4CYBA

Dpsc from streptomyces coelicolor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
172
structure length
172
Chain Sequence
RTIQEFGTVKQFPVALTMDTRLYSCQRLNKVLADTRILHDLYKKYHWLMRGATFYQLHLLLDKHAGEQLELIDTVAERVQTLGGVAVGDPRHVAEITTVPRPPDGVEEVPSMLSRLLEAHELILTECHDAAARTQEYGDDGTNDLLVSEVLRTNELQAWFVAEHLVDTPLVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron binding protein
molecule keywords PUTATIVE DNA PROTECTION PROTEIN
publication title A Tale of Tails: Deciphering the Contribution of Terminal Tails to the Biochemical Properties of Two Dps Proteins from Streptomyces Coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 75
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4cybA00
1S30A 4LPMA 2BK6A 3GVYA 4MN9A 4RC5A 1JTSA 3SE1A 2ZA6A 3F37A 5ERKA 2D5KA 3HIUA 4ITWA 1TJOA 3E1LA 1BFRA 5JKMA 2C41A 3EZ0A 3MPSA 3AJPA 4LQHA 5GN8A 4ML5A 1IESA 2JD60 3O7SA 1S3QA 5FFDA 3F32A 1R03A 4ISMA 4TOCA 5E1UA 3AF8X 1Z6OA 3F35A 1JREA 3VNXA 1F33A 1BCFA 5JKLG 1BG7A 4PG0A 3QB9A 3EGMA 5FEJA 1RCIA 2C2FA 3F38A 3NP0X 2CIHA 4R42A 2CHPA 2FJCA 5J8WA 3UNOA 3BT5A 5CMQA 5D8PA 4AM5A 5JACA 2ITBA 2FG8A 2C6RA 4RC5B 2QQYA 2OC5A 3SH6A 3KXUA 1QYBA 2ZURX 3FVBA 1LKPA 2RBDA 1RCGA 1Z6OM 1GWGA 1TK6A 5GOUA 3Q4QA 3IS7A 3T9JA 4EVCA 2GYQA 3E1MA 2YW6A 1VELA 2BKCA 2FL0A 5GN8B 1JKVA 2V2LA 1Z4AA 1TKPA 4TOBA 4M32A 1DPSA 4ZJKA 4KVQA 2CN7A 5GU0X 3TA8A 3ISFA 4Z3BA 3OJ5A 1UVHA 2BJYA 2C2UA 4Z5SA 4ZKXA 1YUXA 1MFRA 4ERUA 1AEWA 3ERZA 3QHBA 2IU2A 4KVRA 1KRQA 2FHAA 3UOIA 4CVTA 4MJYA 4TODA 3PWFA 4RC6A 1FHAA 3BVKA 2YJJA 2HTNA 2V2RA 3E2CA 1EUMA 2WLUA 3E1OA 2V2IA 1SQ3A 4CVRA 1NF6A 2X170 4TOEA 4EVEA 2V2NA 3RGDA 4TOGA 5LBHA 2OH3A 5JKMG 2YJKA 3R2SA 4DYXA 3RAVA 1NNQA 4ZL5A 3F33A 1YUZA 5GU2X 3O7RA 3AJOA 3U90A 4ZLWA 3AF9X 3QHCA 4DYZA 5I4JA 3E6SA 4DE6A 3IS8A 5AXSA 3R2KA 3AK8A 1JKUA 5D8OA 4AM2A 2Z5QA 1VJXA 3R2RA 4YKHA 2V15A 4XGSA 3R2MA 4ITTA 5D8YA 2FKZA 2QF9A 1ZS3A 5J93A 3BVFA 3HL1A 2CLUA 1JGCA 4ZTTA 1OTKA 3AJQA 3SIDA 4IWJA 3PVTA 4RC6B 3PVRA 5HJFA 4TOAA 2FG4A 4IXKA 3RBCA 2V2JA 2V2PA 4EVDA 3AK9A 3PW1A 5D8XA 4ZL6A 3RD0A 4CYAA 2HR5A 2Y3QA 4TW3A 1DVBA 4ZKWA 3KA9A 2FZFA 3KA8A 4P18A 1LB3A 3F39A 4LYXA 4MY7A 4AM4A 3PW8A 3A9QA 4DASA 2V2OA 2W0OA 2JD70 3R2OA 3WVUA 2VXXA 4LYUA 2CLBA 5FFBA 2ZA8A 3UOFA 1HRSA 4PGKA 4LQJA 2F7NA 4EVBA 1F30A 2CEIA 3E1NA 3PWQA 5D8SA 4KVSA 4II4A 1L8IA 3R2HA 3WNWA 2IB0A 2GS4A 3QZ3A 4OYNA 2IY4A 1IERA 3GHQA 1LKOA 2JD80 2XJMA 5CZUA 2CF7A 3PVTB 1ZUJA 3PVRB 3Q4NA 2ZG9X 3E1JA 2ZG8X 4U3GA 5FFAA 5LG8A 1N1QA 3PW1B 5J9VA 3FSEA 3BVEA 4RC8A 3H7GA 1VEQA 5LG2A 2VXIA 4XKTA 4RC7A 1H96A 2V2SA 1DATA 2GYDA 5J8SA 5FFCA 4IWKA 4ZMCA 3BKNA 4CMYV 1NF4A 4CYBA 5GU3X 1JYBA 5IX6A 4DI0A 3KA6A 2Z5PA 5GU1X 3OGHA 4ISPA 4XKUA 4DYYA 2Z6MA 3ISEA 4II4B 3AF7X 4ZKHA 5HQOA 3KX9A 5D8RA 5C6FA 2Z90A 3ES3A 2XKQA 2UX1A 2WTLA 1O9RA 3GE4A 4M33A 3IQ1A 4CY9A 3BVLA 1UMNA 2XJOA 4PGIA 1QGHA 5D8QA 5K53A 5FFEA 2Z5RA 1RCDA 4Y08A 2VZBA 4QUWA 1XZ1A 3R2LA 3SHXA 2ZA7A 4LQNA 1B71A 3PVYA 5JKLA 3KA4A 4M34A 1XZ3A 4RC7B 1RCCA 3Q4RA 4CVSA 5HJHA 3EZUA 4XKSA 1YV1A 2CN6A 1J30A 4DYUA 5CMRA 4ETRA 4TOHA 4DZ0A 3PZAA 2WLAA 1RCEA 3KA3A 1L8HA 2V2MA 1MOJA 3KWOA 4TO9A 1NFVA 2PYBA 3A68A 1JI4A 5ERJA 5LS9A 3WVWA 3PW8C 4MKUA 4PG1A 2FFXJ 3WVVA 3NP2X 2XJNA 3E1PA 3Q4OA 4TOFA 2ZG7X 4MUDA 2CHIA 1LKMA 3BVIA 3QD8A 1O9IA 1JI5A 1TKOA 4M35A 4CVPA 3QVDA 3FI6A 1JIGA 2G4HA 3NOZX 1RYTA 3E6RA 3RE7A 1VEIA 3F34A 3PWQC 3PVYB 4LPNA 4LPJA 1VLGA 2C2JA 2YW7A 1S2ZA 1SOFA 4REUA 5K52A 4CMYA 5E2DA 3F36A 2BW1A 4A25A 4E6KA 3E1QA 2XGWA 4LQVA
chains in the Genus database with same CATH superfamily
1S30A 4LPMA 4YXMA 2BK6A 3GVYA 4MN9A 4RC5A 1JTSA 3SE1A 2ZA6A 2V8UA 3F37A 5ERKA 2D5KA 3HIUA 4ITWA 1TJOA 3E1LA 1BFRA 4MXPA 5JKMA 2C41A 5JDOA 3EZ0A 3MPSA 3AJPA 4LQHA 2OKCA 5GN8A 4ML5A 2V8TA 1IESA 2JD60 3O7SA 1S3QA 5FFDA 3F32A 1R03A 4ISMA 4TOCA 5E1UA 3AF8X 1Z6OA 3F35A 1JREA 3VNXA 1F33A 1BCFA 5JKLG 1BG7A 4PG0A 3QB9A 3EGMA 5FEJA 1RCIA 2C2FA 2MGYA 3F38A 3NP0X 2CIHA 4R42A 2CHPA 2FJCA 4X0JA 4W4LB 5J8WA 3UNOA 3BT5A 5CMQA 5D8PA 3KDQA 4AM5A 5JACA 2ITBA 2FG8A 2C6RA 4RC5B 2QQYA 2OC5A 3SH6A 3KXUA 1QYBA 2ZURX 3FVBA 1LKPA 2RBDA 1RCGA 1Z6OM 1GWGA 1TK6A 5GOUA 3Q4QA 3IS7A 3T9JA 4EVCA 2GYQA 3E1MA 2YW6A 5JDOB 1VELA 2BKCA 2FL0A 5GN8B 1JKVA 2V2LA 1Z4AA 1TKPA 4TOBA 4M32A 3LKDA 1DPSA 4ZJKA 4KVQA 2CN7A 5GU0X 3TA8A 3ISFA 4Z3BA 3OJ5A 1UVHA 2BJYA 2C2UA 4Z5SA 4ZKXA 1YUXA 3GGYA 1MFRA 4ERUA 1AEWA 3ERZA 3QHBA 2IU2A 4KVRA 1KRQA 2CWLA 2FHAA 3UOIA 4CVTA 4MJYA 4KXRB 4TODA 3PWFA 4RC6A 3GGZA 2Y44A 1FHAA 3BVKA 2YJJA 2HTNA 2V2RA 3E2CA 1EUMA 2WLUA 3E1OA 3JZAB 2V2IA 1SQ3A 4CVRA 1NF6A 2X170 4TOEA 4EVEA 2V2NA 3RGDA 3KHKA 4TOGA 3C23A 5LBHA 2OH3A 5JKMG 2YJKA 3R2SA 4DYXA 3RAVA 1NNQA 4ZL5A 3F33A 1YUZA 5GU2X 3O7RA 3AJOA 3U90A 4ZLWA 3AF9X 3QHCA 4DYZA 5I4JA 3E6SA 4DE6A 3IS8A 5AXSA 3R2KA 3AK8A 1JKUA 5D8OA 4AM2A 4YVZA 2Z5QA 1VJXA 3R2RA 4YKHA 2V15A 4XGSA 3D19A 3R2MA 4ITTA 5D8YA 2FKZA 2QF9A 1ZS3A 5J93A 3BVFA 3HL1A 2CLUA 1JGCA 4ZTTA 1OTKA 3AJQA 3SIDA 3C21A 3N6OA 4IWJA 3PVTA 4RC6B 3PVRA 5HJFA 4TOAA 2FG4A 4IXKA 3RBCA 2V2JA 4W4KB 2V2PA 4EVDA 3AK9A 3PW1A 5D8XA 4ZL6A 3RD0A 4CYAA 2HR5A 2Y3QA 4TW3A 1DVBA 4ZKWA 3KA9A 3JZ9A 4E40A 2FZFA 3KA8A 4P18A 1LB3A 3F39A 4LYXA 4MY7A 4AM4A 3PW8A 3A9QA 2AR0A 4DASA 2V2OA 2W0OA 2JD70 3VVAA 3R2OA 3WVUA 2VXXA 4LYUA 2CLBA 5FFBA 2ZA8A 3UOFA 1HRSA 4PGKA 4LQJA 2G38B 2F7NA 4EVBA 1F30A 2CEIA 3E1NA 3PWQA 5D8SA 4KVSA 4II4A 1L8IA 3R2HA 3WNWA 2IB0A 2GS4A 3QZ3A 4OYNA 2IY4A 1IERA 3GHQA 1LKOA 2JD80 2XJMA 5CZUA 2CF7A 3PVTB 1ZUJA 3PVRB 3Q4NA 2ZG9X 3E1JA 3V3KB 2ZG8X 4U3GA 5FFAA 5LG8A 1N1QA 3PW1B 5J9VA 3FSEA 3BVEA 3C1ZA 4RC8A 3H7GA 1VEQA 5LG2A 2VXIA 4XKTA 4WJG4 4RC7A 1H96A 2V2SA 1DATA 2GYDA 5J8SA 5FFCA 3W54A 2N02A 4IWKA 4YXJA 3DBYA 4ZMCA 3BKNA 3L0MA 4CMYV 1NF4A 4CYBA 5GU3X 1JYBA 5IX6A 4DI0A 3KA6A 2Z5PA 5GU1X 3OGHA 4ISPA 4XKUA 4DYYA 2Z6MA 3ISEA 4II4B 3AF7X 4ZKHA 5HQOA 3KX9A 5D8RA 5C6FA 2Z90A 3ES3A 2XKQA 2UX1A 2WTLA 1O9RA 3GE4A 4M33A 3IQ1A 4CY9A 3BVLA 1UMNA 2XJOA 4PGIA 1QGHA 5D8QA 5K53A 5FFEA 2Z5RA 1RCDA 4Y08A 2VZBA 4QUWA 1XZ1A 3FRRA 3R2LA 3SHXA 2ZA7A 4LQNA 1B71A 3PVYA 5JKLA 3KA4A 4M34A 1XZ3A 4RC7B 1RCCA 3Q4RA 4CVSA 2WWXB 3VV9A 5HJHA 3EZUA 3C1YA 4XKSA 1YV1A 2CN6A 1J30A 4DYUA 5CMRA 4ETRA 4TOHA 3UFBA 4DZ0A 3PZAA 2WLAA 1RCEA 3KA3A 1L8HA 2V2MA 1MOJA 3KWOA 4TO9A 1NFVA 3FRSA 5HU6D 2PYBA 3A68A 1JI4A 5ERJA 3M6JA 5LS9A 3WVWA 3PW8C 4MKUA 4PG1A 2FFXJ 3WVVA 3NP2X 2XJNA 3E1PA 3Q4OA 4TOFA 2ZG7X 4MUDA 2CHIA 1LKMA 3BVIA 3QD8A 1O9IA 1JI5A 1TKOA 4M35A 4CVPA 3QVDA 3FI6A 1JIGA 2G4HA 3NOZX 1RYTA 3E6RA 3RE7A 1VEIA 3F34A 3PWQC 3PVYB 4LPNA 4LPJA 1VLGA 2C2JA 2YW7A 1S2ZA 1SOFA 4REUA 5K52A 4CMYA 5E2DA 3F36A 2BW1A 4A25A 4E6KA 3E1QA 2XGWA 4LQVA
chains in the Genus database with same CATH topology
1S30A 4LPMA 4YXMA 2BK6A 3GVYA 4MN9A 4RC5A 1JTSA 3SE1A 2ZA6A 2V8UA 3F37A 5ERKA 2D5KA 3HIUA 4ITWA 1TJOA 3E1LA 1BFRA 4MXPA 5JKMA 2C41A 5JDOA 3EZ0A 3MPSA 3AJPA 4LQHA 2OKCA 5GN8A 4ML5A 2V8TA 1IESA 2JD60 3O7SA 1S3QA 5FFDA 3F32A 1R03A 4ISMA 4TOCA 5E1UA 3AF8X 1Z6OA 3F35A 1JREA 3VNXA 1F33A 1BCFA 5JKLG 1BG7A 4PG0A 3QB9A 3EGMA 5FEJA 1RCIA 2C2FA 2MGYA 3F38A 3NP0X 2CIHA 4R42A 2CHPA 2FJCA 4X0JA 4W4LB 5J8WA 3UNOA 3BT5A 5CMQA 5D8PA 3KDQA 4AM5A 5JACA 2ITBA 2FG8A 2C6RA 4RC5B 2QQYA 2OC5A 3SH6A 3KXUA 1QYBA 2ZURX 3FVBA 1LKPA 2RBDA 1RCGA 1Z6OM 1GWGA 1TK6A 5GOUA 3Q4QA 3IS7A 3T9JA 4EVCA 2GYQA 3E1MA 2YW6A 5JDOB 1VELA 2BKCA 2FL0A 5GN8B 1JKVA 2V2LA 1Z4AA 1TKPA 4TOBA 4M32A 3LKDA 1DPSA 4ZJKA 4KVQA 2CN7A 5GU0X 3TA8A 3ISFA 4Z3BA 3OJ5A 1UVHA 2BJYA 2C2UA 4Z5SA 4ZKXA 1YUXA 3GGYA 1MFRA 4ERUA 1AEWA 3ERZA 3QHBA 2IU2A 4KVRA 1KRQA 2CWLA 2FHAA 3UOIA 4CVTA 4MJYA 4KXRB 4TODA 3PWFA 4RC6A 3GGZA 2Y44A 1FHAA 3BVKA 2YJJA 2HTNA 2V2RA 3E2CA 1EUMA 2WLUA 3E1OA 3JZAB 2V2IA 1SQ3A 4CVRA 1NF6A 2X170 4TOEA 4EVEA 2V2NA 3RGDA 3KHKA 4TOGA 3C23A 5LBHA 2OH3A 5JKMG 2YJKA 3R2SA 4DYXA 3RAVA 1NNQA 4ZL5A 3F33A 1YUZA 5GU2X 3O7RA 3AJOA 3U90A 4ZLWA 3AF9X 3QHCA 4DYZA 5I4JA 3E6SA 4DE6A 3IS8A 5AXSA 3R2KA 3AK8A 1JKUA 5D8OA 4AM2A 4YVZA 2Z5QA 1VJXA 3R2RA 4YKHA 2V15A 4XGSA 3D19A 3R2MA 4ITTA 5D8YA 2FKZA 2QF9A 1ZS3A 5J93A 3BVFA 3HL1A 2CLUA 1JGCA 4ZTTA 1OTKA 3AJQA 3SIDA 3C21A 3N6OA 4IWJA 3PVTA 4RC6B 3PVRA 5HJFA 4TOAA 2FG4A 4IXKA 3RBCA 2V2JA 4W4KB 2V2PA 4EVDA 3AK9A 3PW1A 5D8XA 4ZL6A 3RD0A 4CYAA 2HR5A 2Y3QA 4TW3A 1DVBA 4ZKWA 3KA9A 3JZ9A 4E40A 2FZFA 3KA8A 4P18A 1LB3A 3F39A 4LYXA 4MY7A 4AM4A 3PW8A 3A9QA 2AR0A 4DASA 2V2OA 2W0OA 2JD70 3VVAA 3R2OA 3WVUA 2VXXA 4LYUA 2CLBA 5FFBA 2ZA8A 3UOFA 1HRSA 4PGKA 4LQJA 2G38B 2F7NA 4EVBA 1F30A 2CEIA 3E1NA 3PWQA 5D8SA 4KVSA 4II4A 1L8IA 3R2HA 3WNWA 2IB0A 2GS4A 3QZ3A 4OYNA 2IY4A 1IERA 3GHQA 1LKOA 2JD80 2XJMA 5CZUA 2CF7A 3PVTB 1ZUJA 3PVRB 3Q4NA 2ZG9X 3E1JA 3V3KB 2ZG8X 4U3GA 5FFAA 5LG8A 1N1QA 3PW1B 5J9VA 3FSEA 3BVEA 3C1ZA 4RC8A 3H7GA 1VEQA 5LG2A 2VXIA 4XKTA 4WJG4 4RC7A 1H96A 2V2SA 1DATA 2GYDA 5J8SA 5FFCA 3W54A 2N02A 4IWKA 4YXJA 3DBYA 4ZMCA 3BKNA 3L0MA 4CMYV 1NF4A 4CYBA 5GU3X 1JYBA 5IX6A 4DI0A 3KA6A 2Z5PA 5GU1X 3OGHA 4ISPA 4XKUA 4DYYA 2Z6MA 3ISEA 4II4B 3AF7X 4ZKHA 5HQOA 3KX9A 5D8RA 5C6FA 2Z90A 3ES3A 2XKQA 2UX1A 2WTLA 1O9RA 3GE4A 4M33A 3IQ1A 4CY9A 3BVLA 1UMNA 2XJOA 4PGIA 1QGHA 5D8QA 5K53A 5FFEA 2Z5RA 1RCDA 4Y08A 2VZBA 4QUWA 1XZ1A 3FRRA 3R2LA 3SHXA 2ZA7A 4LQNA 1B71A 3PVYA 5JKLA 3KA4A 4M34A 1XZ3A 4RC7B 1RCCA 3Q4RA 4CVSA 2WWXB 3VV9A 5HJHA 3EZUA 3C1YA 4XKSA 1YV1A 2CN6A 1J30A 4DYUA 5CMRA 4ETRA 4TOHA 3UFBA 4DZ0A 3PZAA 2WLAA 1RCEA 3KA3A 1L8HA 2V2MA 1MOJA 3KWOA 4TO9A 1NFVA 3FRSA 5HU6D 2PYBA 3A68A 1JI4A 5ERJA 3M6JA 5LS9A 3WVWA 3PW8C 4MKUA 4PG1A 2FFXJ 3WVVA 3NP2X 2XJNA 3E1PA 3Q4OA 4TOFA 2ZG7X 4MUDA 2CHIA 1LKMA 3BVIA 3QD8A 1O9IA 1JI5A 1TKOA 4M35A 4CVPA 3QVDA 3FI6A 1JIGA 2G4HA 3NOZX 1RYTA 3E6RA 3RE7A 1VEIA 3F34A 3PWQC 3PVYB 4LPNA 4LPJA 1VLGA 2C2JA 2YW7A 1S2ZA 1SOFA 4REUA 5K52A 4CMYA 5E2DA 3F36A 2BW1A 4A25A 4E6KA 3E1QA 2XGWA 4LQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S30 A;  4LPM A;  2BK6 A;  3GVY A;  4MN9 A;  4RC5 A;  1JTS A;  3SE1 A;  2ZA6 A;  3F37 A;  5ERK A;  2D5K A;  3HIU A;  4ITW A;  1TJO A;  3E1L A;  1BFR A;  5JKM A;  2C41 A;  3EZ0 A;  3MPS A;  3AJP A;  4LQH A;  5GN8 A;  4ML5 A;  1IES A;  2JD6 0;  3O7S A;  1S3Q A;  5FFD A;  3F32 A;  1R03 A;  4ISM A;  4TOC A;  5E1U A;  3AF8 X;  1Z6O A;  3F35 A;  1JRE A;  3VNX A;  1F33 A;  1BCF A;  5JKL G;  1BG7 A;  4PG0 A;  3QB9 A;  3EGM A;  5FEJ A;  1RCI A;  2C2F A;  3F38 A;  3NP0 X;  2CIH A;  4R42 A;  2CHP A;  2FJC A;  5J8W A;  3UNO A;  3BT5 A;  5CMQ A;  5D8P A;  4AM5 A;  5JAC A;  2ITB A;  2FG8 A;  2C6R A;  4RC5 B;  2QQY A;  2OC5 A;  3SH6 A;  3KXU A;  1QYB A;  2ZUR X;  3FVB A;  1LKP A;  2RBD A;  1RCG A;  1Z6O M;  1GWG A;  1TK6 A;  5GOU A;  3Q4Q A;  3IS7 A;  3T9J A;  4EVC A;  2GYQ A;  3E1M A;  2YW6 A;  1VEL A;  2BKC A;  2FL0 A;  5GN8 B;  1JKV A;  2V2L A;  1Z4A A;  1TKP A;  4TOB A;  4M32 A;  1DPS A;  4ZJK A;  4KVQ A;  2CN7 A;  5GU0 X;  3TA8 A;  3ISF A;  4Z3B A;  3OJ5 A;  1UVH A;  2BJY A;  2C2U A;  4Z5S A;  4ZKX A;  1YUX A;  1MFR A;  4ERU A;  1AEW A;  3ERZ A;  3QHB A;  2IU2 A;  4KVR A;  1KRQ A;  2FHA A;  3UOI A;  4CVT A;  4MJY A;  4TOD A;  3PWF A;  4RC6 A;  1FHA A;  3BVK A;  2YJJ A;  2HTN A;  2V2R A;  3E2C A;  1EUM A;  2WLU A;  3E1O A;  2V2I A;  1SQ3 A;  4CVR A;  1NF6 A;  2X17 0;  4TOE A;  4EVE A;  2V2N A;  3RGD A;  4TOG A;  5LBH A;  2OH3 A;  5JKM G;  2YJK A;  3R2S A;  4DYX A;  3RAV A;  1NNQ A;  4ZL5 A;  3F33 A;  1YUZ A;  5GU2 X;  3O7R A;  3AJO A;  3U90 A;  4ZLW A;  3AF9 X;  3QHC A;  4DYZ A;  5I4J A;  3E6S A;  4DE6 A;  3IS8 A;  5AXS A;  3R2K A;  3AK8 A;  1JKU A;  5D8O A;  4AM2 A;  2Z5Q A;  1VJX A;  3R2R A;  4YKH A;  2V15 A;  4XGS A;  3R2M A;  4ITT A;  5D8Y A;  2FKZ A;  2QF9 A;  1ZS3 A;  5J93 A;  3BVF A;  3HL1 A;  2CLU A;  1JGC A;  4ZTT A;  1OTK A;  3AJQ A;  3SID A;  4IWJ A;  3PVT A;  4RC6 B;  3PVR A;  5HJF A;  4TOA A;  2FG4 A;  4IXK A;  3RBC A;  2V2J A;  2V2P A;  4EVD A;  3AK9 A;  3PW1 A;  5D8X A;  4ZL6 A;  3RD0 A;  4CYA A;  2HR5 A;  2Y3Q A;  4TW3 A;  1DVB A;  4ZKW A;  3KA9 A;  2FZF A;  3KA8 A;  4P18 A;  1LB3 A;  3F39 A;  4LYX A;  4MY7 A;  4AM4 A;  3PW8 A;  3A9Q A;  4DAS A;  2V2O A;  2W0O A;  2JD7 0;  3R2O A;  3WVU A;  2VXX A;  4LYU A;  2CLB A;  5FFB A;  2ZA8 A;  3UOF A;  1HRS A;  4PGK A;  4LQJ A;  2F7N A;  4EVB A;  1F30 A;  2CEI A;  3E1N A;  3PWQ A;  5D8S A;  4KVS A;  4II4 A;  1L8I A;  3R2H A;  3WNW A;  2IB0 A;  2GS4 A;  3QZ3 A;  4OYN A;  2IY4 A;  1IER A;  3GHQ A;  1LKO A;  2JD8 0;  2XJM A;  5CZU A;  2CF7 A;  3PVT B;  1ZUJ A;  3PVR B;  3Q4N A;  2ZG9 X;  3E1J A;  2ZG8 X;  4U3G A;  5FFA A;  5LG8 A;  1N1Q A;  3PW1 B;  5J9V A;  3FSE A;  3BVE A;  4RC8 A;  3H7G A;  1VEQ A;  5LG2 A;  2VXI A;  4XKT A;  4RC7 A;  1H96 A;  2V2S A;  1DAT A;  2GYD A;  5J8S A;  5FFC A;  4IWK A;  4ZMC A;  3BKN A;  4CMY V;  1NF4 A;  4CYB A;  5GU3 X;  1JYB A;  5IX6 A;  4DI0 A;  3KA6 A;  2Z5P A;  5GU1 X;  3OGH A;  4ISP A;  4XKU A;  4DYY A;  2Z6M A;  3ISE A;  4II4 B;  3AF7 X;  4ZKH A;  5HQO A;  3KX9 A;  5D8R A;  5C6F A;  2Z90 A;  3ES3 A;  2XKQ A;  2UX1 A;  2WTL A;  1O9R A;  3GE4 A;  4M33 A;  3IQ1 A;  4CY9 A;  3BVL A;  1UMN A;  2XJO A;  4PGI A;  1QGH A;  5D8Q A;  5K53 A;  5FFE A;  2Z5R A;  1RCD A;  4Y08 A;  2VZB A;  4QUW A;  1XZ1 A;  3R2L A;  3SHX A;  2ZA7 A;  4LQN A;  1B71 A;  3PVY A;  5JKL A;  3KA4 A;  4M34 A;  1XZ3 A;  4RC7 B;  1RCC A;  3Q4R A;  4CVS A;  5HJH A;  3EZU A;  4XKS A;  1YV1 A;  2CN6 A;  1J30 A;  4DYU A;  5CMR A;  4ETR A;  4TOH A;  4DZ0 A;  3PZA A;  2WLA A;  1RCE A;  3KA3 A;  1L8H A;  2V2M A;  1MOJ A;  3KWO A;  4TO9 A;  1NFV A;  2PYB A;  3A68 A;  1JI4 A;  5ERJ A;  5LS9 A;  3WVW A;  3PW8 C;  4MKU A;  4PG1 A;  2FFX J;  3WVV A;  3NP2 X;  2XJN A;  3E1P A;  3Q4O A;  4TOF A;  2ZG7 X;  4MUD A;  2CHI A;  1LKM A;  3BVI A;  3QD8 A;  1O9I A;  1JI5 A;  1TKO A;  4M35 A;  4CVP A;  3QVD A;  3FI6 A;  1JIG A;  2G4H A;  3NOZ X;  1RYT A;  3E6R A;  3RE7 A;  1VEI A;  3F34 A;  3PWQ C;  3PVY B;  4LPN A;  4LPJ A;  1VLG A;  2C2J A;  2YW7 A;  1S2Z A;  1SOF A;  4REU A;  5K52 A;  4CMY A;  5E2D A;  3F36 A;  2BW1 A;  4A25 A;  4E6K A;  3E1Q A;  2XGW A;  4LQV A; 
#chains in the Genus database with same CATH topology
 1S30 A;  4LPM A;  4YXM A;  2BK6 A;  3GVY A;  4MN9 A;  4RC5 A;  1JTS A;  3SE1 A;  2ZA6 A;  2V8U A;  3F37 A;  5ERK A;  2D5K A;  3HIU A;  4ITW A;  1TJO A;  3E1L A;  1BFR A;  4MXP A;  5JKM A;  2C41 A;  5JDO A;  3EZ0 A;  3MPS A;  3AJP A;  4LQH A;  2OKC A;  5GN8 A;  4ML5 A;  2V8T A;  1IES A;  2JD6 0;  3O7S A;  1S3Q A;  5FFD A;  3F32 A;  1R03 A;  4ISM A;  4TOC A;  5E1U A;  3AF8 X;  1Z6O A;  3F35 A;  1JRE A;  3VNX A;  1F33 A;  1BCF A;  5JKL G;  1BG7 A;  4PG0 A;  3QB9 A;  3EGM A;  5FEJ A;  1RCI A;  2C2F A;  2MGY A;  3F38 A;  3NP0 X;  2CIH A;  4R42 A;  2CHP A;  2FJC A;  4X0J A;  4W4L B;  5J8W A;  3UNO A;  3BT5 A;  5CMQ A;  5D8P A;  3KDQ A;  4AM5 A;  5JAC A;  2ITB A;  2FG8 A;  2C6R A;  4RC5 B;  2QQY A;  2OC5 A;  3SH6 A;  3KXU A;  1QYB A;  2ZUR X;  3FVB A;  1LKP A;  2RBD A;  1RCG A;  1Z6O M;  1GWG A;  1TK6 A;  5GOU A;  3Q4Q A;  3IS7 A;  3T9J A;  4EVC A;  2GYQ A;  3E1M A;  2YW6 A;  5JDO B;  1VEL A;  2BKC A;  2FL0 A;  5GN8 B;  1JKV A;  2V2L A;  1Z4A A;  1TKP A;  4TOB A;  4M32 A;  3LKD A;  1DPS A;  4ZJK A;  4KVQ A;  2CN7 A;  5GU0 X;  3TA8 A;  3ISF A;  4Z3B A;  3OJ5 A;  1UVH A;  2BJY A;  2C2U A;  4Z5S A;  4ZKX A;  1YUX A;  3GGY A;  1MFR A;  4ERU A;  1AEW A;  3ERZ A;  3QHB A;  2IU2 A;  4KVR A;  1KRQ A;  2CWL A;  2FHA A;  3UOI A;  4CVT A;  4MJY A;  4KXR B;  4TOD A;  3PWF A;  4RC6 A;  3GGZ A;  2Y44 A;  1FHA A;  3BVK A;  2YJJ A;  2HTN A;  2V2R A;  3E2C A;  1EUM A;  2WLU A;  3E1O A;  3JZA B;  2V2I A;  1SQ3 A;  4CVR A;  1NF6 A;  2X17 0;  4TOE A;  4EVE A;  2V2N A;  3RGD A;  3KHK A;  4TOG A;  3C23 A;  5LBH A;  2OH3 A;  5JKM G;  2YJK A;  3R2S A;  4DYX A;  3RAV A;  1NNQ A;  4ZL5 A;  3F33 A;  1YUZ A;  5GU2 X;  3O7R A;  3AJO A;  3U90 A;  4ZLW A;  3AF9 X;  3QHC A;  4DYZ A;  5I4J A;  3E6S A;  4DE6 A;  3IS8 A;  5AXS A;  3R2K A;  3AK8 A;  1JKU A;  5D8O A;  4AM2 A;  4YVZ A;  2Z5Q A;  1VJX A;  3R2R A;  4YKH A;  2V15 A;  4XGS A;  3D19 A;  3R2M A;  4ITT A;  5D8Y A;  2FKZ A;  2QF9 A;  1ZS3 A;  5J93 A;  3BVF A;  3HL1 A;  2CLU A;  1JGC A;  4ZTT A;  1OTK A;  3AJQ A;  3SID A;  3C21 A;  3N6O A;  4IWJ A;  3PVT A;  4RC6 B;  3PVR A;  5HJF A;  4TOA A;  2FG4 A;  4IXK A;  3RBC A;  2V2J A;  4W4K B;  2V2P A;  4EVD A;  3AK9 A;  3PW1 A;  5D8X A;  4ZL6 A;  3RD0 A;  4CYA A;  2HR5 A;  2Y3Q A;  4TW3 A;  1DVB A;  4ZKW A;  3KA9 A;  3JZ9 A;  4E40 A;  2FZF A;  3KA8 A;  4P18 A;  1LB3 A;  3F39 A;  4LYX A;  4MY7 A;  4AM4 A;  3PW8 A;  3A9Q A;  2AR0 A;  4DAS A;  2V2O A;  2W0O A;  2JD7 0;  3VVA A;  3R2O A;  3WVU A;  2VXX A;  4LYU A;  2CLB A;  5FFB A;  2ZA8 A;  3UOF A;  1HRS A;  4PGK A;  4LQJ A;  2G38 B;  2F7N A;  4EVB A;  1F30 A;  2CEI A;  3E1N A;  3PWQ A;  5D8S A;  4KVS A;  4II4 A;  1L8I A;  3R2H A;  3WNW A;  2IB0 A;  2GS4 A;  3QZ3 A;  4OYN A;  2IY4 A;  1IER A;  3GHQ A;  1LKO A;  2JD8 0;  2XJM A;  5CZU A;  2CF7 A;  3PVT B;  1ZUJ A;  3PVR B;  3Q4N A;  2ZG9 X;  3E1J A;  3V3K B;  2ZG8 X;  4U3G A;  5FFA A;  5LG8 A;  1N1Q A;  3PW1 B;  5J9V A;  3FSE A;  3BVE A;  3C1Z A;  4RC8 A;  3H7G A;  1VEQ A;  5LG2 A;  2VXI A;  4XKT A;  4WJG 4;  4RC7 A;  1H96 A;  2V2S A;  1DAT A;  2GYD A;  5J8S A;  5FFC A;  3W54 A;  2N02 A;  4IWK A;  4YXJ A;  3DBY A;  4ZMC A;  3BKN A;  3L0M A;  4CMY V;  1NF4 A;  4CYB A;  5GU3 X;  1JYB A;  5IX6 A;  4DI0 A;  3KA6 A;  2Z5P A;  5GU1 X;  3OGH A;  4ISP A;  4XKU A;  4DYY A;  2Z6M A;  3ISE A;  4II4 B;  3AF7 X;  4ZKH A;  5HQO A;  3KX9 A;  5D8R A;  5C6F A;  2Z90 A;  3ES3 A;  2XKQ A;  2UX1 A;  2WTL A;  1O9R A;  3GE4 A;  4M33 A;  3IQ1 A;  4CY9 A;  3BVL A;  1UMN A;  2XJO A;  4PGI A;  1QGH A;  5D8Q A;  5K53 A;  5FFE A;  2Z5R A;  1RCD A;  4Y08 A;  2VZB A;  4QUW A;  1XZ1 A;  3FRR A;  3R2L A;  3SHX A;  2ZA7 A;  4LQN A;  1B71 A;  3PVY A;  5JKL A;  3KA4 A;  4M34 A;  1XZ3 A;  4RC7 B;  1RCC A;  3Q4R A;  4CVS A;  2WWX B;  3VV9 A;  5HJH A;  3EZU A;  3C1Y A;  4XKS A;  1YV1 A;  2CN6 A;  1J30 A;  4DYU A;  5CMR A;  4ETR A;  4TOH A;  3UFB A;  4DZ0 A;  3PZA A;  2WLA A;  1RCE A;  3KA3 A;  1L8H A;  2V2M A;  1MOJ A;  3KWO A;  4TO9 A;  1NFV A;  3FRS A;  5HU6 D;  2PYB A;  3A68 A;  1JI4 A;  5ERJ A;  3M6J A;  5LS9 A;  3WVW A;  3PW8 C;  4MKU A;  4PG1 A;  2FFX J;  3WVV A;  3NP2 X;  2XJN A;  3E1P A;  3Q4O A;  4TOF A;  2ZG7 X;  4MUD A;  2CHI A;  1LKM A;  3BVI A;  3QD8 A;  1O9I A;  1JI5 A;  1TKO A;  4M35 A;  4CVP A;  3QVD A;  3FI6 A;  1JIG A;  2G4H A;  3NOZ X;  1RYT A;  3E6R A;  3RE7 A;  1VEI A;  3F34 A;  3PWQ C;  3PVY B;  4LPN A;  4LPJ A;  1VLG A;  2C2J A;  2YW7 A;  1S2Z A;  1SOF A;  4REU A;  5K52 A;  4CMY A;  5E2D A;  3F36 A;  2BW1 A;  4A25 A;  4E6K A;  3E1Q A;  2XGW A;  4LQV A; 
#chains in the Genus database with same CATH homology
 1S30 A;  4LPM A;  4YXM A;  2BK6 A;  3GVY A;  4MN9 A;  4RC5 A;  1JTS A;  3SE1 A;  2ZA6 A;  2V8U A;  3F37 A;  5ERK A;  2D5K A;  3HIU A;  4ITW A;  1TJO A;  3E1L A;  1BFR A;  4MXP A;  5JKM A;  2C41 A;  5JDO A;  3EZ0 A;  3MPS A;  3AJP A;  4LQH A;  2OKC A;  5GN8 A;  4ML5 A;  2V8T A;  1IES A;  2JD6 0;  3O7S A;  1S3Q A;  5FFD A;  3F32 A;  1R03 A;  4ISM A;  4TOC A;  5E1U A;  3AF8 X;  1Z6O A;  3F35 A;  1JRE A;  3VNX A;  1F33 A;  1BCF A;  5JKL G;  1BG7 A;  4PG0 A;  3QB9 A;  3EGM A;  5FEJ A;  1RCI A;  2C2F A;  2MGY A;  3F38 A;  3NP0 X;  2CIH A;  4R42 A;  2CHP A;  2FJC A;  4X0J A;  4W4L B;  5J8W A;  3UNO A;  3BT5 A;  5CMQ A;  5D8P A;  3KDQ A;  4AM5 A;  5JAC A;  2ITB A;  2FG8 A;  2C6R A;  4RC5 B;  2QQY A;  2OC5 A;  3SH6 A;  3KXU A;  1QYB A;  2ZUR X;  3FVB A;  1LKP A;  2RBD A;  1RCG A;  1Z6O M;  1GWG A;  1TK6 A;  5GOU A;  3Q4Q A;  3IS7 A;  3T9J A;  4EVC A;  2GYQ A;  3E1M A;  2YW6 A;  5JDO B;  1VEL A;  2BKC A;  2FL0 A;  5GN8 B;  1JKV A;  2V2L A;  1Z4A A;  1TKP A;  4TOB A;  4M32 A;  3LKD A;  1DPS A;  4ZJK A;  4KVQ A;  2CN7 A;  5GU0 X;  3TA8 A;  3ISF A;  4Z3B A;  3OJ5 A;  1UVH A;  2BJY A;  2C2U A;  4Z5S A;  4ZKX A;  1YUX A;  3GGY A;  1MFR A;  4ERU A;  1AEW A;  3ERZ A;  3QHB A;  2IU2 A;  4KVR A;  1KRQ A;  2CWL A;  2FHA A;  3UOI A;  4CVT A;  4MJY A;  4KXR B;  4TOD A;  3PWF A;  4RC6 A;  3GGZ A;  2Y44 A;  1FHA A;  3BVK A;  2YJJ A;  2HTN A;  2V2R A;  3E2C A;  1EUM A;  2WLU A;  3E1O A;  3JZA B;  2V2I A;  1SQ3 A;  4CVR A;  1NF6 A;  2X17 0;  4TOE A;  4EVE A;  2V2N A;  3RGD A;  3KHK A;  4TOG A;  3C23 A;  5LBH A;  2OH3 A;  5JKM G;  2YJK A;  3R2S A;  4DYX A;  3RAV A;  1NNQ A;  4ZL5 A;  3F33 A;  1YUZ A;  5GU2 X;  3O7R A;  3AJO A;  3U90 A;  4ZLW A;  3AF9 X;  3QHC A;  4DYZ A;  5I4J A;  3E6S A;  4DE6 A;  3IS8 A;  5AXS A;  3R2K A;  3AK8 A;  1JKU A;  5D8O A;  4AM2 A;  4YVZ A;  2Z5Q A;  1VJX A;  3R2R A;  4YKH A;  2V15 A;  4XGS A;  3D19 A;  3R2M A;  4ITT A;  5D8Y A;  2FKZ A;  2QF9 A;  1ZS3 A;  5J93 A;  3BVF A;  3HL1 A;  2CLU A;  1JGC A;  4ZTT A;  1OTK A;  3AJQ A;  3SID A;  3C21 A;  3N6O A;  4IWJ A;  3PVT A;  4RC6 B;  3PVR A;  5HJF A;  4TOA A;  2FG4 A;  4IXK A;  3RBC A;  2V2J A;  4W4K B;  2V2P A;  4EVD A;  3AK9 A;  3PW1 A;  5D8X A;  4ZL6 A;  3RD0 A;  4CYA A;  2HR5 A;  2Y3Q A;  4TW3 A;  1DVB A;  4ZKW A;  3KA9 A;  3JZ9 A;  4E40 A;  2FZF A;  3KA8 A;  4P18 A;  1LB3 A;  3F39 A;  4LYX A;  4MY7 A;  4AM4 A;  3PW8 A;  3A9Q A;  2AR0 A;  4DAS A;  2V2O A;  2W0O A;  2JD7 0;  3VVA A;  3R2O A;  3WVU A;  2VXX A;  4LYU A;  2CLB A;  5FFB A;  2ZA8 A;  3UOF A;  1HRS A;  4PGK A;  4LQJ A;  2G38 B;  2F7N A;  4EVB A;  1F30 A;  2CEI A;  3E1N A;  3PWQ A;  5D8S A;  4KVS A;  4II4 A;  1L8I A;  3R2H A;  3WNW A;  2IB0 A;  2GS4 A;  3QZ3 A;  4OYN A;  2IY4 A;  1IER A;  3GHQ A;  1LKO A;  2JD8 0;  2XJM A;  5CZU A;  2CF7 A;  3PVT B;  1ZUJ A;  3PVR B;  3Q4N A;  2ZG9 X;  3E1J A;  3V3K B;  2ZG8 X;  4U3G A;  5FFA A;  5LG8 A;  1N1Q A;  3PW1 B;  5J9V A;  3FSE A;  3BVE A;  3C1Z A;  4RC8 A;  3H7G A;  1VEQ A;  5LG2 A;  2VXI A;  4XKT A;  4WJG 4;  4RC7 A;  1H96 A;  2V2S A;  1DAT A;  2GYD A;  5J8S A;  5FFC A;  3W54 A;  2N02 A;  4IWK A;  4YXJ A;  3DBY A;  4ZMC A;  3BKN A;  3L0M A;  4CMY V;  1NF4 A;  4CYB A;  5GU3 X;  1JYB A;  5IX6 A;  4DI0 A;  3KA6 A;  2Z5P A;  5GU1 X;  3OGH A;  4ISP A;  4XKU A;  4DYY A;  2Z6M A;  3ISE A;  4II4 B;  3AF7 X;  4ZKH A;  5HQO A;  3KX9 A;  5D8R A;  5C6F A;  2Z90 A;  3ES3 A;  2XKQ A;  2UX1 A;  2WTL A;  1O9R A;  3GE4 A;  4M33 A;  3IQ1 A;  4CY9 A;  3BVL A;  1UMN A;  2XJO A;  4PGI A;  1QGH A;  5D8Q A;  5K53 A;  5FFE A;  2Z5R A;  1RCD A;  4Y08 A;  2VZB A;  4QUW A;  1XZ1 A;  3FRR A;  3R2L A;  3SHX A;  2ZA7 A;  4LQN A;  1B71 A;  3PVY A;  5JKL A;  3KA4 A;  4M34 A;  1XZ3 A;  4RC7 B;  1RCC A;  3Q4R A;  4CVS A;  2WWX B;  3VV9 A;  5HJH A;  3EZU A;  3C1Y A;  4XKS A;  1YV1 A;  2CN6 A;  1J30 A;  4DYU A;  5CMR A;  4ETR A;  4TOH A;  3UFB A;  4DZ0 A;  3PZA A;  2WLA A;  1RCE A;  3KA3 A;  1L8H A;  2V2M A;  1MOJ A;  3KWO A;  4TO9 A;  1NFV A;  3FRS A;  5HU6 D;  2PYB A;  3A68 A;  1JI4 A;  5ERJ A;  3M6J A;  5LS9 A;  3WVW A;  3PW8 C;  4MKU A;  4PG1 A;  2FFX J;  3WVV A;  3NP2 X;  2XJN A;  3E1P A;  3Q4O A;  4TOF A;  2ZG7 X;  4MUD A;  2CHI A;  1LKM A;  3BVI A;  3QD8 A;  1O9I A;  1JI5 A;  1TKO A;  4M35 A;  4CVP A;  3QVD A;  3FI6 A;  1JIG A;  2G4H A;  3NOZ X;  1RYT A;  3E6R A;  3RE7 A;  1VEI A;  3F34 A;  3PWQ C;  3PVY B;  4LPN A;  4LPJ A;  1VLG A;  2C2J A;  2YW7 A;  1S2Z A;  1SOF A;  4REU A;  5K52 A;  4CMY A;  5E2D A;  3F36 A;  2BW1 A;  4A25 A;  4E6K A;  3E1Q A;  2XGW A;  4LQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...