3E1NA

Crystal structure of e. coli bacterioferritin (bfr) after a 65 minute (aerobic) exposure to fe(ii) revealing a possible mu-oxo bridge/mu-hydroxy bridged diiron intermediate at the ferroxidase centre. (fe(iii)-o-fe(iii)-bfr).
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
156
structure length
156
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIOFERRITIN
publication title Structural basis for iron mineralization by bacterioferritin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 73
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e1nA00
3RAVA 2WLUA 2BK6A 1HRSA 4CY9A 5ERKA 4PG0A 5LG8A 5ERJA 2V2MA 1Z4AA 4EVEA 3F36A 4Y08A 4MUDA 3QB9A 4REUA 5D8QA 4M35A 5AXSA 3NP0X 1MFRA 2YW7A 4CYBA 3PW1A 5D8XA 2HTNA 3E6SA 4TO9A 1O9RA 3R2RA 2JD60 3Q4RA 5K53A 3PVYB 3KA4A 2C2JA 5FEJA 4ITWA 2V2IA 4RC8A 1Z6OM 4CMYV 1N1QA 3AK9A 1Z6OA 4PGIA 3NOZX 2IY4A 3PWQC 1ZS3A 2WTLA 4KVRA 1TKOA 5FFAA 2CLUA 4MN9A 2Y3QA 1ZUJA 4U3GA 3AK8A 1NF6A 2BJYA 2W0OA 4OYNA 3QZ3A 3PVTB 4MKUA 2V2OA 5GOUA 1QYBA 2OH3A 4RC6B 1RCIA 4AM5A 3QVDA 5FFBA 2YJJA 3E1JA 5J9VA 4YKHA 3GHQA 3R2OA 5GU0X 3FSEA 3ISFA 1JKVA 2BKCA 4DYZA 2V2LA 4LYUA 2YW6A 2ITBA 4ML5A 1JREA 3ISEA 3EZUA 1JKUA 5D8YA 4TOHA 2C6RA 3A9QA 1RCEA 2V2JA 1OTKA 3E1LA 4MY7A 4Z3BA 3NP2X 4LPNA 4II4B 4RC5A 3E1MA 3E6RA 1VLGA 1LKMA 5GU2X 1NF4A 3HL1A 3O7SA 3R2SA 1DATA 4P18A 1H96A 3E1OA 2Z90A 3AF7X 5K52A 1B71A 1J30A 4LQVA 2QQYA 1DVBA 3QHBA 3UOFA 4Z5SA 1F30A 4TOAA 3BVFA 3H7GA 4ISPA 4IXKA 3R2LA 3F34A 2C2UA 2PYBA 3F35A 3RBCA 4QUWA 4ISMA 1JI4A 3F38A 2FHAA 3R2KA 5E2DA 4M34A 5JACA 1S3QA 3BVLA 1NNQA 3GE4A 5I4JA 3RD0A 3ERZA 4ZL6A 2JD70 3WNWA 2XJNA 3ES3A 3UOIA 4CVSA 3E1QA 3PVYA 1UMNA 4DE6A 4CYAA 4CVRA 5JKMG 5JKMA 3KA3A 4ZTTA 1RCGA 1FHAA 4AM2A 3PW1B 2X170 2CN6A 2V2NA 1JTSA 2F7NA 2CLBA 5FFDA 2XKQA 4PG1A 2BW1A 3EGMA 3UNOA 2OC5A 3PZAA 4E6KA 3IS8A 5FFEA 4LQNA 3BVKA 1RCCA 1JGCA 5GN8A 2FJCA 1IERA 1AEWA 2D5KA 4LYXA 4RC6A 4PGKA 2CF7A 4ZKHA 3AJPA 2WLAA 3GVYA 2ZA7A 2CHPA 5D8PA 4ZMCA 4ETRA 4KVSA 4RC7A 1L8HA 4DZ0A 5HQOA 2QF9A 1BG7A 4CVPA 2FKZA 5D8OA 5HJHA 4II4A 2V2PA 3QHCA 2CIHA 5GU3X 5D8RA 3EZ0A 4TW3A 5CZUA 4ZLWA 5JKLG 4M32A 1QGHA 3PVRB 3FVBA 3IQ1A 2C41A 2XGWA 2G4HA 2V2RA 1YUZA 1RCDA 3F33A 3R2HA 1YUXA 4EVCA 2HR5A 4MJYA 2VZBA 3F32A 2ZG8X 4A25A 2GYDA 4TOFA 2RBDA 1VELA 4IWJA 3SHXA 2CHIA 3KX9A 3PW8A 3PWFA 2JD80 3O7RA 3WVVA 5LG2A 3KA9A 1JIGA 1O9IA 4TOGA 4LQJA 4TOCA 4DI0A 3IS7A 1S2ZA 1TK6A 2ZURX 4TOBA 1DPSA 5GU1X 1IESA 4ZKWA 2IU2A 1XZ1A 1BFRA 1BCFA 3FI6A 5FFCA 2XJMA 3QD8A 2Z5PA 3AJQA 2ZA8A 3U90A 1YV1A 4ZL5A 5C6FA 3WVWA 3BKNA 3OJ5A 5J8SA 3KA6A 3A68A 4XKSA 1RYTA 2XJOA 2UX1A 4DYYA 4LQHA 1JYBA 1MOJA 1VEIA 2FFXJ 1JI5A 3HIUA 3E1NA 2Z5QA 5J93A 4DASA 1NFVA 4XGSA 5CMQA 1VJXA 1S30A 3AF8X 5LS9A 2VXXA 5IX6A 5E1UA 3TA8A 3RGDA 3PW8C 3PVTA 4AM4A 4ERUA 3BVIA 4DYXA 4XKUA 4M33A 3F39A 4ZJKA 3SE1A 3SH6A 1F33A 4CMYA 1LKPA 2FL0A 4CVTA 1EUMA 1GWGA 2IB0A 4IWKA 4XKTA 2FG8A 3OGHA 3VNXA 1VEQA 2Z5RA 4EVDA 2ZG9X 5GN8B 2ZA6A 3Q4NA 4ZKXA 3MPSA 1UVHA 4EVBA 3Q4QA 2ZG7X 1LKOA 1XZ3A 3E1PA 4R42A 3F37A 5CMRA 4RC7B 3BVEA 4LPJA 4TODA 2CEIA 3R2MA 2CN7A 3KA8A 5HJFA 5JKLA 5LBHA 4DYUA 2V2SA 3PVRA 5J8WA 2FG4A 3AJOA 3RE7A 1LB3A 3Q4OA 5D8SA 4LPMA 1L8IA 1TKPA 2VXIA 2Z6MA 1KRQA 4TOEA 4RC5B 3SIDA 2YJKA 1SQ3A 1R03A 2V15A 3BT5A 2FZFA 3E2CA 3KWOA 3AF9X 2GS4A 2C2FA 4KVQA 2GYQA 4ITTA 1SOFA 3KXUA 3PWQA 3T9JA 3WVUA 1TJOA
chains in the Genus database with same CATH superfamily
3JZAB 3RAVA 2WLUA 2BK6A 1HRSA 4CY9A 5ERKA 4PG0A 5LG8A 4E40A 5ERJA 2V2MA 1Z4AA 4EVEA 3F36A 4Y08A 4MUDA 4WJG4 3QB9A 4REUA 5D8QA 4M35A 5AXSA 3NP0X 1MFRA 2YW7A 4CYBA 3PW1A 5D8XA 2HTNA 3E6SA 4TO9A 1O9RA 3R2RA 2JD60 3Q4RA 5K53A 3PVYB 3KA4A 2C2JA 5FEJA 4ITWA 2V2IA 4RC8A 1Z6OM 4CMYV 1N1QA 3AK9A 1Z6OA 4PGIA 3NOZX 2IY4A 3PWQC 1ZS3A 2WTLA 4KVRA 1TKOA 5FFAA 3D19A 3FRRA 2CLUA 4MN9A 2Y3QA 1ZUJA 4U3GA 3AK8A 4KXRB 1NF6A 2BJYA 2W0OA 4OYNA 5JDOA 3QZ3A 3PVTB 2Y44A 4MKUA 2V2OA 5GOUA 1QYBA 2OKCA 4W4KB 2OH3A 4RC6B 1RCIA 2V8TA 4AM5A 3QVDA 5FFBA 2YJJA 3E1JA 5J9VA 4YKHA 3GHQA 3R2OA 5GU0X 3ISFA 3FSEA 1JKVA 2BKCA 3FRSA 4DYZA 2V2LA 4LYUA 2YW6A 2ITBA 4ML5A 1JREA 3ISEA 3EZUA 1JKUA 5D8YA 4TOHA 2C6RA 3A9QA 1RCEA 2V2JA 1OTKA 3E1LA 4MY7A 4Z3BA 3NP2X 4LPNA 4II4B 4RC5A 3E1MA 3E6RA 1VLGA 1LKMA 5GU2X 3GGYA 1NF4A 3HL1A 3O7SA 3R2SA 1DATA 4P18A 2MGYA 1H96A 3E1OA 2Z90A 3AF7X 5K52A 1B71A 1J30A 4LQVA 2QQYA 5HU6D 1DVBA 3QHBA 3UOFA 4Z5SA 1F30A 4TOAA 3BVFA 3H7GA 3N6OA 4ISPA 3VV9A 4IXKA 3R2LA 3F34A 2C2UA 2PYBA 3F35A 2N02A 3RBCA 4QUWA 4ISMA 1JI4A 3F38A 2FHAA 3R2KA 5E2DA 4M34A 5JACA 1S3QA 3BVLA 1NNQA 3GE4A 5I4JA 3RD0A 3ERZA 4ZL6A 2JD70 3WNWA 2XJNA 3ES3A 3UOIA 4CVSA 3E1QA 3PVYA 3GGZA 1UMNA 4DE6A 4CYAA 4YXJA 4CVRA 5JKMG 5JKMA 3KA3A 4ZTTA 1RCGA 3DBYA 1FHAA 4AM2A 3PW1B 2X170 2CN6A 3C1YA 2V2NA 1JTSA 2WWXB 2F7NA 4W4LB 2CLBA 5FFDA 2XKQA 4PG1A 2BW1A 3EGMA 3UNOA 2OC5A 3PZAA 4E6KA 3IS8A 5FFEA 4LQNA 3BVKA 1RCCA 1JGCA 5GN8A 2FJCA 1IERA 1AEWA 2D5KA 4LYXA 4RC6A 4PGKA 2CF7A 4ZKHA 3AJPA 2WLAA 3GVYA 2ZA7A 2CHPA 5D8PA 4ZMCA 3UFBA 4ETRA 4KVSA 4RC7A 1L8HA 4DZ0A 5HQOA 2QF9A 1BG7A 4CVPA 2G38B 2FKZA 5D8OA 5HJHA 4II4A 2V2PA 3QHCA 2CIHA 5GU3X 5D8RA 3EZ0A 4TW3A 5CZUA 4ZLWA 5JKLG 4M32A 1QGHA 3PVRB 3FVBA 3C21A 3IQ1A 2C41A 2XGWA 2G4HA 2V2RA 1YUZA 1RCDA 3F33A 3R2HA 1YUXA 4EVCA 2HR5A 4MJYA 2VZBA 3F32A 2ZG8X 4A25A 2GYDA 4TOFA 2V8UA 2RBDA 1VELA 4IWJA 3SHXA 2CHIA 3KX9A 3PW8A 3PWFA 2JD80 3O7RA 3WVVA 5LG2A 3JZ9A 3KA9A 1JIGA 1O9IA 4TOGA 4LQJA 4TOCA 4DI0A 3IS7A 1S2ZA 1TK6A 2ZURX 4TOBA 1DPSA 5GU1X 1IESA 4ZKWA 2IU2A 1XZ1A 1BFRA 1BCFA 3FI6A 5FFCA 2XJMA 4YXMA 3QD8A 2Z5PA 3AJQA 2ZA8A 3U90A 1YV1A 4ZL5A 5C6FA 3WVWA 3BKNA 3OJ5A 5J8SA 3KA6A 4YVZA 3A68A 4XKSA 1RYTA 2XJOA 2UX1A 4DYYA 4LQHA 1JYBA 1MOJA 1VEIA 2FFXJ 1JI5A 3HIUA 3E1NA 2Z5QA 5J93A 4DASA 1NFVA 4XGSA 3VVAA 5CMQA 1VJXA 1S30A 3AF8X 5LS9A 2VXXA 5IX6A 5E1UA 3TA8A 2AR0A 3RGDA 3PW8C 3PVTA 4AM4A 4ERUA 3BVIA 3V3KB 4DYXA 4XKUA 4M33A 3F39A 4ZJKA 3SE1A 3SH6A 1F33A 4CMYA 1LKPA 2FL0A 4CVTA 1EUMA 1GWGA 2IB0A 4IWKA 4XKTA 2FG8A 4MXPA 5JDOB 3OGHA 3LKDA 3VNXA 1VEQA 2Z5RA 4EVDA 2ZG9X 5GN8B 4X0JA 2ZA6A 3Q4NA 3M6JA 4ZKXA 3MPSA 3KHKA 1UVHA 4EVBA 3Q4QA 2ZG7X 1LKOA 1XZ3A 3E1PA 4R42A 3F37A 5CMRA 4RC7B 3BVEA 4LPJA 4TODA 3W54A 2CEIA 3R2MA 2CN7A 3KA8A 5HJFA 3C23A 5JKLA 5LBHA 4DYUA 2V2SA 3PVRA 5J8WA 2FG4A 3AJOA 3RE7A 1LB3A 3KDQA 3Q4OA 5D8SA 4LPMA 1L8IA 1TKPA 2VXIA 2Z6MA 1KRQA 4TOEA 4RC5B 3SIDA 2YJKA 1SQ3A 1R03A 2V15A 3L0MA 2CWLA 3BT5A 2FZFA 3E2CA 3KWOA 3AF9X 2GS4A 2C2FA 4KVQA 2GYQA 4ITTA 1SOFA 3KXUA 3PWQA 3C1ZA 3T9JA 3WVUA 1TJOA
chains in the Genus database with same CATH topology
3JZAB 3RAVA 2WLUA 2BK6A 1HRSA 4CY9A 5ERKA 4PG0A 5LG8A 4E40A 5ERJA 2V2MA 1Z4AA 4EVEA 3F36A 4Y08A 4MUDA 4WJG4 3QB9A 4REUA 5D8QA 4M35A 5AXSA 3NP0X 1MFRA 2YW7A 4CYBA 3PW1A 5D8XA 2HTNA 3E6SA 4TO9A 1O9RA 3R2RA 2JD60 3Q4RA 5K53A 3PVYB 3KA4A 2C2JA 5FEJA 4ITWA 2V2IA 4RC8A 1Z6OM 4CMYV 1N1QA 3AK9A 1Z6OA 4PGIA 3NOZX 2IY4A 3PWQC 1ZS3A 2WTLA 4KVRA 1TKOA 5FFAA 3D19A 3FRRA 2CLUA 4MN9A 2Y3QA 1ZUJA 4U3GA 3AK8A 4KXRB 1NF6A 2BJYA 2W0OA 4OYNA 5JDOA 3QZ3A 3PVTB 2Y44A 4MKUA 2V2OA 5GOUA 1QYBA 2OKCA 4W4KB 2OH3A 4RC6B 1RCIA 2V8TA 4AM5A 3QVDA 5FFBA 2YJJA 3E1JA 5J9VA 4YKHA 3GHQA 3R2OA 5GU0X 3ISFA 3FSEA 1JKVA 2BKCA 3FRSA 4DYZA 2V2LA 4LYUA 2YW6A 2ITBA 4ML5A 1JREA 3ISEA 3EZUA 1JKUA 5D8YA 4TOHA 2C6RA 3A9QA 1RCEA 2V2JA 1OTKA 3E1LA 4MY7A 4Z3BA 3NP2X 4LPNA 4II4B 4RC5A 3E1MA 3E6RA 1VLGA 1LKMA 5GU2X 3GGYA 1NF4A 3HL1A 3O7SA 3R2SA 1DATA 4P18A 2MGYA 1H96A 3E1OA 2Z90A 3AF7X 5K52A 1B71A 1J30A 4LQVA 2QQYA 5HU6D 1DVBA 3QHBA 3UOFA 4Z5SA 1F30A 4TOAA 3BVFA 3H7GA 3N6OA 4ISPA 3VV9A 4IXKA 3R2LA 3F34A 2C2UA 2PYBA 3F35A 2N02A 3RBCA 4QUWA 4ISMA 1JI4A 3F38A 2FHAA 3R2KA 5E2DA 4M34A 5JACA 1S3QA 3BVLA 1NNQA 3GE4A 5I4JA 3RD0A 3ERZA 4ZL6A 2JD70 3WNWA 2XJNA 3ES3A 3UOIA 4CVSA 3E1QA 3PVYA 3GGZA 1UMNA 4DE6A 4CYAA 4YXJA 4CVRA 5JKMG 5JKMA 3KA3A 4ZTTA 1RCGA 3DBYA 1FHAA 4AM2A 3PW1B 2X170 2CN6A 3C1YA 2V2NA 1JTSA 2WWXB 2F7NA 4W4LB 2CLBA 5FFDA 2XKQA 4PG1A 2BW1A 3EGMA 3UNOA 2OC5A 3PZAA 4E6KA 3IS8A 5FFEA 4LQNA 3BVKA 1RCCA 1JGCA 5GN8A 2FJCA 1IERA 1AEWA 2D5KA 4LYXA 4RC6A 4PGKA 2CF7A 4ZKHA 3AJPA 2WLAA 3GVYA 2ZA7A 2CHPA 5D8PA 4ZMCA 3UFBA 4ETRA 4KVSA 4RC7A 1L8HA 4DZ0A 5HQOA 2QF9A 1BG7A 4CVPA 2G38B 2FKZA 5D8OA 5HJHA 4II4A 2V2PA 3QHCA 2CIHA 5GU3X 5D8RA 3EZ0A 4TW3A 5CZUA 4ZLWA 5JKLG 4M32A 1QGHA 3PVRB 3FVBA 3C21A 3IQ1A 2C41A 2XGWA 2G4HA 2V2RA 1YUZA 1RCDA 3F33A 3R2HA 1YUXA 4EVCA 2HR5A 4MJYA 2VZBA 3F32A 2ZG8X 4A25A 2GYDA 4TOFA 2V8UA 2RBDA 1VELA 4IWJA 3SHXA 2CHIA 3KX9A 3PW8A 3PWFA 2JD80 3O7RA 3WVVA 5LG2A 3JZ9A 3KA9A 1JIGA 1O9IA 4TOGA 4LQJA 4TOCA 4DI0A 3IS7A 1S2ZA 1TK6A 2ZURX 4TOBA 1DPSA 5GU1X 1IESA 4ZKWA 2IU2A 1XZ1A 1BFRA 1BCFA 3FI6A 5FFCA 2XJMA 4YXMA 3QD8A 2Z5PA 3AJQA 2ZA8A 3U90A 1YV1A 4ZL5A 5C6FA 3WVWA 3BKNA 3OJ5A 5J8SA 3KA6A 4YVZA 3A68A 4XKSA 1RYTA 2XJOA 2UX1A 4DYYA 4LQHA 1JYBA 1MOJA 1VEIA 2FFXJ 1JI5A 3HIUA 3E1NA 2Z5QA 5J93A 4DASA 1NFVA 4XGSA 3VVAA 5CMQA 1VJXA 1S30A 3AF8X 5LS9A 2VXXA 5IX6A 5E1UA 3TA8A 2AR0A 3RGDA 3PW8C 3PVTA 4AM4A 4ERUA 3BVIA 3V3KB 4DYXA 4XKUA 4M33A 3F39A 4ZJKA 3SE1A 3SH6A 1F33A 4CMYA 1LKPA 2FL0A 4CVTA 1EUMA 1GWGA 2IB0A 4IWKA 4XKTA 2FG8A 4MXPA 5JDOB 3OGHA 3LKDA 3VNXA 1VEQA 2Z5RA 4EVDA 2ZG9X 5GN8B 4X0JA 2ZA6A 3Q4NA 3M6JA 4ZKXA 3MPSA 3KHKA 1UVHA 4EVBA 3Q4QA 2ZG7X 1LKOA 1XZ3A 3E1PA 4R42A 3F37A 5CMRA 4RC7B 3BVEA 4LPJA 4TODA 3W54A 2CEIA 3R2MA 2CN7A 3KA8A 5HJFA 3C23A 5JKLA 5LBHA 4DYUA 2V2SA 3PVRA 5J8WA 2FG4A 3AJOA 3RE7A 1LB3A 3KDQA 3Q4OA 5D8SA 4LPMA 1L8IA 1TKPA 2VXIA 2Z6MA 1KRQA 4TOEA 4RC5B 3SIDA 2YJKA 1SQ3A 1R03A 2V15A 3L0MA 2CWLA 3BT5A 2FZFA 3E2CA 3KWOA 3AF9X 2GS4A 2C2FA 4KVQA 2GYQA 4ITTA 1SOFA 3KXUA 3PWQA 3C1ZA 3T9JA 3WVUA 1TJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RAV A;  2WLU A;  2BK6 A;  1HRS A;  4CY9 A;  5ERK A;  4PG0 A;  5LG8 A;  5ERJ A;  2V2M A;  1Z4A A;  4EVE A;  3F36 A;  4Y08 A;  4MUD A;  3QB9 A;  4REU A;  5D8Q A;  4M35 A;  5AXS A;  3NP0 X;  1MFR A;  2YW7 A;  4CYB A;  3PW1 A;  5D8X A;  2HTN A;  3E6S A;  4TO9 A;  1O9R A;  3R2R A;  2JD6 0;  3Q4R A;  5K53 A;  3PVY B;  3KA4 A;  2C2J A;  5FEJ A;  4ITW A;  2V2I A;  4RC8 A;  1Z6O M;  4CMY V;  1N1Q A;  3AK9 A;  1Z6O A;  4PGI A;  3NOZ X;  2IY4 A;  3PWQ C;  1ZS3 A;  2WTL A;  4KVR A;  1TKO A;  5FFA A;  2CLU A;  4MN9 A;  2Y3Q A;  1ZUJ A;  4U3G A;  3AK8 A;  1NF6 A;  2BJY A;  2W0O A;  4OYN A;  3QZ3 A;  3PVT B;  4MKU A;  2V2O A;  5GOU A;  1QYB A;  2OH3 A;  4RC6 B;  1RCI A;  4AM5 A;  3QVD A;  5FFB A;  2YJJ A;  3E1J A;  5J9V A;  4YKH A;  3GHQ A;  3R2O A;  5GU0 X;  3FSE A;  3ISF A;  1JKV A;  2BKC A;  4DYZ A;  2V2L A;  4LYU A;  2YW6 A;  2ITB A;  4ML5 A;  1JRE A;  3ISE A;  3EZU A;  1JKU A;  5D8Y A;  4TOH A;  2C6R A;  3A9Q A;  1RCE A;  2V2J A;  1OTK A;  3E1L A;  4MY7 A;  4Z3B A;  3NP2 X;  4LPN A;  4II4 B;  4RC5 A;  3E1M A;  3E6R A;  1VLG A;  1LKM A;  5GU2 X;  1NF4 A;  3HL1 A;  3O7S A;  3R2S A;  1DAT A;  4P18 A;  1H96 A;  3E1O A;  2Z90 A;  3AF7 X;  5K52 A;  1B71 A;  1J30 A;  4LQV A;  2QQY A;  1DVB A;  3QHB A;  3UOF A;  4Z5S A;  1F30 A;  4TOA A;  3BVF A;  3H7G A;  4ISP A;  4IXK A;  3R2L A;  3F34 A;  2C2U A;  2PYB A;  3F35 A;  3RBC A;  4QUW A;  4ISM A;  1JI4 A;  3F38 A;  2FHA A;  3R2K A;  5E2D A;  4M34 A;  5JAC A;  1S3Q A;  3BVL A;  1NNQ A;  3GE4 A;  5I4J A;  3RD0 A;  3ERZ A;  4ZL6 A;  2JD7 0;  3WNW A;  2XJN A;  3ES3 A;  3UOI A;  4CVS A;  3E1Q A;  3PVY A;  1UMN A;  4DE6 A;  4CYA A;  4CVR A;  5JKM G;  5JKM A;  3KA3 A;  4ZTT A;  1RCG A;  1FHA A;  4AM2 A;  3PW1 B;  2X17 0;  2CN6 A;  2V2N A;  1JTS A;  2F7N A;  2CLB A;  5FFD A;  2XKQ A;  4PG1 A;  2BW1 A;  3EGM A;  3UNO A;  2OC5 A;  3PZA A;  4E6K A;  3IS8 A;  5FFE A;  4LQN A;  3BVK A;  1RCC A;  1JGC A;  5GN8 A;  2FJC A;  1IER A;  1AEW A;  2D5K A;  4LYX A;  4RC6 A;  4PGK A;  2CF7 A;  4ZKH A;  3AJP A;  2WLA A;  3GVY A;  2ZA7 A;  2CHP A;  5D8P A;  4ZMC A;  4ETR A;  4KVS A;  4RC7 A;  1L8H A;  4DZ0 A;  5HQO A;  2QF9 A;  1BG7 A;  4CVP A;  2FKZ A;  5D8O A;  5HJH A;  4II4 A;  2V2P A;  3QHC A;  2CIH A;  5GU3 X;  5D8R A;  3EZ0 A;  4TW3 A;  5CZU A;  4ZLW A;  5JKL G;  4M32 A;  1QGH A;  3PVR B;  3FVB A;  3IQ1 A;  2C41 A;  2XGW A;  2G4H A;  2V2R A;  1YUZ A;  1RCD A;  3F33 A;  3R2H A;  1YUX A;  4EVC A;  2HR5 A;  4MJY A;  2VZB A;  3F32 A;  2ZG8 X;  4A25 A;  2GYD A;  4TOF A;  2RBD A;  1VEL A;  4IWJ A;  3SHX A;  2CHI A;  3KX9 A;  3PW8 A;  3PWF A;  2JD8 0;  3O7R A;  3WVV A;  5LG2 A;  3KA9 A;  1JIG A;  1O9I A;  4TOG A;  4LQJ A;  4TOC A;  4DI0 A;  3IS7 A;  1S2Z A;  1TK6 A;  2ZUR X;  4TOB A;  1DPS A;  5GU1 X;  1IES A;  4ZKW A;  2IU2 A;  1XZ1 A;  1BFR A;  1BCF A;  3FI6 A;  5FFC A;  2XJM A;  3QD8 A;  2Z5P A;  3AJQ A;  2ZA8 A;  3U90 A;  1YV1 A;  4ZL5 A;  5C6F A;  3WVW A;  3BKN A;  3OJ5 A;  5J8S A;  3KA6 A;  3A68 A;  4XKS A;  1RYT A;  2XJO A;  2UX1 A;  4DYY A;  4LQH A;  1JYB A;  1MOJ A;  1VEI A;  2FFX J;  1JI5 A;  3HIU A;  3E1N A;  2Z5Q A;  5J93 A;  4DAS A;  1NFV A;  4XGS A;  5CMQ A;  1VJX A;  1S30 A;  3AF8 X;  5LS9 A;  2VXX A;  5IX6 A;  5E1U A;  3TA8 A;  3RGD A;  3PW8 C;  3PVT A;  4AM4 A;  4ERU A;  3BVI A;  4DYX A;  4XKU A;  4M33 A;  3F39 A;  4ZJK A;  3SE1 A;  3SH6 A;  1F33 A;  4CMY A;  1LKP A;  2FL0 A;  4CVT A;  1EUM A;  1GWG A;  2IB0 A;  4IWK A;  4XKT A;  2FG8 A;  3OGH A;  3VNX A;  1VEQ A;  2Z5R A;  4EVD A;  2ZG9 X;  5GN8 B;  2ZA6 A;  3Q4N A;  4ZKX A;  3MPS A;  1UVH A;  4EVB A;  3Q4Q A;  2ZG7 X;  1LKO A;  1XZ3 A;  3E1P A;  4R42 A;  3F37 A;  5CMR A;  4RC7 B;  3BVE A;  4LPJ A;  4TOD A;  2CEI A;  3R2M A;  2CN7 A;  3KA8 A;  5HJF A;  5JKL A;  5LBH A;  4DYU A;  2V2S A;  3PVR A;  5J8W A;  2FG4 A;  3AJO A;  3RE7 A;  1LB3 A;  3Q4O A;  5D8S A;  4LPM A;  1L8I A;  1TKP A;  2VXI A;  2Z6M A;  1KRQ A;  4TOE A;  4RC5 B;  3SID A;  2YJK A;  1SQ3 A;  1R03 A;  2V15 A;  3BT5 A;  2FZF A;  3E2C A;  3KWO A;  3AF9 X;  2GS4 A;  2C2F A;  4KVQ A;  2GYQ A;  4ITT A;  1SOF A;  3KXU A;  3PWQ A;  3T9J A;  3WVU A;  1TJO A; 
#chains in the Genus database with same CATH topology
 3JZA B;  3RAV A;  2WLU A;  2BK6 A;  1HRS A;  4CY9 A;  5ERK A;  4PG0 A;  5LG8 A;  4E40 A;  5ERJ A;  2V2M A;  1Z4A A;  4EVE A;  3F36 A;  4Y08 A;  4MUD A;  4WJG 4;  3QB9 A;  4REU A;  5D8Q A;  4M35 A;  5AXS A;  3NP0 X;  1MFR A;  2YW7 A;  4CYB A;  3PW1 A;  5D8X A;  2HTN A;  3E6S A;  4TO9 A;  1O9R A;  3R2R A;  2JD6 0;  3Q4R A;  5K53 A;  3PVY B;  3KA4 A;  2C2J A;  5FEJ A;  4ITW A;  2V2I A;  4RC8 A;  1Z6O M;  4CMY V;  1N1Q A;  3AK9 A;  1Z6O A;  4PGI A;  3NOZ X;  2IY4 A;  3PWQ C;  1ZS3 A;  2WTL A;  4KVR A;  1TKO A;  5FFA A;  3D19 A;  3FRR A;  2CLU A;  4MN9 A;  2Y3Q A;  1ZUJ A;  4U3G A;  3AK8 A;  4KXR B;  1NF6 A;  2BJY A;  2W0O A;  4OYN A;  5JDO A;  3QZ3 A;  3PVT B;  2Y44 A;  4MKU A;  2V2O A;  5GOU A;  1QYB A;  2OKC A;  4W4K B;  2OH3 A;  4RC6 B;  1RCI A;  2V8T A;  4AM5 A;  3QVD A;  5FFB A;  2YJJ A;  3E1J A;  5J9V A;  4YKH A;  3GHQ A;  3R2O A;  5GU0 X;  3ISF A;  3FSE A;  1JKV A;  2BKC A;  3FRS A;  4DYZ A;  2V2L A;  4LYU A;  2YW6 A;  2ITB A;  4ML5 A;  1JRE A;  3ISE A;  3EZU A;  1JKU A;  5D8Y A;  4TOH A;  2C6R A;  3A9Q A;  1RCE A;  2V2J A;  1OTK A;  3E1L A;  4MY7 A;  4Z3B A;  3NP2 X;  4LPN A;  4II4 B;  4RC5 A;  3E1M A;  3E6R A;  1VLG A;  1LKM A;  5GU2 X;  3GGY A;  1NF4 A;  3HL1 A;  3O7S A;  3R2S A;  1DAT A;  4P18 A;  2MGY A;  1H96 A;  3E1O A;  2Z90 A;  3AF7 X;  5K52 A;  1B71 A;  1J30 A;  4LQV A;  2QQY A;  5HU6 D;  1DVB A;  3QHB A;  3UOF A;  4Z5S A;  1F30 A;  4TOA A;  3BVF A;  3H7G A;  3N6O A;  4ISP A;  3VV9 A;  4IXK A;  3R2L A;  3F34 A;  2C2U A;  2PYB A;  3F35 A;  2N02 A;  3RBC A;  4QUW A;  4ISM A;  1JI4 A;  3F38 A;  2FHA A;  3R2K A;  5E2D A;  4M34 A;  5JAC A;  1S3Q A;  3BVL A;  1NNQ A;  3GE4 A;  5I4J A;  3RD0 A;  3ERZ A;  4ZL6 A;  2JD7 0;  3WNW A;  2XJN A;  3ES3 A;  3UOI A;  4CVS A;  3E1Q A;  3PVY A;  3GGZ A;  1UMN A;  4DE6 A;  4CYA A;  4YXJ A;  4CVR A;  5JKM G;  5JKM A;  3KA3 A;  4ZTT A;  1RCG A;  3DBY A;  1FHA A;  4AM2 A;  3PW1 B;  2X17 0;  2CN6 A;  3C1Y A;  2V2N A;  1JTS A;  2WWX B;  2F7N A;  4W4L B;  2CLB A;  5FFD A;  2XKQ A;  4PG1 A;  2BW1 A;  3EGM A;  3UNO A;  2OC5 A;  3PZA A;  4E6K A;  3IS8 A;  5FFE A;  4LQN A;  3BVK A;  1RCC A;  1JGC A;  5GN8 A;  2FJC A;  1IER A;  1AEW A;  2D5K A;  4LYX A;  4RC6 A;  4PGK A;  2CF7 A;  4ZKH A;  3AJP A;  2WLA A;  3GVY A;  2ZA7 A;  2CHP A;  5D8P A;  4ZMC A;  3UFB A;  4ETR A;  4KVS A;  4RC7 A;  1L8H A;  4DZ0 A;  5HQO A;  2QF9 A;  1BG7 A;  4CVP A;  2G38 B;  2FKZ A;  5D8O A;  5HJH A;  4II4 A;  2V2P A;  3QHC A;  2CIH A;  5GU3 X;  5D8R A;  3EZ0 A;  4TW3 A;  5CZU A;  4ZLW A;  5JKL G;  4M32 A;  1QGH A;  3PVR B;  3FVB A;  3C21 A;  3IQ1 A;  2C41 A;  2XGW A;  2G4H A;  2V2R A;  1YUZ A;  1RCD A;  3F33 A;  3R2H A;  1YUX A;  4EVC A;  2HR5 A;  4MJY A;  2VZB A;  3F32 A;  2ZG8 X;  4A25 A;  2GYD A;  4TOF A;  2V8U A;  2RBD A;  1VEL A;  4IWJ A;  3SHX A;  2CHI A;  3KX9 A;  3PW8 A;  3PWF A;  2JD8 0;  3O7R A;  3WVV A;  5LG2 A;  3JZ9 A;  3KA9 A;  1JIG A;  1O9I A;  4TOG A;  4LQJ A;  4TOC A;  4DI0 A;  3IS7 A;  1S2Z A;  1TK6 A;  2ZUR X;  4TOB A;  1DPS A;  5GU1 X;  1IES A;  4ZKW A;  2IU2 A;  1XZ1 A;  1BFR A;  1BCF A;  3FI6 A;  5FFC A;  2XJM A;  4YXM A;  3QD8 A;  2Z5P A;  3AJQ A;  2ZA8 A;  3U90 A;  1YV1 A;  4ZL5 A;  5C6F A;  3WVW A;  3BKN A;  3OJ5 A;  5J8S A;  3KA6 A;  4YVZ A;  3A68 A;  4XKS A;  1RYT A;  2XJO A;  2UX1 A;  4DYY A;  4LQH A;  1JYB A;  1MOJ A;  1VEI A;  2FFX J;  1JI5 A;  3HIU A;  3E1N A;  2Z5Q A;  5J93 A;  4DAS A;  1NFV A;  4XGS A;  3VVA A;  5CMQ A;  1VJX A;  1S30 A;  3AF8 X;  5LS9 A;  2VXX A;  5IX6 A;  5E1U A;  3TA8 A;  2AR0 A;  3RGD A;  3PW8 C;  3PVT A;  4AM4 A;  4ERU A;  3BVI A;  3V3K B;  4DYX A;  4XKU A;  4M33 A;  3F39 A;  4ZJK A;  3SE1 A;  3SH6 A;  1F33 A;  4CMY A;  1LKP A;  2FL0 A;  4CVT A;  1EUM A;  1GWG A;  2IB0 A;  4IWK A;  4XKT A;  2FG8 A;  4MXP A;  5JDO B;  3OGH A;  3LKD A;  3VNX A;  1VEQ A;  2Z5R A;  4EVD A;  2ZG9 X;  5GN8 B;  4X0J A;  2ZA6 A;  3Q4N A;  3M6J A;  4ZKX A;  3MPS A;  3KHK A;  1UVH A;  4EVB A;  3Q4Q A;  2ZG7 X;  1LKO A;  1XZ3 A;  3E1P A;  4R42 A;  3F37 A;  5CMR A;  4RC7 B;  3BVE A;  4LPJ A;  4TOD A;  3W54 A;  2CEI A;  3R2M A;  2CN7 A;  3KA8 A;  5HJF A;  3C23 A;  5JKL A;  5LBH A;  4DYU A;  2V2S A;  3PVR A;  5J8W A;  2FG4 A;  3AJO A;  3RE7 A;  1LB3 A;  3KDQ A;  3Q4O A;  5D8S A;  4LPM A;  1L8I A;  1TKP A;  2VXI A;  2Z6M A;  1KRQ A;  4TOE A;  4RC5 B;  3SID A;  2YJK A;  1SQ3 A;  1R03 A;  2V15 A;  3L0M A;  2CWL A;  3BT5 A;  2FZF A;  3E2C A;  3KWO A;  3AF9 X;  2GS4 A;  2C2F A;  4KVQ A;  2GYQ A;  4ITT A;  1SOF A;  3KXU A;  3PWQ A;  3C1Z A;  3T9J A;  3WVU A;  1TJO A; 
#chains in the Genus database with same CATH homology
 3JZA B;  3RAV A;  2WLU A;  2BK6 A;  1HRS A;  4CY9 A;  5ERK A;  4PG0 A;  5LG8 A;  4E40 A;  5ERJ A;  2V2M A;  1Z4A A;  4EVE A;  3F36 A;  4Y08 A;  4MUD A;  4WJG 4;  3QB9 A;  4REU A;  5D8Q A;  4M35 A;  5AXS A;  3NP0 X;  1MFR A;  2YW7 A;  4CYB A;  3PW1 A;  5D8X A;  2HTN A;  3E6S A;  4TO9 A;  1O9R A;  3R2R A;  2JD6 0;  3Q4R A;  5K53 A;  3PVY B;  3KA4 A;  2C2J A;  5FEJ A;  4ITW A;  2V2I A;  4RC8 A;  1Z6O M;  4CMY V;  1N1Q A;  3AK9 A;  1Z6O A;  4PGI A;  3NOZ X;  2IY4 A;  3PWQ C;  1ZS3 A;  2WTL A;  4KVR A;  1TKO A;  5FFA A;  3D19 A;  3FRR A;  2CLU A;  4MN9 A;  2Y3Q A;  1ZUJ A;  4U3G A;  3AK8 A;  4KXR B;  1NF6 A;  2BJY A;  2W0O A;  4OYN A;  5JDO A;  3QZ3 A;  3PVT B;  2Y44 A;  4MKU A;  2V2O A;  5GOU A;  1QYB A;  2OKC A;  4W4K B;  2OH3 A;  4RC6 B;  1RCI A;  2V8T A;  4AM5 A;  3QVD A;  5FFB A;  2YJJ A;  3E1J A;  5J9V A;  4YKH A;  3GHQ A;  3R2O A;  5GU0 X;  3ISF A;  3FSE A;  1JKV A;  2BKC A;  3FRS A;  4DYZ A;  2V2L A;  4LYU A;  2YW6 A;  2ITB A;  4ML5 A;  1JRE A;  3ISE A;  3EZU A;  1JKU A;  5D8Y A;  4TOH A;  2C6R A;  3A9Q A;  1RCE A;  2V2J A;  1OTK A;  3E1L A;  4MY7 A;  4Z3B A;  3NP2 X;  4LPN A;  4II4 B;  4RC5 A;  3E1M A;  3E6R A;  1VLG A;  1LKM A;  5GU2 X;  3GGY A;  1NF4 A;  3HL1 A;  3O7S A;  3R2S A;  1DAT A;  4P18 A;  2MGY A;  1H96 A;  3E1O A;  2Z90 A;  3AF7 X;  5K52 A;  1B71 A;  1J30 A;  4LQV A;  2QQY A;  5HU6 D;  1DVB A;  3QHB A;  3UOF A;  4Z5S A;  1F30 A;  4TOA A;  3BVF A;  3H7G A;  3N6O A;  4ISP A;  3VV9 A;  4IXK A;  3R2L A;  3F34 A;  2C2U A;  2PYB A;  3F35 A;  2N02 A;  3RBC A;  4QUW A;  4ISM A;  1JI4 A;  3F38 A;  2FHA A;  3R2K A;  5E2D A;  4M34 A;  5JAC A;  1S3Q A;  3BVL A;  1NNQ A;  3GE4 A;  5I4J A;  3RD0 A;  3ERZ A;  4ZL6 A;  2JD7 0;  3WNW A;  2XJN A;  3ES3 A;  3UOI A;  4CVS A;  3E1Q A;  3PVY A;  3GGZ A;  1UMN A;  4DE6 A;  4CYA A;  4YXJ A;  4CVR A;  5JKM G;  5JKM A;  3KA3 A;  4ZTT A;  1RCG A;  3DBY A;  1FHA A;  4AM2 A;  3PW1 B;  2X17 0;  2CN6 A;  3C1Y A;  2V2N A;  1JTS A;  2WWX B;  2F7N A;  4W4L B;  2CLB A;  5FFD A;  2XKQ A;  4PG1 A;  2BW1 A;  3EGM A;  3UNO A;  2OC5 A;  3PZA A;  4E6K A;  3IS8 A;  5FFE A;  4LQN A;  3BVK A;  1RCC A;  1JGC A;  5GN8 A;  2FJC A;  1IER A;  1AEW A;  2D5K A;  4LYX A;  4RC6 A;  4PGK A;  2CF7 A;  4ZKH A;  3AJP A;  2WLA A;  3GVY A;  2ZA7 A;  2CHP A;  5D8P A;  4ZMC A;  3UFB A;  4ETR A;  4KVS A;  4RC7 A;  1L8H A;  4DZ0 A;  5HQO A;  2QF9 A;  1BG7 A;  4CVP A;  2G38 B;  2FKZ A;  5D8O A;  5HJH A;  4II4 A;  2V2P A;  3QHC A;  2CIH A;  5GU3 X;  5D8R A;  3EZ0 A;  4TW3 A;  5CZU A;  4ZLW A;  5JKL G;  4M32 A;  1QGH A;  3PVR B;  3FVB A;  3C21 A;  3IQ1 A;  2C41 A;  2XGW A;  2G4H A;  2V2R A;  1YUZ A;  1RCD A;  3F33 A;  3R2H A;  1YUX A;  4EVC A;  2HR5 A;  4MJY A;  2VZB A;  3F32 A;  2ZG8 X;  4A25 A;  2GYD A;  4TOF A;  2V8U A;  2RBD A;  1VEL A;  4IWJ A;  3SHX A;  2CHI A;  3KX9 A;  3PW8 A;  3PWF A;  2JD8 0;  3O7R A;  3WVV A;  5LG2 A;  3JZ9 A;  3KA9 A;  1JIG A;  1O9I A;  4TOG A;  4LQJ A;  4TOC A;  4DI0 A;  3IS7 A;  1S2Z A;  1TK6 A;  2ZUR X;  4TOB A;  1DPS A;  5GU1 X;  1IES A;  4ZKW A;  2IU2 A;  1XZ1 A;  1BFR A;  1BCF A;  3FI6 A;  5FFC A;  2XJM A;  4YXM A;  3QD8 A;  2Z5P A;  3AJQ A;  2ZA8 A;  3U90 A;  1YV1 A;  4ZL5 A;  5C6F A;  3WVW A;  3BKN A;  3OJ5 A;  5J8S A;  3KA6 A;  4YVZ A;  3A68 A;  4XKS A;  1RYT A;  2XJO A;  2UX1 A;  4DYY A;  4LQH A;  1JYB A;  1MOJ A;  1VEI A;  2FFX J;  1JI5 A;  3HIU A;  3E1N A;  2Z5Q A;  5J93 A;  4DAS A;  1NFV A;  4XGS A;  3VVA A;  5CMQ A;  1VJX A;  1S30 A;  3AF8 X;  5LS9 A;  2VXX A;  5IX6 A;  5E1U A;  3TA8 A;  2AR0 A;  3RGD A;  3PW8 C;  3PVT A;  4AM4 A;  4ERU A;  3BVI A;  3V3K B;  4DYX A;  4XKU A;  4M33 A;  3F39 A;  4ZJK A;  3SE1 A;  3SH6 A;  1F33 A;  4CMY A;  1LKP A;  2FL0 A;  4CVT A;  1EUM A;  1GWG A;  2IB0 A;  4IWK A;  4XKT A;  2FG8 A;  4MXP A;  5JDO B;  3OGH A;  3LKD A;  3VNX A;  1VEQ A;  2Z5R A;  4EVD A;  2ZG9 X;  5GN8 B;  4X0J A;  2ZA6 A;  3Q4N A;  3M6J A;  4ZKX A;  3MPS A;  3KHK A;  1UVH A;  4EVB A;  3Q4Q A;  2ZG7 X;  1LKO A;  1XZ3 A;  3E1P A;  4R42 A;  3F37 A;  5CMR A;  4RC7 B;  3BVE A;  4LPJ A;  4TOD A;  3W54 A;  2CEI A;  3R2M A;  2CN7 A;  3KA8 A;  5HJF A;  3C23 A;  5JKL A;  5LBH A;  4DYU A;  2V2S A;  3PVR A;  5J8W A;  2FG4 A;  3AJO A;  3RE7 A;  1LB3 A;  3KDQ A;  3Q4O A;  5D8S A;  4LPM A;  1L8I A;  1TKP A;  2VXI A;  2Z6M A;  1KRQ A;  4TOE A;  4RC5 B;  3SID A;  2YJK A;  1SQ3 A;  1R03 A;  2V15 A;  3L0M A;  2CWL A;  3BT5 A;  2FZF A;  3E2C A;  3KWO A;  3AF9 X;  2GS4 A;  2C2F A;  4KVQ A;  2GYQ A;  4ITT A;  1SOF A;  3KXU A;  3PWQ A;  3C1Z A;  3T9J A;  3WVU A;  1TJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...