA 1IROA 2M4YA 1R0GA 5MF6A 5MLC3 3E1NA 2HTNA 2CWLA 3CQZL 2R7ZL 2JI1A 2WTLA 5LBHA 2G4HA 3S2HL 4DE6A 5M5XL 2VUML 1YV1A 2FL0A 4ZN3B 4TW3A 1RCCA 3RYGA 2CN7A 1CADA 2C41A 4CMYV 4X6AL 2AQCA 3UNOA 4TOCA 2FFXJ 4A3ML 3QQCE 1DVBA 5D8RA 2NVXL 4ISMA 3SIDA 3AF8X 3KDQA 3HOWL 3KXUA 2AR0A 3BVIA 2F7NA 1L8HA 1LTLA 3AJOA 3C1ZA 5JACA 2AUSB 3IU3I 3M3YL 4JAGA 4TVMA 4POFA 1XZ3A 4AHZA 2CN6A 3ISEA 5C4XL 4A3FL 4AYBP 4AI1A 3UOFA 4YXJA 3RZOL 4CVRA 4II4A 1SFOL 4RC6A 1TWGL 3A44A 1LKPA 4RC5A 5D8PA 2FG4A 3PKJA 1K83L 5D8SA 1T9QA 5C6FA 2ZIXA 1DPSA 2Y44A 5C4JL 3GTKL 2IY4A 3LKDA 2BW1A 3F38A 2M6PA 4YKHA 5JKMG 4EVEA 4AHYA 5JKLA 2A68D 4DI0A 1CAAA 1O9IA 2E2IL 3PVTA 3H9CA 4IWJA 2JI3A 3LWPB 5JVH1 3PO2L 2WWXB 3F35A 3R2LA 4CVSA 3JR7A 1R0HA 1F30A 3S2DL 4KVRA 4E6KA 2L0ZA 2GYDA 3KA9A 3LPEB 2XJNA 1IERA 2YU9L 3V3KB 2JD80 5GN8A 3KHKA 3L0MA 2XJSA 3NFPI 1IRNA 2A6ED 1VEIA 2XJMA 2ZA6A 3QHBA 3RZDL 3WVVA 3PKIA 5MGNA 4LYUA 1BG7A 4DYZA 3BKNA 3PW8A 3KYWA 4XGHA 2V2JA 5DM61 4REUA 2IB0A 1YUXA 2XJQA 3HOXL 4Y7NL 3HL1A 3HOZL 2C6RA 2YJKA 3OJ5A 1BQ9A 1R0FA 3S1NL 5AXSA 1YK4A 1RCDA 3IS7A 5M5WL 4ML5A 5GOUA 1OWBA 3PWQA 2ERJA 3Q4RA 4A3EL 3S1RL 2CLUA 4BBSL 1SOFA 3J7Z1 2CR8A 5AI2A 4BY7L 4LHLA 3GTLL 1Z6OM 3D19A 4A3CL 3PO3L 4AI2A 2ZA7A 4TOBA 3ES3A 4DYYA 4XKUA 5HQOA 4CYBA 4KVSA 2BKCA 2ZURX 3Q4OA 3F36A 3LWVB 1EUMA 2Z90A 3PVTB 3R2OA 2IU2A 4OYNA 4K9FA 2YW6A 2JD60 4MN9A 2XJVA 2V2OA 3BVEA 2LCQA 3WVUA 5AN9H 2XJRA 1I3QL 3NP0X 1IESA 3PWFA 2V2NA 1OWCA 1VCXA 2N02A 2X170 3PVYA 4ITWA 4TOHA 2JI2A 5ERKA 1T9OA 4ZMCA 1FHMA 1QQTA 5EINC 4UY81 2CHIA 2PVXA 5GN8B 7RXNA 3PW1A 2JA6L 3H9BA 4YWLA 3ERZA 1SMUA 3R2MA 2K2DA 4TOFA 2ZG9X 1DATA 3E1QA 4CMYA 3FKIL 2ZA8A 2NVTL 3I4NL 3E6RA 2YW7A 2Z5RA 5GAHc 5IY0A 4XXBB 6RXNA 1VLGA 3HAXC 3VV9A 3H7GA 4XGSA 2VZBA 3OGHA 1QCVA 2Z3QB 3BVKA 4AR5A 3E1OA 1UMNA 3H99A 1LKMA 2V8TA 3JZAB 2B63L 4BXXL 4IWKA 3R2RA 3KYUA 3DBYA 5M5YL 4MKUA 1BFRA 3F34A 4P18A 4M35A 3PL5A 5J8SA 3KYYA 4DZ0A 1VJXA 4U3GA 4AHWA 4A3DL 3M4OL 4G6BA 1RCIA 1FHAA 4TOGA 1B2JA 5JDOA 5ERJA 2FHAA 4Z5SA 2AYJA 2FJCA 1Z92B 1DX8A 1BQ8A 3VPBE 4AR6A 2PMZP 1SQ3A 2Z5QA 1O9RA 4PG1A 4A25A 4E40A 4EVDA 4IXKA 4M34A 2C6BA 3BVLA 4A3IL 2QF9A 1S24A 1L8IA 3R2SA 5GU2X 1Y1WL 5EIOC 3PVYB 3FRRA 4GS7D 4MXPA 2MS3A 1VEQA 3PVRA 1Z4AA 3KYVA 3PW1B 1WJVA 1ZUJA 1N1QA 4AM5A 3UOIA 4ETRA 3GTGL 1TJOA 4PGIA 5FEJA 4C3JL 5K2ME 3N6OA 3C23A 4LPNA 2PPTA 1RCEA 3S1QL 3T9JA 1T9PA 3RGDA 3J7Y1 1NFVA 1BCFA 3H3VM 3HIUA 1J30A 5LG2A 3RE7A 5JKLG 4TPUA 2W0OA 3SH6A 5C3EL 3R2KA 3M6JA 2R93L 4W4KB 1NXGA 3Q4NA 3PIP1 2A69D 2C2JA 3UFBA 3E6SA 1PFWA 2XJUA 3QHCA 3MSUA 4EVCA 3B08B 3KX9A 1FHHA 4C3IL 1PZXA 2MGYA 2RDVA 2KN9A 3LNLA 1NF4A 2CF7A 2C6AA 2RFKB 3GTML 3K35A 3RZ6A 4BBRL 1KRQA 1JI5A 3LWQB 2V2IA 5IYDL 5JDOB 4DASA 3S14L 1S30A 3E1JA 1YUZA 1GWGA 2BK6A 4WJG4 4ZKHA 4ISPA 5LS9A 1IU6A 2Z3RB 4BY1L 4ZL6A 2WLAA 3R2HA 3H0GL 8RXNA 1VELA 4C3HL 4YVZA 1YK5A 2WAQP 1B71A 2V2MA 1LB3A 2ZG7X 4AM4A 1R0IA 5IP7L 3S16L 3PVRB 4TODA 4RC8A 1E8JA 4POGA 4ZTTA 1JI4A 3S17L 2H12A 2ERSA 3SHXA 5FFBA 3FDJA 3E1PA 1RWDA 1BFYA 1H7VA 1PFYA 2VXXA 2YJJA 3KYXA 3GTJL 3QZ3A 1JYBA 1R9TL 5GU3X 3HOUL 1TKOA 4LYXA 1ZRPA 3HJYB 3WWNB 3RAVA 3O7RA 3EZ0A 5CMRA 1TWHL 3GGYA 5FFCA 3B0AB 4EVBA 3GTPL 1TWFL 2V3BB 2XJTA 3W54A 2FKZA 2VL6A 4CY9A 1Y1VL 3AF7X 2A6HD 5IP9L 4C2M1 3AK8A 3P2AA 2PSMC 3E2CA 3A9QA 5RXNA 5HJFA 3KA6A 2EY4E 5GU0X 2XJPA 1OTKA 4MUDA 1Z6OA 3FSEA 1PFVA 5D8XA 2GYQA 3KA3A 2DSXA 3SE1A 4ZL5A 4DYUA 2WLUA 5FLML 5E1UA 2HVYC 1IU5A 4LPMA 3MQKB 4AI3A 2NYDA 2E2HL 4A3LL 2GMGA 5LG8A 5DM71 4U671 4TOAA 3HKZP 3U90A 1RDGA 3C21A 1JTSA 2V2LA 1UVHA 2QQYA 3WWLA 5GADc 1QYBA 4B8CD 2GS4A 4R42A 3PW8C 3IS8A 3JZ9A 2FZFA 2PYBA 5CMQA 1JIGA 4ERUA 2UX1A 1XZ1A 3AJPA 3QD8A 5I4JA 4AI0A 2E2JL 2J9UB 1B13A 4CVPA 3BVFA 3Q4QA 5IYCL 2RBDA 4ME3A 3PWQC 5HJHA 1AEWA 2B5ID 3GTQL 4AM2A 2NVYL 1MOJA 3GE4A 4A3BL 1S2ZA 3NOZX 5J8WA 1TWAL 1RYTA 3LWRB 1S3QA 3ZG6A 3FRSA 3WNWA 2OKCA 1QGHA 4YXMA 1BE7A 4AHXA 3KA8A 3ISFA 3LWOB 3EZUA 3K7AL 3HOYL 1JREA 1MFRA 3H97A 5IX6A 3F37A 5GAEc 5M3FL 4KXRB 1F33A 3GGZA 2M4VA 3NP2X 4LPJA 2O5JD 5JVG1 3AK9A 4JAEA 4MJYA 3SS2A 2CLBA 2BE5D 1P7PA 3QVDA 3PIO1 3A68A 3F39A 1B2OA 1F4LA 2XJOA 2Z5PA 2V0EA 1JKUA 4CVTA 4YWMA 4WFN1 4CYAA 3I4ML 5FFAA 2OH3A 1ZS3A 1NXEA 3IQ1A 2BJYA 5D8YA 2JA5L 5FFDA 5AI3A 5C44L 2JD70 4ZLWA 4JAFA 5K53A 1BRFA 3FVBA 3TA8A 5MFPA 3RZTA 5JKMA 4RC7A 1TKPA 1I50L 2HR5A 1PFUA 2JA7L 2V2SA 4ZKXA 4A3KL 1TWCL 1SMWA 1NNQA 3FI6A 1R0JA 4LHNA 1LKOA 5D8QA 5GU1X 5GAGc 4QUWA 4PG0A 1RYQA 1JKVA 2NVQL 4W4LB 5MFZA 1C09A 1TK6A 4AR3A 2Y3QA 1NF6A 2V15A 2V0FA 5J93A 2XKQA 2JA8L 3C1YA 3KWOA 2QL0A 4V196 4X0JA 4TO9A 3GTOL 3PZAA 4LQVA 4RXNA 3F33A 3GHQA 4A3GL 4MY7A 5M3ML 2CHPA 3RBCA 3MPSA 1IW7D 2CKAA 2VXIA 3P8BA 5J9VA 2XGWA 3E1LA 4DYXA 1RB9A 2V8UA 1RDVA 3S15L 2R92L 5FFEA 1VZHA 3BT5A 4ZJKA 3E1MA 2G38B 3O7SA 5D8OA 2KKDA 4XKTA 2C2FA 4II4B 5CZUA 1R03A 4RC6B 2ITBA 1VZGA 4A93L 4RC5B 2APOB 4Z3BA 4LQNA 2M6OA 1ODHA 4RC7B 3HOVL 1HRSA 1SMMA 3HJWB 4ZKWA 5HU6D 4A3JL 3F32A 5IYBL 5K52A 5FJ8L 4KVQA 4QIWP 4LQHA 4AR4A
chains in the Genus database with same CATH topology
2CEIA 2V2PA 4Y08A 5E2DA 2CIHA 4M32A 4E6YA 4M33A 1VZIA 5H1Sc 2FG8A 2PYAA 3EGMA 2V2RA 3AJQA 2ZG8X 4ZN1B 4XKSA 2PVEA 2C2UA 2OC5A 3AF9X 4TOEA 4PGKA 3VNXA 2CKCA 1RCGA 3GVYA 4ITTA 3VVAA 1JGCA 3WVWA 4LQJA 1H96A 3RD0A 2Z6MA 3KA4A 3QB9A 4JADA 2D5KA 1IROA 2M4YA 1R0GA 5MF6A 5MLC3 3E1NA 2HTNA 2CWLA 2JI1A 2WTLA 5LBHA 2G4HA 4DE6A 1YV1A 2FL0A 4ZN3B 4TW3A 1RCCA 3RYGA 2CN7A 1CADA 2C41A 4CMYV 3UNOA 4TOCA 2FFXJ 3QQCE 1DVBA 5D8RA 4ISMA 3SIDA 3AF8X 3KDQA 3KXUA 2AR0A 3BVIA 2F7NA 1L8HA 1LTLA 3AJOA 3C1ZA 5JACA 3IU3I 4JAGA 4TVMA 4POFA 1XZ3A 4AHZA 2CN6A 3ISEA 4AI1A 3UOFA 4YXJA 4CVRA 4II4A 4RC6A 3A44A 1LKPA 4RC5A 5D8PA 2FG4A 3PKJA 1T9QA 5D8SA 5C6FA 2ZIXA 1DPSA 2Y44A 2IY4A 3LKDA 2BW1A 3F38A 2M6PA 4YKHA 5JKMG 4EVEA 4AHYA 5JKLA 2A68D 4DI0A 1CAAA 1O9IA 3PVTA 4IWJA 2JI3A 5JVH1 2WWXB 3F35A 3R2LA 4CVSA 1R0HA 1F30A 4KVRA 4E6KA 2L0ZA 2GYDA 3KA9A 3LPEB 2XJNA 1IERA 3V3KB 2JD80 5GN8A 3KHKA 3L0MA 2XJSA 3NFPI 1IRNA 2A6ED 1VEIA 2XJMA 2ZA6A 3QHBA 3WVVA 3PKIA 5MGNA 4LYUA 1BG7A 4DYZA 3BKNA 3PW8A 3KYWA 4XGHA 2V2JA 5DM61 4REUA 2IB0A 1YUXA 2XJQA 3HL1A 2C6RA 2YJKA 3OJ5A 1BQ9A 1R0FA 5AXSA 1YK4A 1RCDA 3IS7A 4ML5A 5GOUA 1OWBA 3PWQA 2ERJA 3Q4RA 2CLUA 1SOFA 3J7Z1 2CR8A 5AI2A 4LHLA 1Z6OM 3D19A 4AI2A 2ZA7A 4TOBA 3ES3A 4DYYA 4XKUA 5HQOA 4CYBA 4KVSA 2BKCA 2ZURX 3Q4OA 3F36A 1EUMA 2Z90A 3PVTB 3R2OA 2IU2A 4OYNA 4K9FA 2YW6A 2JD60 4MN9A 2XJVA 2V2OA 3BVEA 2LCQA 3WVUA 5AN9H 2XJRA 3NP0X 1IESA 3PWFA 2V2NA 1OWCA 1VCXA 2N02A 2X170 3PVYA 4ITWA 4TOHA 2JI2A 5ERKA 1T9OA 4ZMCA 1FHMA 5EINC 4UY81 2CHIA 2PVXA 5GN8B 7RXNA 3PW1A 4YWLA 3ERZA 1SMUA 3R2MA 2K2DA 4TOFA 2ZG9X 1DATA 3E1QA 4CMYA 2ZA8A 3E6RA 2YW7A 2Z5RA 5GAHc 5IY0A 4XXBB 6RXNA 1VLGA 3VV9A 3H7GA 4XGSA 2VZBA 3OGHA 1QCVA 2Z3QB 3BVKA 4AR5A 3E1OA 1UMNA 1LKMA 2V8TA 3JZAB 4IWKA 3R2RA 3KYUA 3DBYA 4MKUA 1BFRA 3F34A 4P18A 4M35A 5J8SA 3KYYA 4DZ0A 1VJXA 4U3GA 4AHWA 4G6BA 1RCIA 1FHAA 4TOGA 1B2JA 5JDOA 5ERJA 2FHAA 4Z5SA 2AYJA 2FJCA 1Z92B 1DX8A 1BQ8A 3VPBE 4AR6A 1SQ3A 2Z5QA 1O9RA 4PG1A 4A25A 4E40A 4EVDA 4IXKA 4M34A 2C6BA 3BVLA 2QF9A 1S24A 1L8IA 3R2SA 5GU2X 5EIOC 3PVYB 3FRRA 4GS7D 4MXPA 2MS3A 1VEQA 3PVRA 1Z4AA 3KYVA 3PW1B 1WJVA 1ZUJA 1N1QA 4AM5A 3UOIA 4ETRA 1TJOA 4PGIA 5FEJA 5K2ME 3N6OA 3C23A 4LPNA 2PPTA 1RCEA 3T9JA 1T9PA 3RGDA 3J7Y1 1NFVA 1BCFA 3HIUA 1J30A 5LG2A 3RE7A 5JKLG 4TPUA 2W0OA 3SH6A 3R2KA 3M6JA 4W4KB 1NXGA 3Q4NA 3PIP1 2A69D 2C2JA 3UFBA 3E6SA 2XJUA 3QHCA 3MSUA 4EVCA 3B08B 3KX9A 1FHHA 2MGYA 2RDVA 2KN9A 3LNLA 1NF4A 2CF7A 2C6AA 3K35A 3RZ6A 1KRQA 1JI5A 2V2IA 5JDOB 4DASA 1S30A 3E1JA 1YUZA 1GWGA 2BK6A 4WJG4 4ZKHA 4ISPA 5LS9A 1IU6A 2Z3RB 4ZL6A 2WLAA 3R2HA 8RXNA 1VELA 4YVZA 1YK5A 1B71A 2V2MA 1LB3A 2ZG7X 4AM4A 1R0IA 3PVRB 4TODA 4RC8A 1E8JA 4POGA 4ZTTA 1JI4A 2H12A 2ERSA 3SHXA 5FFBA 3E1PA 1RWDA 1BFYA 1H7VA 2VXXA 2YJJA 3KYXA 3QZ3A 1JYBA 5GU3X 1TKOA 4LYXA 1ZRPA 3WWNB 3RAVA 3O7RA 3EZ0A 5CMRA 3B0AB 3GGYA 5FFCA 4EVBA 2V3BB 2XJTA 3W54A 2FKZA 2VL6A 4CY9A 2A6HD 3AF7X 3AK8A 3P2AA 2PSMC 3E2CA 3A9QA 5RXNA 5HJFA 3KA6A 5GU0X 2XJPA 1OTKA 4MUDA 1Z6OA 3FSEA 5D8XA 2GYQA 3KA3A 2DSXA 3SE1A 4ZL5A 4DYUA 2WLUA 5E1UA 1IU5A 4LPMA 4AI3A 2NYDA 2GMGA 5LG8A 5DM71 4U671 4TOAA 3U90A 1RDGA 3C21A 1JTSA 2V2LA 1UVHA 2QQYA 3WWLA 5GADc 1QYBA 4B8CD 2GS4A 4R42A 3PW8C 3IS8A 3JZ9A 2FZFA 2PYBA 5CMQA 1JIGA 4ERUA 2UX1A 1XZ1A 3AJPA 3QD8A 5I4JA 4AI0A 2J9UB 1B13A 4CVPA 3BVFA 3Q4QA 2RBDA 4ME3A 3PWQC 5HJHA 1AEWA 2B5ID 4AM2A 1MOJA 3GE4A 1S2ZA 3NOZX 5J8WA 1RYTA 1S3QA 3ZG6A 3FRSA 3WNWA 2OKCA 1QGHA 4YXMA 1BE7A 4AHXA 3KA8A 3ISFA 3EZUA 1JREA 1MFRA 5IX6A 3F37A 5GAEc 4KXRB 1F33A 3GGZA 2M4VA 3NP2X 4LPJA 2O5JD 5JVG1 3AK9A 4JAEA 4MJYA 3SS2A 2CLBA 2BE5D 3QVDA 3PIO1 3A68A 3F39A 1B2OA 2XJOA 2Z5PA 2V0EA 1JKUA 4CVTA 4YWMA 4WFN1 4CYAA 5FFAA 2OH3A 1ZS3A 1NXEA 3IQ1A 2BJYA 5D8YA 5FFDA 5AI3A 2JD70 4ZLWA 4JAFA 5K53A 1BRFA 3FVBA 3TA8A 5MFPA 3RZTA 5JKMA 4RC7A 1TKPA 2HR5A 2V2SA 4ZKXA 1SMWA 1NNQA 3FI6A 1R0JA 4LHNA 1LKOA 5D8QA 5GU1X 5GAGc 4QUWA 4PG0A 1RYQA 1JKVA 4W4LB 5MFZA 1C09A 1TK6A 4AR3A 2Y3QA 1NF6A 2V15A 2V0FA 5J93A 2XKQA 3C1YA 3KWOA 2QL0A 4V196 4X0JA 4TO9A 3PZAA 4LQVA 4RXNA 3F33A 3GHQA 4MY7A 2CHPA 3RBCA 3MPSA 1IW7D 2CKAA 2VXIA 3P8BA 5J9VA 2XGWA 3E1LA 4DYXA 1RB9A 2V8UA 1RDVA 5FFEA 1VZHA 3BT5A 4ZJKA 3E1MA 2G38B 3O7SA 5D8OA 2KKDA 4XKTA 2C2FA 4II4B 5CZUA 1R03A 4RC6B 2ITBA 1VZGA 4RC5B 4Z3BA 4LQNA 2M6OA 1ODHA 4RC7B 1HRSA 1SMMA 4ZKWA 5HU6D 3F32A 5K52A 4KVQA 4LQHA 4AR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CEI A;  2V2P A;  4Y08 A;  5E2D A;  2CIH A;  4M32 A;  4M33 A;  2FG8 A;  2PYA A;  3EGM A;  2V2R A;  3AJQ A;  2ZG8 X;  4XKS A;  2PVE A;  2C2U A;  2OC5 A;  3AF9 X;  4TOE A;  4PGK A;  3VNX A;  1RCG A;  3GVY A;  4ITT A;  1JGC A;  3WVW A;  4LQJ A;  1H96 A;  3RD0 A;  2Z6M A;  3KA4 A;  3QB9 A;  2D5K A;  1IRO A;  2M4Y A;  1R0G A;  3E1N A;  2HTN A;  2WTL A;  5LBH A;  2G4H A;  4DE6 A;  1YV1 A;  2FL0 A;  4TW3 A;  1RCC A;  3RYG A;  2CN7 A;  1CAD A;  2C41 A;  4CMY V;  3UNO A;  4TOC A;  2FFX J;  1DVB A;  5D8R A;  4ISM A;  3SID A;  3AF8 X;  3KXU A;  3BVI A;  1LTL A;  2F7N A;  1L8H A;  3AJO A;  5JAC A;  4POF A;  1XZ3 A;  2CN6 A;  3ISE A;  3UOF A;  4CVR A;  4II4 A;  4RC6 A;  3A44 A;  1LKP A;  4RC5 A;  5D8P A;  2FG4 A;  1T9Q A;  5D8S A;  5C6F A;  1DPS A;  2IY4 A;  2BW1 A;  3F38 A;  4YKH A;  5JKM G;  4EVE A;  5JKL A;  4DI0 A;  1CAA A;  1O9I A;  3PVT A;  4IWJ A;  3R2L A;  3F35 A;  4CVS A;  1R0H A;  1F30 A;  4KVR A;  4E6K A;  2GYD A;  3KA9 A;  2XJN A;  1IER A;  2JD8 0;  5GN8 A;  1IRN A;  1VEI A;  2XJM A;  2ZA6 A;  3QHB A;  3WVV A;  4LYU A;  1BG7 A;  4DYZ A;  3BKN A;  3PW8 A;  3KYW A;  2V2J A;  4REU A;  2IB0 A;  1YUX A;  3HL1 A;  2C6R A;  2YJK A;  3OJ5 A;  1BQ9 A;  1R0F A;  5AXS A;  1YK4 A;  1RCD A;  3IS7 A;  4ML5 A;  5GOU A;  3PWQ A;  3Q4R A;  2CLU A;  1SOF A;  5AI2 A;  1Z6O M;  2ZA7 A;  4TOB A;  3ES3 A;  4DYY A;  4XKU A;  5HQO A;  4CYB A;  4KVS A;  2BKC A;  2ZUR X;  3Q4O A;  3F36 A;  1EUM A;  2Z90 A;  3PVT B;  3R2O A;  2IU2 A;  4OYN A;  4K9F A;  2YW6 A;  2JD6 0;  4MN9 A;  2V2O A;  3BVE A;  2LCQ A;  3WVU A;  3NP0 X;  1IES A;  3PWF A;  2V2N A;  1VCX A;  2X17 0;  3PVY A;  4ITW A;  4TOH A;  5ERK A;  1T9O A;  4ZMC A;  1FHM A;  2CHI A;  2PVX A;  5GN8 B;  7RXN A;  3PW1 A;  4YWL A;  3ERZ A;  1SMU A;  3R2M A;  2K2D A;  4TOF A;  2ZG9 X;  1DAT A;  3E1Q A;  4CMY A;  2ZA8 A;  3E6R A;  2YW7 A;  2Z5R A;  5IY0 A;  6RXN A;  1VLG A;  3H7G A;  4XGS A;  2VZB A;  3OGH A;  1QCV A;  3BVK A;  4AR5 A;  3E1O A;  1UMN A;  1LKM A;  4IWK A;  3R2R A;  3KYU A;  4MKU A;  1BFR A;  3F34 A;  4P18 A;  4M35 A;  5J8S A;  3KYY A;  4DZ0 A;  1VJX A;  4U3G A;  1RCI A;  1FHA A;  4TOG A;  1B2J A;  5ERJ A;  2FHA A;  4Z5S A;  2FJC A;  1DX8 A;  1BQ8 A;  4AR6 A;  1SQ3 A;  2Z5Q A;  1O9R A;  4PG1 A;  4A25 A;  4EVD A;  4IXK A;  4M34 A;  3BVL A;  2QF9 A;  1S24 A;  1L8I A;  3R2S A;  5GU2 X;  3PVY B;  2MS3 A;  1VEQ A;  3PVR A;  1Z4A A;  3KYV A;  3PW1 B;  1ZUJ A;  1N1Q A;  4AM5 A;  3UOI A;  4ETR A;  1TJO A;  4PGI A;  5FEJ A;  4LPN A;  1RCE A;  3T9J A;  1T9P A;  3RGD A;  1NFV A;  1BCF A;  3HIU A;  1J30 A;  5LG2 A;  3RE7 A;  5JKL G;  4TPU A;  2W0O A;  3SH6 A;  3R2K A;  3Q4N A;  2C2J A;  3E6S A;  3QHC A;  4EVC A;  3KX9 A;  1FHH A;  2RDV A;  2KN9 A;  1NF4 A;  2CF7 A;  3RZ6 A;  1KRQ A;  1JI5 A;  2V2I A;  4DAS A;  1S30 A;  3E1J A;  1YUZ A;  1GWG A;  2BK6 A;  4ZKH A;  4ISP A;  5LS9 A;  1IU6 A;  4ZL6 A;  2WLA A;  3R2H A;  8RXN A;  1VEL A;  1YK5 A;  1B71 A;  2V2M A;  1LB3 A;  2ZG7 X;  4AM4 A;  1R0I A;  3PVR B;  4TOD A;  4RC8 A;  1E8J A;  4POG A;  4ZTT A;  1JI4 A;  3SHX A;  5FFB A;  3E1P A;  1RWD A;  1BFY A;  1H7V A;  2VXX A;  2YJJ A;  3KYX A;  3QZ3 A;  1JYB A;  5GU3 X;  1TKO A;  4LYX A;  1ZRP A;  3RAV A;  3O7R A;  3EZ0 A;  5CMR A;  5FFC A;  4EVB A;  2V3B B;  2FKZ A;  2VL6 A;  4CY9 A;  3AF7 X;  3AK8 A;  3E2C A;  3A9Q A;  5RXN A;  5HJF A;  3KA6 A;  5GU0 X;  1OTK A;  4MUD A;  1Z6O A;  3FSE A;  5D8X A;  2GYQ A;  3KA3 A;  2DSX A;  3SE1 A;  4ZL5 A;  4DYU A;  2WLU A;  5E1U A;  1IU5 A;  4LPM A;  2GMG A;  5LG8 A;  4TOA A;  3U90 A;  1RDG A;  1JTS A;  2V2L A;  1UVH A;  2QQY A;  1QYB A;  2GS4 A;  4R42 A;  3PW8 C;  3IS8 A;  2FZF A;  2PYB A;  5CMQ A;  1JIG A;  4ERU A;  2UX1 A;  1XZ1 A;  3AJP A;  3QD8 A;  5I4J A;  1B13 A;  4CVP A;  3BVF A;  3Q4Q A;  2RBD A;  4ME3 A;  3PWQ C;  5HJH A;  1AEW A;  4AM2 A;  1MOJ A;  3GE4 A;  1S2Z A;  3NOZ X;  5J8W A;  1RYT A;  1S3Q A;  3WNW A;  1QGH A;  1BE7 A;  3KA8 A;  3ISF A;  3EZU A;  1JRE A;  1MFR A;  5IX6 A;  3F37 A;  1F33 A;  3NP2 X;  4LPJ A;  3AK9 A;  4MJY A;  3SS2 A;  2CLB A;  3QVD A;  3A68 A;  3F39 A;  1B2O A;  2XJO A;  2Z5P A;  1JKU A;  4CVT A;  4YWM A;  4CYA A;  5FFA A;  2OH3 A;  1ZS3 A;  3IQ1 A;  2BJY A;  5D8Y A;  5FFD A;  5AI3 A;  2JD7 0;  4ZLW A;  5K53 A;  1BRF A;  3FVB A;  3TA8 A;  3RZT A;  5JKM A;  4RC7 A;  1TKP A;  2HR5 A;  2V2S A;  4ZKX A;  1SMW A;  1NNQ A;  3FI6 A;  1R0J A;  1LKO A;  5D8Q A;  5GU1 X;  4QUW A;  4PG0 A;  1JKV A;  1C09 A;  1TK6 A;  4AR3 A;  2Y3Q A;  1NF6 A;  2V15 A;  5J93 A;  2XKQ A;  3KWO A;  2QL0 A;  4TO9 A;  3PZA A;  4LQV A;  4RXN A;  3F33 A;  3GHQ A;  4MY7 A;  2CHP A;  3RBC A;  3MPS A;  2VXI A;  5J9V A;  2XGW A;  3E1L A;  4DYX A;  1RB9 A;  1RDV A;  5FFE A;  3BT5 A;  4ZJK A;  3E1M A;  3O7S A;  5D8O A;  2KKD A;  4XKT A;  2C2F A;  4II4 B;  5CZU A;  1R03 A;  4RC6 B;  2ITB A;  4RC5 B;  4Z3B A;  4LQN A;  4RC7 B;  1HRS A;  1SMM A;  4ZKW A;  3F32 A;  5K52 A;  4KVQ A;  4LQH A;  4AR4 A; 
#chains in the Genus database with same CATH topology
 2CEI A;  2V2P A;  4Y08 A;  5E2D A;  2CIH A;  4M32 A;  4E6Y A;  4M33 A;  1VZI A;  1WCM L;  5H1S c;  2FG8 A;  2PYA A;  3EGM A;  2V2R A;  3AJQ A;  2ZG8 X;  4ZN1 B;  4XKS A;  2PVE A;  2C2U A;  2OC5 A;  3AF9 X;  4TOE A;  4PGK A;  3VNX A;  2CKC A;  4Y52 L;  3S1M L;  1RCG A;  2Y0S P;  3GVY A;  4ITT A;  3VVA A;  1JGC A;  3WVW A;  2WB1 P;  4LQJ A;  1I6H L;  1H96 A;  3RD0 A;  2Z6M A;  3KA4 A;  3QB9 A;  4JAD A;  2D5K A;  1IRO A;  2M4Y A;  1R0G A;  5MF6 A;  5MLC 3;  3E1N A;  2HTN A;  2CWL A;  3CQZ L;  2R7Z L;  2JI1 A;  2WTL A;  5LBH A;  2G4H A;  3S2H L;  4DE6 A;  5M5X L;  2VUM L;  1YV1 A;  2FL0 A;  4ZN3 B;  4TW3 A;  1RCC A;  3RYG A;  2CN7 A;  1CAD A;  2C41 A;  4CMY V;  4X6A L;  2AQC A;  3UNO A;  4TOC A;  2FFX J;  4A3M L;  3QQC E;  1DVB A;  5D8R A;  2NVX L;  4ISM A;  3SID A;  3AF8 X;  3KDQ A;  3HOW L;  3KXU A;  2AR0 A;  3BVI A;  2F7N A;  1L8H A;  1LTL A;  3AJO A;  3C1Z A;  5JAC A;  2AUS B;  3IU3 I;  3M3Y L;  4JAG A;  4TVM A;  4POF A;  1XZ3 A;  4AHZ A;  2CN6 A;  3ISE A;  5C4X L;  4A3F L;  4AYB P;  4AI1 A;  3UOF A;  4YXJ A;  3RZO L;  4CVR A;  4II4 A;  1SFO L;  4RC6 A;  1TWG L;  3A44 A;  1LKP A;  4RC5 A;  5D8P A;  2FG4 A;  3PKJ A;  1K83 L;  5D8S A;  1T9Q A;  5C6F A;  2ZIX A;  1DPS A;  2Y44 A;  5C4J L;  3GTK L;  2IY4 A;  3LKD A;  2BW1 A;  3F38 A;  2M6P A;  4YKH A;  5JKM G;  4EVE A;  4AHY A;  5JKL A;  2A68 D;  4DI0 A;  1CAA A;  1O9I A;  2E2I L;  3PVT A;  3H9C A;  4IWJ A;  2JI3 A;  3LWP B;  5JVH 1;  3PO2 L;  2WWX B;  3F35 A;  3R2L A;  4CVS A;  3JR7 A;  1R0H A;  1F30 A;  3S2D L;  4KVR A;  4E6K A;  2L0Z A;  2GYD A;  3KA9 A;  3LPE B;  2XJN A;  1IER A;  2YU9 L;  3V3K B;  2JD8 0;  5GN8 A;  3KHK A;  3L0M A;  2XJS A;  3NFP I;  1IRN A;  2A6E D;  1VEI A;  2XJM A;  2ZA6 A;  3QHB A;  3RZD L;  3WVV A;  3PKI A;  5MGN A;  4LYU A;  1BG7 A;  4DYZ A;  3BKN A;  3PW8 A;  3KYW A;  4XGH A;  2V2J A;  5DM6 1;  4REU A;  2IB0 A;  1YUX A;  2XJQ A;  3HOX L;  4Y7N L;  3HL1 A;  3HOZ L;  2C6R A;  2YJK A;  3OJ5 A;  1BQ9 A;  1R0F A;  3S1N L;  5AXS A;  1YK4 A;  1RCD A;  3IS7 A;  5M5W L;  4ML5 A;  5GOU A;  1OWB A;  3PWQ A;  2ERJ A;  3Q4R A;  4A3E L;  3S1R L;  2CLU A;  4BBS L;  1SOF A;  3J7Z 1;  2CR8 A;  5AI2 A;  4BY7 L;  4LHL A;  3GTL L;  1Z6O M;  3D19 A;  4A3C L;  3PO3 L;  4AI2 A;  2ZA7 A;  4TOB A;  3ES3 A;  4DYY A;  4XKU A;  5HQO A;  4CYB A;  4KVS A;  2BKC A;  2ZUR X;  3Q4O A;  3F36 A;  3LWV B;  1EUM A;  2Z90 A;  3PVT B;  3R2O A;  2IU2 A;  4OYN A;  4K9F A;  2YW6 A;  2JD6 0;  4MN9 A;  2XJV A;  2V2O A;  3BVE A;  2LCQ A;  3WVU A;  5AN9 H;  2XJR A;  1I3Q L;  3NP0 X;  1IES A;  3PWF A;  2V2N A;  1OWC A;  1VCX A;  2N02 A;  2X17 0;  3PVY A;  4ITW A;  4TOH A;  2JI2 A;  5ERK A;  1T9O A;  4ZMC A;  1FHM A;  1QQT A;  5EIN C;  4UY8 1;  2CHI A;  2PVX A;  5GN8 B;  7RXN A;  3PW1 A;  2JA6 L;  3H9B A;  4YWL A;  3ERZ A;  1SMU A;  3R2M A;  2K2D A;  4TOF A;  2ZG9 X;  1DAT A;  3E1Q A;  4CMY A;  3FKI L;  2ZA8 A;  2NVT L;  3I4N L;  3E6R A;  2YW7 A;  2Z5R A;  5GAH c;  5IY0 A;  4XXB B;  6RXN A;  1VLG A;  3HAX C;  3VV9 A;  3H7G A;  4XGS A;  2VZB A;  3OGH A;  1QCV A;  2Z3Q B;  3BVK A;  4AR5 A;  3E1O A;  1UMN A;  3H99 A;  1LKM A;  2V8T A;  3JZA B;  2B63 L;  4BXX L;  4IWK A;  3R2R A;  3KYU A;  3DBY A;  5M5Y L;  4MKU A;  1BFR A;  3F34 A;  4P18 A;  4M35 A;  3PL5 A;  5J8S A;  3KYY A;  4DZ0 A;  1VJX A;  4U3G A;  4AHW A;  4A3D L;  3M4O L;  4G6B A;  1RCI A;  1FHA A;  4TOG A;  1B2J A;  5JDO A;  5ERJ A;  2FHA A;  4Z5S A;  2AYJ A;  2FJC A;  1Z92 B;  1DX8 A;  1BQ8 A;  3VPB E;  4AR6 A;  2PMZ P;  1SQ3 A;  2Z5Q A;  1O9R A;  4PG1 A;  4A25 A;  4E40 A;  4EVD A;  4IXK A;  4M34 A;  2C6B A;  3BVL A;  4A3I L;  2QF9 A;  1S24 A;  1L8I A;  3R2S A;  5GU2 X;  1Y1W L;  5EIO C;  3PVY B;  3FRR A;  4GS7 D;  4MXP A;  2MS3 A;  1VEQ A;  3PVR A;  1Z4A A;  3KYV A;  3PW1 B;  1WJV A;  1ZUJ A;  1N1Q A;  4AM5 A;  3UOI A;  4ETR A;  3GTG L;  1TJO A;  4PGI A;  5FEJ A;  4C3J L;  5K2M E;  3N6O A;  3C23 A;  4LPN A;  2PPT A;  1RCE A;  3S1Q L;  3T9J A;  1T9P A;  3RGD A;  3J7Y 1;  1NFV A;  1BCF A;  3H3V M;  3HIU A;  1J30 A;  5LG2 A;  3RE7 A;  5JKL G;  4TPU A;  2W0O A;  3SH6 A;  5C3E L;  3R2K A;  3M6J A;  2R93 L;  4W4K B;  1NXG A;  3Q4N A;  3PIP 1;  2A69 D;  2C2J A;  3UFB A;  3E6S A;  1PFW A;  2XJU A;  3QHC A;  3MSU A;  4EVC A;  3B08 B;  3KX9 A;  1FHH A;  4C3I L;  1PZX A;  2MGY A;  2RDV A;  2KN9 A;  3LNL A;  1NF4 A;  2CF7 A;  2C6A A;  2RFK B;  3GTM L;  3K35 A;  3RZ6 A;  4BBR L;  1KRQ A;  1JI5 A;  3LWQ B;  2V2I A;  5IYD L;  5JDO B;  4DAS A;  3S14 L;  1S30 A;  3E1J A;  1YUZ A;  1GWG A;  2BK6 A;  4WJG 4;  4ZKH A;  4ISP A;  5LS9 A;  1IU6 A;  2Z3R B;  4BY1 L;  4ZL6 A;  2WLA A;  3R2H A;  3H0G L;  8RXN A;  1VEL A;  4C3H L;  4YVZ A;  1YK5 A;  2WAQ P;  1B71 A;  2V2M A;  1LB3 A;  2ZG7 X;  4AM4 A;  1R0I A;  5IP7 L;  3S16 L;  3PVR B;  4TOD A;  4RC8 A;  1E8J A;  4POG A;  4ZTT A;  1JI4 A;  3S17 L;  2H12 A;  2ERS A;  3SHX A;  5FFB A;  3FDJ A;  3E1P A;  1RWD A;  1BFY A;  1H7V A;  1PFY A;  2VXX A;  2YJJ A;  3KYX A;  3GTJ L;  3QZ3 A;  1JYB A;  1R9T L;  5GU3 X;  3HOU L;  1TKO A;  4LYX A;  1ZRP A;  3HJY B;  3WWN B;  3RAV A;  3O7R A;  3EZ0 A;  5CMR A;  1TWH L;  3GGY A;  5FFC A;  3B0A B;  4EVB A;  3GTP L;  1TWF L;  2V3B B;  2XJT A;  3W54 A;  2FKZ A;  2VL6 A;  4CY9 A;  1Y1V L;  3AF7 X;  2A6H D;  5IP9 L;  4C2M 1;  3AK8 A;  3P2A A;  2PSM C;  3E2C A;  3A9Q A;  5RXN A;  5HJF A;  3KA6 A;  2EY4 E;  5GU0 X;  2XJP A;  1OTK A;  4MUD A;  1Z6O A;  3FSE A;  1PFV A;  5D8X A;  2GYQ A;  3KA3 A;  2DSX A;  3SE1 A;  4ZL5 A;  4DYU A;  2WLU A;  5FLM L;  5E1U A;  2HVY C;  1IU5 A;  4LPM A;  3MQK B;  4AI3 A;  2NYD A;  2E2H L;  4A3L L;  2GMG A;  5LG8 A;  5DM7 1;  4U67 1;  4TOA A;  3HKZ P;  3U90 A;  1RDG A;  3C21 A;  1JTS A;  2V2L A;  1UVH A;  2QQY A;  3WWL A;  5GAD c;  1QYB A;  4B8C D;  2GS4 A;  4R42 A;  3PW8 C;  3IS8 A;  3JZ9 A;  2FZF A;  2PYB A;  5CMQ A;  1JIG A;  4ERU A;  2UX1 A;  1XZ1 A;  3AJP A;  3QD8 A;  5I4J A;  4AI0 A;  2E2J L;  2J9U B;  1B13 A;  4CVP A;  3BVF A;  3Q4Q A;  5IYC L;  2RBD A;  4ME3 A;  3PWQ C;  5HJH A;  1AEW A;  2B5I D;  3GTQ L;  4AM2 A;  2NVY L;  1MOJ A;  3GE4 A;  4A3B L;  1S2Z A;  3NOZ X;  5J8W A;  1TWA L;  1RYT A;  3LWR B;  1S3Q A;  3ZG6 A;  3FRS A;  3WNW A;  2OKC A;  1QGH A;  4YXM A;  1BE7 A;  4AHX A;  3KA8 A;  3ISF A;  3LWO B;  3EZU A;  3K7A L;  3HOY L;  1JRE A;  1MFR A;  3H97 A;  5IX6 A;  3F37 A;  5GAE c;  5M3F L;  4KXR B;  1F33 A;  3GGZ A;  2M4V A;  3NP2 X;  4LPJ A;  2O5J D;  5JVG 1;  3AK9 A;  4JAE A;  4MJY A;  3SS2 A;  2CLB A;  2BE5 D;  1P7P A;  3QVD A;  3PIO 1;  3A68 A;  3F39 A;  1B2O A;  1F4L A;  2XJO A;  2Z5P A;  2V0E A;  1JKU A;  4CVT A;  4YWM A;  4WFN 1;  4CYA A;  3I4M L;  5FFA A;  2OH3 A;  1ZS3 A;  1NXE A;  3IQ1 A;  2BJY A;  5D8Y A;  2JA5 L;  5FFD A;  5AI3 A;  5C44 L;  2JD7 0;  4ZLW A;  4JAF A;  5K53 A;  1BRF A;  3FVB A;  3TA8 A;  5MFP A;  3RZT A;  5JKM A;  4RC7 A;  1TKP A;  1I50 L;  2HR5 A;  1PFU A;  2JA7 L;  2V2S A;  4ZKX A;  4A3K L;  1TWC L;  1SMW A;  1NNQ A;  3FI6 A;  1R0J A;  4LHN A;  1LKO A;  5D8Q A;  5GU1 X;  5GAG c;  4QUW A;  4PG0 A;  1RYQ A;  1JKV A;  2NVQ L;  4W4L B;  5MFZ A;  1C09 A;  1TK6 A;  4AR3 A;  2Y3Q A;  1NF6 A;  2V15 A;  2V0F A;  5J93 A;  2XKQ A;  2JA8 L;  3C1Y A;  3KWO A;  2QL0 A;  4V19 6;  4X0J A;  4TO9 A;  3GTO L;  3PZA A;  4LQV A;  4RXN A;  3F33 A;  3GHQ A;  4A3G L;  4MY7 A;  5M3M L;  2CHP A;  3RBC A;  3MPS A;  1IW7 D;  2CKA A;  2VXI A;  3P8B A;  5J9V A;  2XGW A;  3E1L A;  4DYX A;  1RB9 A;  2V8U A;  1RDV A;  3S15 L;  2R92 L;  5FFE A;  1VZH A;  3BT5 A;  4ZJK A;  3E1M A;  2G38 B;  3O7S A;  5D8O A;  2KKD A;  4XKT A;  2C2F A;  4II4 B;  5CZU A;  1R03 A;  4RC6 B;  2ITB A;  1VZG A;  4A93 L;  4RC5 B;  2APO B;  4Z3B A;  4LQN A;  2M6O A;  1ODH A;  4RC7 B;  3HOV L;  1HRS A;  1SMM A;  3HJW B;  4ZKW A;  5HU6 D;  4A3J L;  3F32 A;  5IYB L;  5K52 A;  5FJ8 L;  4KVQ A;  4QIW P;  4LQH A;  4AR4 A; 
#chains in the Genus database with same CATH homology
 2CEI A;  2V2P A;  4Y08 A;  5E2D A;  2CIH A;  4M32 A;  4E6Y A;  4M33 A;  1VZI A;  5H1S c;  2FG8 A;  2PYA A;  3EGM A;  2V2R A;  3AJQ A;  2ZG8 X;  4ZN1 B;  4XKS A;  2PVE A;  2C2U A;  2OC5 A;  3AF9 X;  4TOE A;  4PGK A;  3VNX A;  2CKC A;  1RCG A;  3GVY A;  4ITT A;  3VVA A;  1JGC A;  3WVW A;  4LQJ A;  1H96 A;  3RD0 A;  2Z6M A;  3KA4 A;  3QB9 A;  4JAD A;  2D5K A;  1IRO A;  2M4Y A;  1R0G A;  5MF6 A;  5MLC 3;  3E1N A;  2HTN A;  2CWL A;  2JI1 A;  2WTL A;  5LBH A;  2G4H A;  4DE6 A;  1YV1 A;  2FL0 A;  4ZN3 B;  4TW3 A;  1RCC A;  3RYG A;  2CN7 A;  1CAD A;  2C41 A;  4CMY V;  3UNO A;  4TOC A;  2FFX J;  3QQC E;  1DVB A;  5D8R A;  4ISM A;  3SID A;  3AF8 X;  3KDQ A;  3KXU A;  2AR0 A;  3BVI A;  2F7N A;  1L8H A;  1LTL A;  3AJO A;  3C1Z A;  5JAC A;  3IU3 I;  4JAG A;  4TVM A;  4POF A;  1XZ3 A;  4AHZ A;  2CN6 A;  3ISE A;  4AI1 A;  3UOF A;  4YXJ A;  4CVR A;  4II4 A;  4RC6 A;  3A44 A;  1LKP A;  4RC5 A;  5D8P A;  2FG4 A;  3PKJ A;  1T9Q A;  5D8S A;  5C6F A;  2ZIX A;  1DPS A;  2Y44 A;  2IY4 A;  3LKD A;  2BW1 A;  3F38 A;  2M6P A;  4YKH A;  5JKM G;  4EVE A;  4AHY A;  5JKL A;  2A68 D;  4DI0 A;  1CAA A;  1O9I A;  3PVT A;  4IWJ A;  2JI3 A;  5JVH 1;  2WWX B;  3F35 A;  3R2L A;  4CVS A;  1R0H A;  1F30 A;  4KVR A;  4E6K A;  2L0Z A;  2GYD A;  3KA9 A;  3LPE B;  2XJN A;  1IER A;  3V3K B;  2JD8 0;  5GN8 A;  3KHK A;  3L0M A;  2XJS A;  3NFP I;  1IRN A;  2A6E D;  1VEI A;  2XJM A;  2ZA6 A;  3QHB A;  3WVV A;  3PKI A;  5MGN A;  4LYU A;  1BG7 A;  4DYZ A;  3BKN A;  3PW8 A;  3KYW A;  4XGH A;  2V2J A;  5DM6 1;  4REU A;  2IB0 A;  1YUX A;  2XJQ A;  3HL1 A;  2C6R A;  2YJK A;  3OJ5 A;  1BQ9 A;  1R0F A;  5AXS A;  1YK4 A;  1RCD A;  3IS7 A;  4ML5 A;  5GOU A;  1OWB A;  3PWQ A;  2ERJ A;  3Q4R A;  2CLU A;  1SOF A;  3J7Z 1;  2CR8 A;  5AI2 A;  4LHL A;  1Z6O M;  3D19 A;  4AI2 A;  2ZA7 A;  4TOB A;  3ES3 A;  4DYY A;  4XKU A;  5HQO A;  4CYB A;  4KVS A;  2BKC A;  2ZUR X;  3Q4O A;  3F36 A;  1EUM A;  2Z90 A;  3PVT B;  3R2O A;  2IU2 A;  4OYN A;  4K9F A;  2YW6 A;  2JD6 0;  4MN9 A;  2XJV A;  2V2O A;  3BVE A;  2LCQ A;  3WVU A;  5AN9 H;  2XJR A;  3NP0 X;  1IES A;  3PWF A;  2V2N A;  1OWC A;  1VCX A;  2N02 A;  2X17 0;  3PVY A;  4ITW A;  4TOH A;  2JI2 A;  5ERK A;  1T9O A;  4ZMC A;  1FHM A;  5EIN C;  4UY8 1;  2CHI A;  2PVX A;  5GN8 B;  7RXN A;  3PW1 A;  4YWL A;  3ERZ A;  1SMU A;  3R2M A;  2K2D A;  4TOF A;  2ZG9 X;  1DAT A;  3E1Q A;  4CMY A;  2ZA8 A;  3E6R A;  2YW7 A;  2Z5R A;  5GAH c;  5IY0 A;  4XXB B;  6RXN A;  1VLG A;  3VV9 A;  3H7G A;  4XGS A;  2VZB A;  3OGH A;  1QCV A;  2Z3Q B;  3BVK A;  4AR5 A;  3E1O A;  1UMN A;  1LKM A;  2V8T A;  3JZA B;  4IWK A;  3R2R A;  3KYU A;  3DBY A;  4MKU A;  1BFR A;  3F34 A;  4P18 A;  4M35 A;  5J8S A;  3KYY A;  4DZ0 A;  1VJX A;  4U3G A;  4AHW A;  4G6B A;  1RCI A;  1FHA A;  4TOG A;  1B2J A;  5JDO A;  5ERJ A;  2FHA A;  4Z5S A;  2AYJ A;  2FJC A;  1Z92 B;  1DX8 A;  1BQ8 A;  3VPB E;  4AR6 A;  1SQ3 A;  2Z5Q A;  1O9R A;  4PG1 A;  4A25 A;  4E40 A;  4EVD A;  4IXK A;  4M34 A;  2C6B A;  3BVL A;  2QF9 A;  1S24 A;  1L8I A;  3R2S A;  5GU2 X;  5EIO C;  3PVY B;  3FRR A;  4GS7 D;  4MXP A;  2MS3 A;  1VEQ A;  3PVR A;  1Z4A A;  3KYV A;  3PW1 B;  1WJV A;  1ZUJ A;  1N1Q A;  4AM5 A;  3UOI A;  4ETR A;  1TJO A;  4PGI A;  5FEJ A;  5K2M E;  3N6O A;  3C23 A;  4LPN A;  2PPT A;  1RCE A;  3T9J A;  1T9P A;  3RGD A;  3J7Y 1;  1NFV A;  1BCF A;  3HIU A;  1J30 A;  5LG2 A;  3RE7 A;  5JKL G;  4TPU A;  2W0O A;  3SH6 A;  3R2K A;  3M6J A;  4W4K B;  1NXG A;  3Q4N A;  3PIP 1;  2A69 D;  2C2J A;  3UFB A;  3E6S A;  2XJU A;  3QHC A;  3MSU A;  4EVC A;  3B08 B;  3KX9 A;  1FHH A;  2MGY A;  2RDV A;  2KN9 A;  3LNL A;  1NF4 A;  2CF7 A;  2C6A A;  3K35 A;  3RZ6 A;  1KRQ A;  1JI5 A;  2V2I A;  5JDO B;  4DAS A;  1S30 A;  3E1J A;  1YUZ A;  1GWG A;  2BK6 A;  4WJG 4;  4ZKH A;  4ISP A;  5LS9 A;  1IU6 A;  2Z3R B;  4ZL6 A;  2WLA A;  3R2H A;  8RXN A;  1VEL A;  4YVZ A;  1YK5 A;  1B71 A;  2V2M A;  1LB3 A;  2ZG7 X;  4AM4 A;  1R0I A;  3PVR B;  4TOD A;  4RC8 A;  1E8J A;  4POG A;  4ZTT A;  1JI4 A;  2H12 A;  2ERS A;  3SHX A;  5FFB A;  3E1P A;  1RWD A;  1BFY A;  1H7V A;  2VXX A;  2YJJ A;  3KYX A;  3QZ3 A;  1JYB A;  5GU3 X;  1TKO A;  4LYX A;  1ZRP A;  3WWN B;  3RAV A;  3O7R A;  3EZ0 A;  5CMR A;  3B0A B;  3GGY A;  5FFC A;  4EVB A;  2V3B B;  2XJT A;  3W54 A;  2FKZ A;  2VL6 A;  4CY9 A;  2A6H D;  3AF7 X;  3AK8 A;  3P2A A;  2PSM C;  3E2C A;  3A9Q A;  5RXN A;  5HJF A;  3KA6 A;  5GU0 X;  2XJP A;  1OTK A;  4MUD A;  1Z6O A;  3FSE A;  5D8X A;  2GYQ A;  3KA3 A;  2DSX A;  3SE1 A;  4ZL5 A;  4DYU A;  2WLU A;  5E1U A;  1IU5 A;  4LPM A;  4AI3 A;  2NYD A;  2GMG A;  5LG8 A;  5DM7 1;  4U67 1;  4TOA A;  3U90 A;  1RDG A;  3C21 A;  1JTS A;  2V2L A;  1UVH A;  2QQY A;  3WWL A;  5GAD c;  1QYB A;  4B8C D;  2GS4 A;  4R42 A;  3PW8 C;  3IS8 A;  3JZ9 A;  2FZF A;  2PYB A;  5CMQ A;  1JIG A;  4ERU A;  2UX1 A;  1XZ1 A;  3AJP A;  3QD8 A;  5I4J A;  4AI0 A;  2J9U B;  1B13 A;  4CVP A;  3BVF A;  3Q4Q A;  2RBD A;  4ME3 A;  3PWQ C;  5HJH A;  1AEW A;  2B5I D;  4AM2 A;  1MOJ A;  3GE4 A;  1S2Z A;  3NOZ X;  5J8W A;  1RYT A;  1S3Q A;  3ZG6 A;  3FRS A;  3WNW A;  2OKC A;  1QGH A;  4YXM A;  1BE7 A;  4AHX A;  3KA8 A;  3ISF A;  3EZU A;  1JRE A;  1MFR A;  5IX6 A;  3F37 A;  5GAE c;  4KXR B;  1F33 A;  3GGZ A;  2M4V A;  3NP2 X;  4LPJ A;  2O5J D;  5JVG 1;  3AK9 A;  4JAE A;  4MJY A;  3SS2 A;  2CLB A;  2BE5 D;  3QVD A;  3PIO 1;  3A68 A;  3F39 A;  1B2O A;  2XJO A;  2Z5P A;  2V0E A;  1JKU A;  4CVT A;  4YWM A;  4WFN 1;  4CYA A;  5FFA A;  2OH3 A;  1ZS3 A;  1NXE A;  3IQ1 A;  2BJY A;  5D8Y A;  5FFD A;  5AI3 A;  2JD7 0;  4ZLW A;  4JAF A;  5K53 A;  1BRF A;  3FVB A;  3TA8 A;  5MFP A;  3RZT A;  5JKM A;  4RC7 A;  1TKP A;  2HR5 A;  2V2S A;  4ZKX A;  1SMW A;  1NNQ A;  3FI6 A;  1R0J A;  4LHN A;  1LKO A;  5D8Q A;  5GU1 X;  5GAG c;  4QUW A;  4PG0 A;  1RYQ A;  1JKV A;  4W4L B;  5MFZ A;  1C09 A;  1TK6 A;  4AR3 A;  2Y3Q A;  1NF6 A;  2V15 A;  2V0F A;  5J93 A;  2XKQ A;  3C1Y A;  3KWO A;  2QL0 A;  4V19 6;  4X0J A;  4TO9 A;  3PZA A;  4LQV A;  4RXN A;  3F33 A;  3GHQ A;  4MY7 A;  2CHP A;  3RBC A;  3MPS A;  1IW7 D;  2CKA A;  2VXI A;  3P8B A;  5J9V A;  2XGW A;  3E1L A;  4DYX A;  1RB9 A;  2V8U A;  1RDV A;  5FFE A;  1VZH A;  3BT5 A;  4ZJK A;  3E1M A;  2G38 B;  3O7S A;  5D8O A;  2KKD A;  4XKT A;  2C2F A;  4II4 B;  5CZU A;  1R03 A;  4RC6 B;  2ITB A;  1VZG A;  4RC5 B;  4Z3B A;  4LQN A;  2M6O A;  1ODH A;  4RC7 B;  1HRS A;  1SMM A;  4ZKW A;  5HU6 D;  3F32 A;  5K52 A;  4KVQ A;  4LQH A;  4AR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...