4CYBA

Dpsc from streptomyces coelicolor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
172
structure length
172
Chain Sequence
RTIQEFGTVKQFPVALTMDTRLYSCQRLNKVLADTRILHDLYKKYHWLMRGATFYQLHLLLDKHAGEQLELIDTVAERVQTLGGVAVGDPRHVAEITTVPRPPDGVEEVPSMLSRLLEAHELILTECHDAAARTQEYGDDGTNDLLVSEVLRTNELQAWFVAEHLVDTPLVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE DNA PROTECTION PROTEIN
publication title A Tale of Tails: Deciphering the Contribution of Terminal Tails to the Biochemical Properties of Two Dps Proteins from Streptomyces Coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Iron binding protein
total genus 75
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4cybA00
3R2HA 3ISEA 1BCFA 5J9VA 4M32A 2BK6A 4M35A 1L8IA 1Z4AA 3SE1A 2OH3A 5D8PA 2BKCA 5HJFA 3TA8A 5GU2X 2X170 4ZKXA 2JD60 3R2MA 4LYUA 4M33A 3QVDA 2WTLA 2FG4A 4ETRA 3T9JA 2V2PA 3NP0X 1RCGA 3PW8A 3KXUA 1TKPA 4DI0A 4LQJA 2HR5A 2IB0A 1JIGA 1ZUJA 1LKPA 2CF7A 1LB3A 4XGSA 1F33A 5C6FA 4IWJA 4II4A 1XZ3A 3SHXA 5CMRA 5LBHA 1BG7A 2GYDA 2YW6A 1QGHA 4CVTA 3QHBA 3AK9A 2CHPA 2Z6MA 1JKUA 4DYZA 3GE4A 1S2ZA 4U3GA 2V15A 2YW7A 5HQOA 4DE6A 1OTKA 2F7NA 4EVBA 3PVTA 1L8HA 4R42A 2XKQA 3PVRB 1J30A 1YUZA 3PWFA 4RC7A 4OYNA 2C41A 4YKHA 2V2JA 2OC5A 4MJYA 2FZFA 3R2RA 2ZA6A 2Z5QA 3HL1A 2JD80 2VXIA 1H96A 5CZUA 2QQYA 1JI5A 1JKVA 3EGMA 3O7SA 4IXKA 5FFDA 4P18A 2C2FA 1Z6OM 4ISMA 4TW3A 4ITWA 5LG8A 4CVRA 5FFEA 1JI4A 1S3QA 4Z5SA 3BVEA 1UVHA 2FG8A 4ZKWA 4DYXA 5J8WA 2CN7A 1QYBA 1VELA 1IERA 3WVVA 4IWKA 2PYBA 1YUXA 1ZS3A 2Y3QA 4TOFA 2WLAA 5FFAA 3OJ5A 3IQ1A 4LQNA 3RGDA 3F32A 3E1PA 5JKMA 1TK6A 3KA3A 5JKLA 2CLBA 5GU0X 3Q4QA 4EVCA 1TKOA 3KA9A 3E1JA 3Q4NA 4PG0A 4ZL6A 3BVKA 5LG2A 3RBCA 2FFXJ 1R03A 5ERJA 2V2RA 2IY4A 3KA6A 4KVSA 4REUA 4M34A 4CVSA 4II4B 4XKUA 4CMYV 3EZ0A 5ERKA 4MN9A 4LYXA 4ZKHA 3E1MA 4RC6B 1UMNA 3Q4RA 3E1QA 5GN8B 1TJOA 2V2NA 2FJCA 5D8YA 3F39A 4EVDA 3PVYB 1MFRA 4DYYA 4MUDA 4ZLWA 1O9IA 1RCCA 4PGKA 5D8QA 3R2LA 4QUWA 5JACA 1RCIA 2C2JA 3KA8A 5I4JA 4RC5B 3PVTB 3KWOA 2V2MA 4EVEA 1N1QA 1JTSA 5J8SA 4RC7B 4ZL5A 3ES3A 2RBDA 2IU2A 1VLGA 1YV1A 3AF7X 1BFRA 3R2KA 4ZTTA 5D8RA 3AJQA 3E1NA 4TOAA 5JKMG 1EUMA 2XJNA 3SH6A 1DATA 2Z5RA 1NF4A 4XKSA 3RE7A 3UNOA 2CIHA 4LPJA 3A9QA 3FVBA 5JKLG 4KVRA 2UX1A 2CEIA 3SIDA 5E1UA 2GYQA 3BVIA 4TOBA 4Y08A 4PGIA 3PZAA 2FKZA 1RCDA 1RCEA 2Z5PA 5D8OA 1JGCA 5GU3X 2CHIA 2V2LA 1SOFA 1LKOA 3F33A 2V2SA 3PWQC 1DVBA 4ITTA 3IS7A 3RD0A 2GS4A 2G4HA 3E1LA 2FHAA 4ML5A 4XKTA 3QD8A 3BKNA 1GWGA 3FSEA 4MKUA 4LPNA 4AM5A 4AM2A 1VEQA 5GOUA 3U90A 2ZG8X 1SQ3A 4KVQA 3NOZX 3BVLA 3Q4OA 1JYBA 4DYUA 4Z3BA 5J93A 2V2IA 5D8SA 4TODA 3E1OA 3PW1A 1NFVA 3VNXA 1IESA 2VZBA 3KA4A 4LPMA 5FFCA 2ZG7X 2ITBA 3AK8A 3WVUA 5LS9A 3AJOA 3H7GA 3AF9X 1DPSA 3RAVA 3HIUA 1XZ1A 3GVYA 1FHAA 2BJYA 1KRQA 5K52A 4CY9A 2WLUA 2XJMA 3FI6A 3F36A 2CLUA 4TO9A 2QF9A 5CMQA 4LQVA 1RYTA 2ZG9X 4TOGA 2CN6A 1VJXA 3QHCA 4A25A 1LKMA 2VXXA 3F35A 3MPSA 1AEWA 3F38A 3PWQA 3E6RA 4DASA 1NNQA 3R2SA 4ZMCA 2C6RA 4ERUA 1O9RA 4AM4A 4ISPA 3E2CA 2YJJA 4RC6A 4MY7A 5GN8A 4E6KA 3R2OA 2BW1A 4ZJKA 3IS8A 3F37A 4TOEA 5IX6A 3PVYA 1HRSA 3A68A 4CVPA 4DZ0A 5K53A 5FFBA 4PG1A 5D8XA 3ERZA 2ZA7A 3E6SA 1Z6OA 3WNWA 3BT5A 3WVWA 4TOCA 4RC5A 3QB9A 3OGHA 4TOHA 4LQHA 4RC8A 2XJOA 2YJKA 3UOIA 3QZ3A 3PW8C 2ZA8A 4CYBA 3EZUA 4CMYA 1VEIA 2D5KA 3ISFA 3PVRA 3O7RA 3UOFA 5FEJA 3GHQA 2HTNA 2V2OA 5AXSA 3KX9A 2FL0A 1NF6A 2Z90A 1F30A 5GU1X 3AJPA 2JD70 3AF8X 1S30A 3F34A 1MOJA 5HJHA 3NP2X 2XGWA 1JREA 3BVFA 3PW1B 5E2DA 2W0OA 1B71A 2C2UA 2ZURX 4CYAA
chains in the Genus database with same CATH superfamily
3R2HA 3ISEA 1BCFA 3N6OA 5J9VA 4M32A 2BK6A 4M35A 1L8IA 1Z4AA 3SE1A 3W54A 2OH3A 5D8PA 2BKCA 5HJFA 3TA8A 5GU2X 2X170 4ZKXA 2JD60 3UFBA 4E40A 3R2MA 4LYUA 4M33A 3QVDA 2WTLA 2FG4A 3GGYA 4ETRA 4YXJA 3T9JA 2V2PA 3NP0X 1RCGA 3PW8A 3KXUA 1TKPA 4DI0A 4LQJA 2HR5A 2IB0A 1JIGA 1ZUJA 1LKPA 2CF7A 1LB3A 4XGSA 2N02A 1F33A 5C6FA 4IWJA 5HU6D 4II4A 1XZ3A 3SHXA 5CMRA 5LBHA 1BG7A 2GYDA 2YW6A 1QGHA 4CVTA 3QHBA 3AK9A 2CHPA 2Z6MA 4W4LB 2CWLA 1JKUA 4DYZA 3GE4A 1S2ZA 4U3GA 2V15A 2YW7A 5HQOA 4DE6A 1OTKA 2F7NA 3KDQA 4EVBA 3PVTA 1L8HA 4YVZA 4R42A 2XKQA 3PVRB 1J30A 1YUZA 3PWFA 4RC7A 3C1ZA 4OYNA 2C41A 4YKHA 2V2JA 2OC5A 5JDOA 4MJYA 2FZFA 3FRRA 3R2RA 2ZA6A 2Z5QA 3HL1A 2JD80 2VXIA 1H96A 5CZUA 2QQYA 1JI5A 1JKVA 3EGMA 3O7SA 4IXKA 5FFDA 4P18A 2C2FA 1Z6OM 4ISMA 4TW3A 4ITWA 5LG8A 4CVRA 5FFEA 1JI4A 1S3QA 4Z5SA 3BVEA 1UVHA 2FG8A 4ZKWA 4DYXA 5J8WA 2CN7A 1QYBA 1VELA 1IERA 4X0JA 3WVVA 4IWKA 2PYBA 1YUXA 1ZS3A 2Y3QA 4TOFA 2WLAA 5FFAA 3OJ5A 4KXRB 3IQ1A 4LQNA 4MXPA 3RGDA 3F32A 3E1PA 5JKMA 1TK6A 3KA3A 3V3KB 5JKLA 2CLBA 5GU0X 3Q4QA 4EVCA 1TKOA 3KA9A 3E1JA 3Q4NA 4PG0A 4ZL6A 2Y44A 3BVKA 5LG2A 3RBCA 2FFXJ 1R03A 5ERJA 2V2RA 2IY4A 3KA6A 4KVSA 4REUA 4M34A 4CVSA 4II4B 4XKUA 4CMYV 3EZ0A 5ERKA 4MN9A 4LYXA 4ZKHA 3E1MA 4RC6B 1UMNA 3Q4RA 3E1QA 5GN8B 1TJOA 2V2NA 2FJCA 5D8YA 3F39A 4EVDA 3PVYB 1MFRA 4DYYA 4MUDA 4ZLWA 1O9IA 1RCCA 4PGKA 5D8QA 3R2LA 4QUWA 5JACA 1RCIA 2C2JA 3KA8A 5I4JA 4RC5B 3PVTB 3KWOA 4W4KB 2V2MA 4EVEA 1N1QA 1JTSA 5J8SA 4RC7B 4ZL5A 3ES3A 2RBDA 2IU2A 1VLGA 1YV1A 3KHKA 3AF7X 1BFRA 5JDOB 3R2KA 4ZTTA 5D8RA 3AJQA 3E1NA 4TOAA 5JKMG 1EUMA 2XJNA 3SH6A 1DATA 2Z5RA 1NF4A 4XKSA 3RE7A 3UNOA 2CIHA 4LPJA 3A9QA 3FVBA 5JKLG 4KVRA 2UX1A 2CEIA 3FRSA 3SIDA 5E1UA 3DBYA 2GYQA 3BVIA 4TOBA 4Y08A 4PGIA 3PZAA 2FKZA 1RCDA 1RCEA 2Z5PA 5D8OA 1JGCA 5GU3X 2AR0A 2CHIA 3LKDA 2V2LA 1SOFA 1LKOA 3F33A 2V2SA 4YXMA 3PWQC 4WJG4 1DVBA 4ITTA 3IS7A 3RD0A 2GS4A 2G4HA 3E1LA 2FHAA 4ML5A 4XKTA 3QD8A 3BKNA 2V8UA 1GWGA 3FSEA 4MKUA 4LPNA 4AM5A 4AM2A 2MGYA 1VEQA 5GOUA 3U90A 2ZG8X 1SQ3A 4KVQA 3NOZX 3BVLA 3Q4OA 1JYBA 4DYUA 4Z3BA 5J93A 2V2IA 5D8SA 4TODA 3C1YA 3E1OA 3PW1A 1NFVA 3VV9A 3VNXA 1IESA 2VZBA 3KA4A 4LPMA 5FFCA 2ZG7X 2ITBA 3AK8A 3WVUA 2V8TA 5LS9A 3AJOA 3H7GA 3AF9X 1DPSA 3RAVA 3HIUA 1XZ1A 3GVYA 1FHAA 2BJYA 1KRQA 5K52A 4CY9A 2WLUA 2XJMA 3FI6A 3F36A 2CLUA 4TO9A 2QF9A 5CMQA 4LQVA 1RYTA 2ZG9X 4TOGA 2CN6A 1VJXA 3QHCA 4A25A 1LKMA 2VXXA 3F35A 3MPSA 1AEWA 3F38A 3PWQA 3E6RA 3C21A 3D19A 3JZAB 4DASA 1NNQA 3R2SA 4ZMCA 2C6RA 4ERUA 1O9RA 4AM4A 4ISPA 3C23A 3E2CA 2YJJA 4RC6A 4MY7A 5GN8A 4E6KA 2G38B 3R2OA 2BW1A 4ZJKA 3IS8A 3F37A 4TOEA 5IX6A 3PVYA 1HRSA 3A68A 4CVPA 4DZ0A 5K53A 5FFBA 4PG1A 5D8XA 3ERZA 2ZA7A 3E6SA 1Z6OA 3WNWA 3BT5A 3WVWA 4TOCA 4RC5A 3QB9A 3OGHA 3GGZA 4TOHA 4LQHA 4RC8A 2XJOA 2YJKA 3JZ9A 3UOIA 3QZ3A 3PW8C 2ZA8A 3L0MA 4CYBA 3EZUA 4CMYA 1VEIA 2D5KA 3ISFA 3PVRA 3M6JA 3O7RA 3UOFA 2WWXB 5FEJA 3GHQA 2HTNA 2V2OA 5AXSA 3KX9A 2FL0A 3VVAA 1NF6A 2Z90A 1F30A 5GU1X 3AJPA 2JD70 3AF8X 1S30A 3F34A 1MOJA 5HJHA 3NP2X 2XGWA 1JREA 3BVFA 3PW1B 2OKCA 5E2DA 2W0OA 1B71A 2C2UA 2ZURX 4CYAA
chains in the Genus database with same CATH topology
3R2HA 3ISEA 1BCFA 3N6OA 5J9VA 4M32A 2BK6A 4M35A 1L8IA 1Z4AA 3SE1A 3W54A 2OH3A 5D8PA 2BKCA 5HJFA 3TA8A 5GU2X 2X170 4ZKXA 2JD60 3UFBA 4E40A 3R2MA 4LYUA 4M33A 3QVDA 2WTLA 2FG4A 3GGYA 4ETRA 4YXJA 3T9JA 2V2PA 3NP0X 1RCGA 3PW8A 3KXUA 1TKPA 4DI0A 4LQJA 2HR5A 2IB0A 1JIGA 1ZUJA 1LKPA 2CF7A 1LB3A 4XGSA 2N02A 1F33A 5C6FA 4IWJA 5HU6D 4II4A 1XZ3A 3SHXA 5CMRA 5LBHA 1BG7A 2GYDA 2YW6A 1QGHA 4CVTA 3QHBA 3AK9A 2CHPA 2Z6MA 4W4LB 2CWLA 1JKUA 4DYZA 3GE4A 1S2ZA 4U3GA 2V15A 2YW7A 5HQOA 4DE6A 1OTKA 2F7NA 3KDQA 4EVBA 3PVTA 1L8HA 4YVZA 4R42A 2XKQA 3PVRB 1J30A 1YUZA 3PWFA 4RC7A 3C1ZA 4OYNA 2C41A 4YKHA 2V2JA 2OC5A 5JDOA 4MJYA 2FZFA 3FRRA 3R2RA 2ZA6A 2Z5QA 3HL1A 2JD80 2VXIA 1H96A 5CZUA 2QQYA 1JI5A 1JKVA 3EGMA 3O7SA 4IXKA 5FFDA 4P18A 2C2FA 1Z6OM 4ISMA 4TW3A 4ITWA 5LG8A 4CVRA 5FFEA 1JI4A 1S3QA 4Z5SA 3BVEA 1UVHA 2FG8A 4ZKWA 4DYXA 5J8WA 2CN7A 1QYBA 1VELA 1IERA 4X0JA 3WVVA 4IWKA 2PYBA 1YUXA 1ZS3A 2Y3QA 4TOFA 2WLAA 5FFAA 3OJ5A 4KXRB 3IQ1A 4LQNA 4MXPA 3RGDA 3F32A 3E1PA 5JKMA 1TK6A 3KA3A 3V3KB 5JKLA 2CLBA 5GU0X 3Q4QA 4EVCA 1TKOA 3KA9A 3E1JA 3Q4NA 4PG0A 4ZL6A 2Y44A 3BVKA 5LG2A 3RBCA 2FFXJ 1R03A 5ERJA 2V2RA 2IY4A 3KA6A 4KVSA 4REUA 4M34A 4CVSA 4II4B 4XKUA 4CMYV 3EZ0A 5ERKA 4MN9A 4LYXA 4ZKHA 3E1MA 4RC6B 1UMNA 3Q4RA 3E1QA 5GN8B 1TJOA 2V2NA 2FJCA 5D8YA 3F39A 4EVDA 3PVYB 1MFRA 4DYYA 4MUDA 4ZLWA 1O9IA 1RCCA 4PGKA 5D8QA 3R2LA 4QUWA 5JACA 1RCIA 2C2JA 3KA8A 5I4JA 4RC5B 3PVTB 3KWOA 4W4KB 2V2MA 4EVEA 1N1QA 1JTSA 5J8SA 4RC7B 4ZL5A 3ES3A 2RBDA 2IU2A 1VLGA 1YV1A 3KHKA 3AF7X 1BFRA 5JDOB 3R2KA 4ZTTA 5D8RA 3AJQA 3E1NA 4TOAA 5JKMG 1EUMA 2XJNA 3SH6A 1DATA 2Z5RA 1NF4A 4XKSA 3RE7A 3UNOA 2CIHA 4LPJA 3A9QA 3FVBA 5JKLG 4KVRA 2UX1A 2CEIA 3FRSA 3SIDA 5E1UA 3DBYA 2GYQA 3BVIA 4TOBA 4Y08A 4PGIA 3PZAA 2FKZA 1RCDA 1RCEA 2Z5PA 5D8OA 1JGCA 5GU3X 2AR0A 2CHIA 3LKDA 2V2LA 1SOFA 1LKOA 3F33A 2V2SA 4YXMA 3PWQC 4WJG4 1DVBA 4ITTA 3IS7A 3RD0A 2GS4A 2G4HA 3E1LA 2FHAA 4ML5A 4XKTA 3QD8A 3BKNA 2V8UA 1GWGA 3FSEA 4MKUA 4LPNA 4AM5A 4AM2A 2MGYA 1VEQA 5GOUA 3U90A 2ZG8X 1SQ3A 4KVQA 3NOZX 3BVLA 3Q4OA 1JYBA 4DYUA 4Z3BA 5J93A 2V2IA 5D8SA 4TODA 3C1YA 3E1OA 3PW1A 1NFVA 3VV9A 3VNXA 1IESA 2VZBA 3KA4A 4LPMA 5FFCA 2ZG7X 2ITBA 3AK8A 3WVUA 2V8TA 5LS9A 3AJOA 3H7GA 3AF9X 1DPSA 3RAVA 3HIUA 1XZ1A 3GVYA 1FHAA 2BJYA 1KRQA 5K52A 4CY9A 2WLUA 2XJMA 3FI6A 3F36A 2CLUA 4TO9A 2QF9A 5CMQA 4LQVA 1RYTA 2ZG9X 4TOGA 2CN6A 1VJXA 3QHCA 4A25A 1LKMA 2VXXA 3F35A 3MPSA 1AEWA 3F38A 3PWQA 3E6RA 3C21A 3D19A 3JZAB 4DASA 1NNQA 3R2SA 4ZMCA 2C6RA 4ERUA 1O9RA 4AM4A 4ISPA 3C23A 3E2CA 2YJJA 4RC6A 4MY7A 5GN8A 4E6KA 2G38B 3R2OA 2BW1A 4ZJKA 3IS8A 3F37A 4TOEA 5IX6A 3PVYA 1HRSA 3A68A 4CVPA 4DZ0A 5K53A 5FFBA 4PG1A 5D8XA 3ERZA 2ZA7A 3E6SA 1Z6OA 3WNWA 3BT5A 3WVWA 4TOCA 4RC5A 3QB9A 3OGHA 3GGZA 4TOHA 4LQHA 4RC8A 2XJOA 2YJKA 3JZ9A 3UOIA 3QZ3A 3PW8C 2ZA8A 3L0MA 4CYBA 3EZUA 4CMYA 1VEIA 2D5KA 3ISFA 3PVRA 3M6JA 3O7RA 3UOFA 2WWXB 5FEJA 3GHQA 2HTNA 2V2OA 5AXSA 3KX9A 2FL0A 3VVAA 1NF6A 2Z90A 1F30A 5GU1X 3AJPA 2JD70 3AF8X 1S30A 3F34A 1MOJA 5HJHA 3NP2X 2XGWA 1JREA 3BVFA 3PW1B 2OKCA 5E2DA 2W0OA 1B71A 2C2UA 2ZURX 4CYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2H A;  3ISE A;  1BCF A;  5J9V A;  4M32 A;  2BK6 A;  4M35 A;  1L8I A;  1Z4A A;  3SE1 A;  2OH3 A;  5D8P A;  2BKC A;  5HJF A;  3TA8 A;  5GU2 X;  2X17 0;  4ZKX A;  2JD6 0;  3R2M A;  4LYU A;  4M33 A;  3QVD A;  2WTL A;  2FG4 A;  4ETR A;  3T9J A;  2V2P A;  3NP0 X;  1RCG A;  3PW8 A;  3KXU A;  1TKP A;  4DI0 A;  4LQJ A;  2HR5 A;  2IB0 A;  1JIG A;  1ZUJ A;  1LKP A;  2CF7 A;  1LB3 A;  4XGS A;  1F33 A;  5C6F A;  4IWJ A;  4II4 A;  1XZ3 A;  3SHX A;  5CMR A;  5LBH A;  1BG7 A;  2GYD A;  2YW6 A;  1QGH A;  4CVT A;  3QHB A;  3AK9 A;  2CHP A;  2Z6M A;  1JKU A;  4DYZ A;  3GE4 A;  1S2Z A;  4U3G A;  2V15 A;  2YW7 A;  5HQO A;  4DE6 A;  1OTK A;  2F7N A;  4EVB A;  3PVT A;  1L8H A;  4R42 A;  2XKQ A;  3PVR B;  1J30 A;  1YUZ A;  3PWF A;  4RC7 A;  4OYN A;  2C41 A;  4YKH A;  2V2J A;  2OC5 A;  4MJY A;  2FZF A;  3R2R A;  2ZA6 A;  2Z5Q A;  3HL1 A;  2JD8 0;  2VXI A;  1H96 A;  5CZU A;  2QQY A;  1JI5 A;  1JKV A;  3EGM A;  3O7S A;  4IXK A;  5FFD A;  4P18 A;  2C2F A;  1Z6O M;  4ISM A;  4TW3 A;  4ITW A;  5LG8 A;  4CVR A;  5FFE A;  1JI4 A;  1S3Q A;  4Z5S A;  3BVE A;  1UVH A;  2FG8 A;  4ZKW A;  4DYX A;  5J8W A;  2CN7 A;  1QYB A;  1VEL A;  1IER A;  3WVV A;  4IWK A;  2PYB A;  1YUX A;  1ZS3 A;  2Y3Q A;  4TOF A;  2WLA A;  5FFA A;  3OJ5 A;  3IQ1 A;  4LQN A;  3RGD A;  3F32 A;  3E1P A;  5JKM A;  1TK6 A;  3KA3 A;  5JKL A;  2CLB A;  5GU0 X;  3Q4Q A;  4EVC A;  1TKO A;  3KA9 A;  3E1J A;  3Q4N A;  4PG0 A;  4ZL6 A;  3BVK A;  5LG2 A;  3RBC A;  2FFX J;  1R03 A;  5ERJ A;  2V2R A;  2IY4 A;  3KA6 A;  4KVS A;  4REU A;  4M34 A;  4CVS A;  4II4 B;  4XKU A;  4CMY V;  3EZ0 A;  5ERK A;  4MN9 A;  4LYX A;  4ZKH A;  3E1M A;  4RC6 B;  1UMN A;  3Q4R A;  3E1Q A;  5GN8 B;  1TJO A;  2V2N A;  2FJC A;  5D8Y A;  3F39 A;  4EVD A;  3PVY B;  1MFR A;  4DYY A;  4MUD A;  4ZLW A;  1O9I A;  1RCC A;  4PGK A;  5D8Q A;  3R2L A;  4QUW A;  5JAC A;  1RCI A;  2C2J A;  3KA8 A;  5I4J A;  4RC5 B;  3PVT B;  3KWO A;  2V2M A;  4EVE A;  1N1Q A;  1JTS A;  5J8S A;  4RC7 B;  4ZL5 A;  3ES3 A;  2RBD A;  2IU2 A;  1VLG A;  1YV1 A;  3AF7 X;  1BFR A;  3R2K A;  4ZTT A;  5D8R A;  3AJQ A;  3E1N A;  4TOA A;  5JKM G;  1EUM A;  2XJN A;  3SH6 A;  1DAT A;  2Z5R A;  1NF4 A;  4XKS A;  3RE7 A;  3UNO A;  2CIH A;  4LPJ A;  3A9Q A;  3FVB A;  5JKL G;  4KVR A;  2UX1 A;  2CEI A;  3SID A;  5E1U A;  2GYQ A;  3BVI A;  4TOB A;  4Y08 A;  4PGI A;  3PZA A;  2FKZ A;  1RCD A;  1RCE A;  2Z5P A;  5D8O A;  1JGC A;  5GU3 X;  2CHI A;  2V2L A;  1SOF A;  1LKO A;  3F33 A;  2V2S A;  3PWQ C;  1DVB A;  4ITT A;  3IS7 A;  3RD0 A;  2GS4 A;  2G4H A;  3E1L A;  2FHA A;  4ML5 A;  4XKT A;  3QD8 A;  3BKN A;  1GWG A;  3FSE A;  4MKU A;  4LPN A;  4AM5 A;  4AM2 A;  1VEQ A;  5GOU A;  3U90 A;  2ZG8 X;  1SQ3 A;  4KVQ A;  3NOZ X;  3BVL A;  3Q4O A;  1JYB A;  4DYU A;  4Z3B A;  5J93 A;  2V2I A;  5D8S A;  4TOD A;  3E1O A;  3PW1 A;  1NFV A;  3VNX A;  1IES A;  2VZB A;  3KA4 A;  4LPM A;  5FFC A;  2ZG7 X;  2ITB A;  3AK8 A;  3WVU A;  5LS9 A;  3AJO A;  3H7G A;  3AF9 X;  1DPS A;  3RAV A;  3HIU A;  1XZ1 A;  3GVY A;  1FHA A;  2BJY A;  1KRQ A;  5K52 A;  4CY9 A;  2WLU A;  2XJM A;  3FI6 A;  3F36 A;  2CLU A;  4TO9 A;  2QF9 A;  5CMQ A;  4LQV A;  1RYT A;  2ZG9 X;  4TOG A;  2CN6 A;  1VJX A;  3QHC A;  4A25 A;  1LKM A;  2VXX A;  3F35 A;  3MPS A;  1AEW A;  3F38 A;  3PWQ A;  3E6R A;  4DAS A;  1NNQ A;  3R2S A;  4ZMC A;  2C6R A;  4ERU A;  1O9R A;  4AM4 A;  4ISP A;  3E2C A;  2YJJ A;  4RC6 A;  4MY7 A;  5GN8 A;  4E6K A;  3R2O A;  2BW1 A;  4ZJK A;  3IS8 A;  3F37 A;  4TOE A;  5IX6 A;  3PVY A;  1HRS A;  3A68 A;  4CVP A;  4DZ0 A;  5K53 A;  5FFB A;  4PG1 A;  5D8X A;  3ERZ A;  2ZA7 A;  3E6S A;  1Z6O A;  3WNW A;  3BT5 A;  3WVW A;  4TOC A;  4RC5 A;  3QB9 A;  3OGH A;  4TOH A;  4LQH A;  4RC8 A;  2XJO A;  2YJK A;  3UOI A;  3QZ3 A;  3PW8 C;  2ZA8 A;  4CYB A;  3EZU A;  4CMY A;  1VEI A;  2D5K A;  3ISF A;  3PVR A;  3O7R A;  3UOF A;  5FEJ A;  3GHQ A;  2HTN A;  2V2O A;  5AXS A;  3KX9 A;  2FL0 A;  1NF6 A;  2Z90 A;  1F30 A;  5GU1 X;  3AJP A;  2JD7 0;  3AF8 X;  1S30 A;  3F34 A;  1MOJ A;  5HJH A;  3NP2 X;  2XGW A;  1JRE A;  3BVF A;  3PW1 B;  5E2D A;  2W0O A;  1B71 A;  2C2U A;  2ZUR X;  4CYA A; 
#chains in the Genus database with same CATH topology
 3R2H A;  3ISE A;  1BCF A;  3N6O A;  5J9V A;  4M32 A;  2BK6 A;  4M35 A;  1L8I A;  1Z4A A;  3SE1 A;  3W54 A;  2OH3 A;  5D8P A;  2BKC A;  5HJF A;  3TA8 A;  5GU2 X;  2X17 0;  4ZKX A;  2JD6 0;  3UFB A;  4E40 A;  3R2M A;  4LYU A;  4M33 A;  3QVD A;  2WTL A;  2FG4 A;  3GGY A;  4ETR A;  4YXJ A;  3T9J A;  2V2P A;  3NP0 X;  1RCG A;  3PW8 A;  3KXU A;  1TKP A;  4DI0 A;  4LQJ A;  2HR5 A;  2IB0 A;  1JIG A;  1ZUJ A;  1LKP A;  2CF7 A;  1LB3 A;  4XGS A;  2N02 A;  1F33 A;  5C6F A;  4IWJ A;  5HU6 D;  4II4 A;  1XZ3 A;  3SHX A;  5CMR A;  5LBH A;  1BG7 A;  2GYD A;  2YW6 A;  1QGH A;  4CVT A;  3QHB A;  3AK9 A;  2CHP A;  2Z6M A;  4W4L B;  2CWL A;  1JKU A;  4DYZ A;  3GE4 A;  1S2Z A;  4U3G A;  2V15 A;  2YW7 A;  5HQO A;  4DE6 A;  1OTK A;  2F7N A;  3KDQ A;  4EVB A;  3PVT A;  1L8H A;  4YVZ A;  4R42 A;  2XKQ A;  3PVR B;  1J30 A;  1YUZ A;  3PWF A;  4RC7 A;  3C1Z A;  4OYN A;  2C41 A;  4YKH A;  2V2J A;  2OC5 A;  5JDO A;  4MJY A;  2FZF A;  3FRR A;  3R2R A;  2ZA6 A;  2Z5Q A;  3HL1 A;  2JD8 0;  2VXI A;  1H96 A;  5CZU A;  2QQY A;  1JI5 A;  1JKV A;  3EGM A;  3O7S A;  4IXK A;  5FFD A;  4P18 A;  2C2F A;  1Z6O M;  4ISM A;  4TW3 A;  4ITW A;  5LG8 A;  4CVR A;  5FFE A;  1JI4 A;  1S3Q A;  4Z5S A;  3BVE A;  1UVH A;  2FG8 A;  4ZKW A;  4DYX A;  5J8W A;  2CN7 A;  1QYB A;  1VEL A;  1IER A;  4X0J A;  3WVV A;  4IWK A;  2PYB A;  1YUX A;  1ZS3 A;  2Y3Q A;  4TOF A;  2WLA A;  5FFA A;  3OJ5 A;  4KXR B;  3IQ1 A;  4LQN A;  4MXP A;  3RGD A;  3F32 A;  3E1P A;  5JKM A;  1TK6 A;  3KA3 A;  3V3K B;  5JKL A;  2CLB A;  5GU0 X;  3Q4Q A;  4EVC A;  1TKO A;  3KA9 A;  3E1J A;  3Q4N A;  4PG0 A;  4ZL6 A;  2Y44 A;  3BVK A;  5LG2 A;  3RBC A;  2FFX J;  1R03 A;  5ERJ A;  2V2R A;  2IY4 A;  3KA6 A;  4KVS A;  4REU A;  4M34 A;  4CVS A;  4II4 B;  4XKU A;  4CMY V;  3EZ0 A;  5ERK A;  4MN9 A;  4LYX A;  4ZKH A;  3E1M A;  4RC6 B;  1UMN A;  3Q4R A;  3E1Q A;  5GN8 B;  1TJO A;  2V2N A;  2FJC A;  5D8Y A;  3F39 A;  4EVD A;  3PVY B;  1MFR A;  4DYY A;  4MUD A;  4ZLW A;  1O9I A;  1RCC A;  4PGK A;  5D8Q A;  3R2L A;  4QUW A;  5JAC A;  1RCI A;  2C2J A;  3KA8 A;  5I4J A;  4RC5 B;  3PVT B;  3KWO A;  4W4K B;  2V2M A;  4EVE A;  1N1Q A;  1JTS A;  5J8S A;  4RC7 B;  4ZL5 A;  3ES3 A;  2RBD A;  2IU2 A;  1VLG A;  1YV1 A;  3KHK A;  3AF7 X;  1BFR A;  5JDO B;  3R2K A;  4ZTT A;  5D8R A;  3AJQ A;  3E1N A;  4TOA A;  5JKM G;  1EUM A;  2XJN A;  3SH6 A;  1DAT A;  2Z5R A;  1NF4 A;  4XKS A;  3RE7 A;  3UNO A;  2CIH A;  4LPJ A;  3A9Q A;  3FVB A;  5JKL G;  4KVR A;  2UX1 A;  2CEI A;  3FRS A;  3SID A;  5E1U A;  3DBY A;  2GYQ A;  3BVI A;  4TOB A;  4Y08 A;  4PGI A;  3PZA A;  2FKZ A;  1RCD A;  1RCE A;  2Z5P A;  5D8O A;  1JGC A;  5GU3 X;  2AR0 A;  2CHI A;  3LKD A;  2V2L A;  1SOF A;  1LKO A;  3F33 A;  2V2S A;  4YXM A;  3PWQ C;  4WJG 4;  1DVB A;  4ITT A;  3IS7 A;  3RD0 A;  2GS4 A;  2G4H A;  3E1L A;  2FHA A;  4ML5 A;  4XKT A;  3QD8 A;  3BKN A;  2V8U A;  1GWG A;  3FSE A;  4MKU A;  4LPN A;  4AM5 A;  4AM2 A;  2MGY A;  1VEQ A;  5GOU A;  3U90 A;  2ZG8 X;  1SQ3 A;  4KVQ A;  3NOZ X;  3BVL A;  3Q4O A;  1JYB A;  4DYU A;  4Z3B A;  5J93 A;  2V2I A;  5D8S A;  4TOD A;  3C1Y A;  3E1O A;  3PW1 A;  1NFV A;  3VV9 A;  3VNX A;  1IES A;  2VZB A;  3KA4 A;  4LPM A;  5FFC A;  2ZG7 X;  2ITB A;  3AK8 A;  3WVU A;  2V8T A;  5LS9 A;  3AJO A;  3H7G A;  3AF9 X;  1DPS A;  3RAV A;  3HIU A;  1XZ1 A;  3GVY A;  1FHA A;  2BJY A;  1KRQ A;  5K52 A;  4CY9 A;  2WLU A;  2XJM A;  3FI6 A;  3F36 A;  2CLU A;  4TO9 A;  2QF9 A;  5CMQ A;  4LQV A;  1RYT A;  2ZG9 X;  4TOG A;  2CN6 A;  1VJX A;  3QHC A;  4A25 A;  1LKM A;  2VXX A;  3F35 A;  3MPS A;  1AEW A;  3F38 A;  3PWQ A;  3E6R A;  3C21 A;  3D19 A;  3JZA B;  4DAS A;  1NNQ A;  3R2S A;  4ZMC A;  2C6R A;  4ERU A;  1O9R A;  4AM4 A;  4ISP A;  3C23 A;  3E2C A;  2YJJ A;  4RC6 A;  4MY7 A;  5GN8 A;  4E6K A;  2G38 B;  3R2O A;  2BW1 A;  4ZJK A;  3IS8 A;  3F37 A;  4TOE A;  5IX6 A;  3PVY A;  1HRS A;  3A68 A;  4CVP A;  4DZ0 A;  5K53 A;  5FFB A;  4PG1 A;  5D8X A;  3ERZ A;  2ZA7 A;  3E6S A;  1Z6O A;  3WNW A;  3BT5 A;  3WVW A;  4TOC A;  4RC5 A;  3QB9 A;  3OGH A;  3GGZ A;  4TOH A;  4LQH A;  4RC8 A;  2XJO A;  2YJK A;  3JZ9 A;  3UOI A;  3QZ3 A;  3PW8 C;  2ZA8 A;  3L0M A;  4CYB A;  3EZU A;  4CMY A;  1VEI A;  2D5K A;  3ISF A;  3PVR A;  3M6J A;  3O7R A;  3UOF A;  2WWX B;  5FEJ A;  3GHQ A;  2HTN A;  2V2O A;  5AXS A;  3KX9 A;  2FL0 A;  3VVA A;  1NF6 A;  2Z90 A;  1F30 A;  5GU1 X;  3AJP A;  2JD7 0;  3AF8 X;  1S30 A;  3F34 A;  1MOJ A;  5HJH A;  3NP2 X;  2XGW A;  1JRE A;  3BVF A;  3PW1 B;  2OKC A;  5E2D A;  2W0O A;  1B71 A;  2C2U A;  2ZUR X;  4CYA A; 
#chains in the Genus database with same CATH homology
 3R2H A;  3ISE A;  1BCF A;  3N6O A;  5J9V A;  4M32 A;  2BK6 A;  4M35 A;  1L8I A;  1Z4A A;  3SE1 A;  3W54 A;  2OH3 A;  5D8P A;  2BKC A;  5HJF A;  3TA8 A;  5GU2 X;  2X17 0;  4ZKX A;  2JD6 0;  3UFB A;  4E40 A;  3R2M A;  4LYU A;  4M33 A;  3QVD A;  2WTL A;  2FG4 A;  3GGY A;  4ETR A;  4YXJ A;  3T9J A;  2V2P A;  3NP0 X;  1RCG A;  3PW8 A;  3KXU A;  1TKP A;  4DI0 A;  4LQJ A;  2HR5 A;  2IB0 A;  1JIG A;  1ZUJ A;  1LKP A;  2CF7 A;  1LB3 A;  4XGS A;  2N02 A;  1F33 A;  5C6F A;  4IWJ A;  5HU6 D;  4II4 A;  1XZ3 A;  3SHX A;  5CMR A;  5LBH A;  1BG7 A;  2GYD A;  2YW6 A;  1QGH A;  4CVT A;  3QHB A;  3AK9 A;  2CHP A;  2Z6M A;  4W4L B;  2CWL A;  1JKU A;  4DYZ A;  3GE4 A;  1S2Z A;  4U3G A;  2V15 A;  2YW7 A;  5HQO A;  4DE6 A;  1OTK A;  2F7N A;  3KDQ A;  4EVB A;  3PVT A;  1L8H A;  4YVZ A;  4R42 A;  2XKQ A;  3PVR B;  1J30 A;  1YUZ A;  3PWF A;  4RC7 A;  3C1Z A;  4OYN A;  2C41 A;  4YKH A;  2V2J A;  2OC5 A;  5JDO A;  4MJY A;  2FZF A;  3FRR A;  3R2R A;  2ZA6 A;  2Z5Q A;  3HL1 A;  2JD8 0;  2VXI A;  1H96 A;  5CZU A;  2QQY A;  1JI5 A;  1JKV A;  3EGM A;  3O7S A;  4IXK A;  5FFD A;  4P18 A;  2C2F A;  1Z6O M;  4ISM A;  4TW3 A;  4ITW A;  5LG8 A;  4CVR A;  5FFE A;  1JI4 A;  1S3Q A;  4Z5S A;  3BVE A;  1UVH A;  2FG8 A;  4ZKW A;  4DYX A;  5J8W A;  2CN7 A;  1QYB A;  1VEL A;  1IER A;  4X0J A;  3WVV A;  4IWK A;  2PYB A;  1YUX A;  1ZS3 A;  2Y3Q A;  4TOF A;  2WLA A;  5FFA A;  3OJ5 A;  4KXR B;  3IQ1 A;  4LQN A;  4MXP A;  3RGD A;  3F32 A;  3E1P A;  5JKM A;  1TK6 A;  3KA3 A;  3V3K B;  5JKL A;  2CLB A;  5GU0 X;  3Q4Q A;  4EVC A;  1TKO A;  3KA9 A;  3E1J A;  3Q4N A;  4PG0 A;  4ZL6 A;  2Y44 A;  3BVK A;  5LG2 A;  3RBC A;  2FFX J;  1R03 A;  5ERJ A;  2V2R A;  2IY4 A;  3KA6 A;  4KVS A;  4REU A;  4M34 A;  4CVS A;  4II4 B;  4XKU A;  4CMY V;  3EZ0 A;  5ERK A;  4MN9 A;  4LYX A;  4ZKH A;  3E1M A;  4RC6 B;  1UMN A;  3Q4R A;  3E1Q A;  5GN8 B;  1TJO A;  2V2N A;  2FJC A;  5D8Y A;  3F39 A;  4EVD A;  3PVY B;  1MFR A;  4DYY A;  4MUD A;  4ZLW A;  1O9I A;  1RCC A;  4PGK A;  5D8Q A;  3R2L A;  4QUW A;  5JAC A;  1RCI A;  2C2J A;  3KA8 A;  5I4J A;  4RC5 B;  3PVT B;  3KWO A;  4W4K B;  2V2M A;  4EVE A;  1N1Q A;  1JTS A;  5J8S A;  4RC7 B;  4ZL5 A;  3ES3 A;  2RBD A;  2IU2 A;  1VLG A;  1YV1 A;  3KHK A;  3AF7 X;  1BFR A;  5JDO B;  3R2K A;  4ZTT A;  5D8R A;  3AJQ A;  3E1N A;  4TOA A;  5JKM G;  1EUM A;  2XJN A;  3SH6 A;  1DAT A;  2Z5R A;  1NF4 A;  4XKS A;  3RE7 A;  3UNO A;  2CIH A;  4LPJ A;  3A9Q A;  3FVB A;  5JKL G;  4KVR A;  2UX1 A;  2CEI A;  3FRS A;  3SID A;  5E1U A;  3DBY A;  2GYQ A;  3BVI A;  4TOB A;  4Y08 A;  4PGI A;  3PZA A;  2FKZ A;  1RCD A;  1RCE A;  2Z5P A;  5D8O A;  1JGC A;  5GU3 X;  2AR0 A;  2CHI A;  3LKD A;  2V2L A;  1SOF A;  1LKO A;  3F33 A;  2V2S A;  4YXM A;  3PWQ C;  4WJG 4;  1DVB A;  4ITT A;  3IS7 A;  3RD0 A;  2GS4 A;  2G4H A;  3E1L A;  2FHA A;  4ML5 A;  4XKT A;  3QD8 A;  3BKN A;  2V8U A;  1GWG A;  3FSE A;  4MKU A;  4LPN A;  4AM5 A;  4AM2 A;  2MGY A;  1VEQ A;  5GOU A;  3U90 A;  2ZG8 X;  1SQ3 A;  4KVQ A;  3NOZ X;  3BVL A;  3Q4O A;  1JYB A;  4DYU A;  4Z3B A;  5J93 A;  2V2I A;  5D8S A;  4TOD A;  3C1Y A;  3E1O A;  3PW1 A;  1NFV A;  3VV9 A;  3VNX A;  1IES A;  2VZB A;  3KA4 A;  4LPM A;  5FFC A;  2ZG7 X;  2ITB A;  3AK8 A;  3WVU A;  2V8T A;  5LS9 A;  3AJO A;  3H7G A;  3AF9 X;  1DPS A;  3RAV A;  3HIU A;  1XZ1 A;  3GVY A;  1FHA A;  2BJY A;  1KRQ A;  5K52 A;  4CY9 A;  2WLU A;  2XJM A;  3FI6 A;  3F36 A;  2CLU A;  4TO9 A;  2QF9 A;  5CMQ A;  4LQV A;  1RYT A;  2ZG9 X;  4TOG A;  2CN6 A;  1VJX A;  3QHC A;  4A25 A;  1LKM A;  2VXX A;  3F35 A;  3MPS A;  1AEW A;  3F38 A;  3PWQ A;  3E6R A;  3C21 A;  3D19 A;  3JZA B;  4DAS A;  1NNQ A;  3R2S A;  4ZMC A;  2C6R A;  4ERU A;  1O9R A;  4AM4 A;  4ISP A;  3C23 A;  3E2C A;  2YJJ A;  4RC6 A;  4MY7 A;  5GN8 A;  4E6K A;  2G38 B;  3R2O A;  2BW1 A;  4ZJK A;  3IS8 A;  3F37 A;  4TOE A;  5IX6 A;  3PVY A;  1HRS A;  3A68 A;  4CVP A;  4DZ0 A;  5K53 A;  5FFB A;  4PG1 A;  5D8X A;  3ERZ A;  2ZA7 A;  3E6S A;  1Z6O A;  3WNW A;  3BT5 A;  3WVW A;  4TOC A;  4RC5 A;  3QB9 A;  3OGH A;  3GGZ A;  4TOH A;  4LQH A;  4RC8 A;  2XJO A;  2YJK A;  3JZ9 A;  3UOI A;  3QZ3 A;  3PW8 C;  2ZA8 A;  3L0M A;  4CYB A;  3EZU A;  4CMY A;  1VEI A;  2D5K A;  3ISF A;  3PVR A;  3M6J A;  3O7R A;  3UOF A;  2WWX B;  5FEJ A;  3GHQ A;  2HTN A;  2V2O A;  5AXS A;  3KX9 A;  2FL0 A;  3VVA A;  1NF6 A;  2Z90 A;  1F30 A;  5GU1 X;  3AJP A;  2JD7 0;  3AF8 X;  1S30 A;  3F34 A;  1MOJ A;  5HJH A;  3NP2 X;  2XGW A;  1JRE A;  3BVF A;  3PW1 B;  2OKC A;  5E2D A;  2W0O A;  1B71 A;  2C2U A;  2ZUR X;  4CYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...