3E1PA

Crystal structure of e. coli bacterioferritin (bfr) in which the ferroxidase centre is inhibited with zn(ii) and high occupancy iron is bound within the cavity.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords BACTERIOFERRITIN
publication title Structural basis for iron mineralization by bacterioferritin
pubmed doi rcsb
source organism Escherichia coli
total genus 72
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e1pA00
4ZL6A 1O9IA 1NF6A 3BT5A 1EUMA 2VXXA 1Z6OM 4LPNA 5GU0X 1B71A 3BVIA 4IXKA 2BW1A 4OYNA 2YJJA 5CZUA 1RCIA 3IS8A 1BFRA 5ERJA 3KA3A 2JD70 4RC5A 1H96A 5GN8A 1ZUJA 5CMQA 1VEQA 4LQVA 3ES3A 5FFDA 4YKHA 5GOUA 4MJYA 5J8WA 4PG0A 4AM4A 4CYAA 2CN6A 3GHQA 5LG2A 3SE1A 2YJKA 3H7GA 3WVWA 2IU2A 2Z6MA 2WTLA 3TA8A 1DVBA 5ERKA 3NP0X 1SOFA 3E1OA 3AJPA 2QF9A 3R2OA 3F32A 2C2UA 1JKUA 3ISEA 4CVTA 2C2JA 3GE4A 1Z6OA 1S3QA 2FL0A 4XKTA 5D8QA 4TOEA 4Z3BA 2CEIA 4LPMA 4E6KA 3RBCA 1JI4A 1YUXA 2CF7A 2V2RA 3A68A 2W0OA 3OJ5A 5D8OA 2JD80 2V2SA 5D8XA 4RC6B 5AXSA 3R2SA 1FHAA 2GYQA 2C6RA 5HJHA 1NFVA 3PVRA 3SHXA 3E1PA 3KA9A 3PVTA 2XJOA 5LG8A 3Q4OA 5JKLG 2WLAA 1JIGA 4AM2A 2Y3QA 2CN7A 3Q4RA 5C6FA 1JYBA 1SQ3A 2QQYA 2FG4A 3UOIA 4TO9A 5E1UA 4ISMA 5FFAA 3AF8X 4ZJKA 2OH3A 1KRQA 5K53A 3GVYA 1TK6A 4ML5A 2XJMA 1BCFA 3RGDA 3AF7X 4Z5SA 2ZG7X 5JKMG 2IB0A 2V2JA 4PG1A 2V15A 1LKOA 2GYDA 2ZURX 4QUWA 2C2FA 4XKUA 5GU1X 3IS7A 1YUZA 2JD60 3R2MA 4AM5A 4MKUA 3ISFA 4U3GA 3KA8A 1LKPA 2ZA7A 1L8HA 4DE6A 4IWKA 4ERUA 4CVPA 3NP2X 3PW8C 5J9VA 1RYTA 3F38A 3FI6A 4LPJA 3R2KA 4A25A 3KA6A 5JKMA 4DASA 3BKNA 2ZG9X 1TKOA 3WVVA 3Q4QA 3E1LA 5HQOA 3SH6A 5J8SA 4LQHA 3O7SA 3RE7A 1VELA 1JTSA 3PVRB 4ZKHA 3E1NA 2F7NA 3IQ1A 3PVTB 1VJXA 1YV1A 2BK6A 4ETRA 4CMYA 3U90A 2Z90A 4TOBA 3QB9A 2XJNA 2OC5A 5JACA 4M35A 2CIHA 1S30A 3QD8A 1BG7A 3AJOA 3AF9X 1NF4A 2FFXJ 3E2CA 3F39A 2UX1A 2V2NA 4EVBA 3A9QA 3E6RA 4REUA 4XGSA 2X170 1UVHA 4EVDA 3FSEA 4ZTTA 3UNOA 4ITWA 5FFCA 1HRSA 5LS9A 1TJOA 1IERA 3BVKA 4CVRA 5HJFA 2YW6A 2HTNA 4ZMCA 4RC8A 2CLBA 2Z5RA 3PW1A 1LKMA 2ZA6A 4TW3A 1QGHA 4ZKXA 3ERZA 2FG8A 2Z5PA 3WVUA 3EGMA 4KVSA 1XZ1A 2Z5QA 4TOFA 3E1MA 5GU3X 1JGCA 1JI5A 1DPSA 4CY9A 3AK8A 3QVDA 3BVFA 3PZAA 4TODA 1TKPA 2XGWA 4CVSA 4M34A 2FZFA 1LB3A 3KXUA 3KWOA 4P18A 1N1QA 3BVLA 5JKLA 4DZ0A 1O9RA 2CHPA 4DYZA 4LQJA 4ITTA 3PWQC 1Z4AA 3VNXA 2G4HA 2VZBA 2IY4A 3HIUA 4TOGA 2RBDA 2CLUA 4CMYV 3F36A 2V2OA 4LQNA 3FVBA 3E6SA 1UMNA 1DATA 4PGKA 2FKZA 4ISPA 1R03A 4LYXA 1QYBA 2VXIA 4M33A 4EVCA 1JKVA 1IESA 3KA4A 4IWJA 3QZ3A 3R2HA 5FFBA 2ZA8A 3OGHA 5D8RA 3EZUA 5D8YA 4LYUA 5CMRA 3UOFA 3PWQA 4CYBA 1L8IA 3BVEA 3RD0A 3E1JA 2BJYA 3AJQA 1RCGA 3QHCA 5FFEA 1XZ3A 3R2LA 5FEJA 2XKQA 3PVYB 3MPSA 3PW8A 1GWGA 4TOCA 4MN9A 2YW7A 3AK9A 4II4B 1VLGA 4MUDA 3NOZX 3PWFA 1S2ZA 1VEIA 4DI0A 3PW1B 3F37A 2WLUA 4DYUA 4ZKWA 2GS4A 1ZS3A 5LBHA 1MOJA 2V2PA 5D8PA 4ZLWA 5D8SA 3RAVA 4M32A 5I4JA 3O7RA 1RCDA 2BKCA 2V2IA 3PVYA 3E1QA 2ZG8X 1MFRA 3Q4NA 5IX6A 4R42A 1F33A 4DYXA 1NNQA 4II4A 4Y08A 2V2LA 4DYYA 3SIDA 1F30A 4KVRA 3EZ0A 4RC7B 4EVEA 4TOHA 3F33A 3R2RA 5K52A 3F35A 2HR5A 1OTKA 5E2DA 5GU2X 3HL1A 2FHAA 2PYBA 5J93A 4XKSA 2C41A 2V2MA 2FJCA 4RC6A 4TOAA 3KX9A 4MY7A 4RC5B 2D5KA 5GN8B 3WNWA 1RCCA 4KVQA 2ITBA 1RCEA 2CHIA 3T9JA 1J30A 4ZL5A 4RC7A 1JREA 3QHBA 4PGIA 3F34A 1AEWA
chains in the Genus database with same CATH superfamily
4ZL6A 1O9IA 1NF6A 3UFBA 3BT5A 1EUMA 2VXXA 1Z6OM 4LPNA 5GU0X 1B71A 3BVIA 4IXKA 2BW1A 4OYNA 2YJJA 5CZUA 1RCIA 3IS8A 1BFRA 2Y44A 5ERJA 3KA3A 3C1YA 2JD70 4RC5A 1H96A 5GN8A 1ZUJA 5CMQA 1VEQA 4LQVA 3ES3A 5FFDA 4YKHA 5GOUA 4MJYA 5J8WA 4PG0A 4AM4A 4CYAA 2CN6A 3GHQA 5LG2A 3SE1A 2YJKA 3H7GA 3WVWA 2WWXB 2IU2A 2Z6MA 2WTLA 3TA8A 1DVBA 5ERKA 3NP0X 1SOFA 3LKDA 3C21A 3DBYA 3E1OA 3AJPA 2QF9A 3R2OA 3F32A 2C2UA 1JKUA 3ISEA 4CVTA 2C2JA 3GE4A 1Z6OA 3C1ZA 1S3QA 2FL0A 4XKTA 5D8QA 4TOEA 4Z3BA 2CEIA 4LPMA 4E6KA 3RBCA 1JI4A 1YUXA 2CF7A 2V2RA 3A68A 2W0OA 3OJ5A 5D8OA 2JD80 3D19A 2V2SA 5D8XA 4RC6B 5AXSA 3R2SA 1FHAA 2GYQA 2G38B 2C6RA 5HJHA 1NFVA 3PVRA 4X0JA 3E1PA 3SHXA 2OKCA 3KA9A 3PVTA 2XJOA 5LG8A 3Q4OA 3L0MA 5JKLG 2WLAA 1JIGA 4AM2A 2Y3QA 2CN7A 3Q4RA 5C6FA 1JYBA 1SQ3A 2V8UA 2QQYA 2FG4A 3UOIA 4TO9A 5E1UA 4ISMA 5FFAA 3AF8X 4ZJKA 2OH3A 1KRQA 5K53A 3GVYA 1TK6A 4ML5A 2XJMA 3W54A 1BCFA 3RGDA 3AF7X 4Z5SA 2ZG7X 5JKMG 5HU6D 2IB0A 2V2JA 4PG1A 3JZ9A 2V15A 1LKOA 2GYDA 2ZURX 4QUWA 2C2FA 4XKUA 5GU1X 3IS7A 1YUZA 2JD60 3R2MA 4AM5A 4MKUA 3ISFA 4U3GA 3KA8A 1LKPA 2ZA7A 1L8HA 4DE6A 4IWKA 4ERUA 3FRSA 4CVPA 3NP2X 3PW8C 5J9VA 3KHKA 1RYTA 3F38A 3FI6A 4YXJA 4LPJA 3R2KA 4A25A 3KA6A 5JKMA 4DASA 3BKNA 2ZG9X 1TKOA 3WVVA 3GGZA 3Q4QA 3E1LA 5HQOA 3SH6A 3JZAB 5J8SA 4LQHA 3O7SA 3RE7A 1VELA 1JTSA 3V3KB 3PVRB 4ZKHA 3E1NA 2F7NA 3IQ1A 3PVTB 1VJXA 1YV1A 2BK6A 4WJG4 4ETRA 4CMYA 3U90A 2Z90A 4TOBA 3QB9A 2XJNA 2OC5A 5JACA 4M35A 2CIHA 1S30A 3QD8A 1BG7A 3AJOA 3AF9X 1NF4A 2FFXJ 3E2CA 3F39A 2UX1A 2V2NA 4EVBA 3A9QA 3E6RA 4REUA 4XGSA 2X170 1UVHA 4EVDA 3FSEA 4ZTTA 3UNOA 4ITWA 4E40A 5FFCA 1HRSA 3FRRA 5LS9A 1TJOA 1IERA 3BVKA 4CVRA 5HJFA 3C23A 2YW6A 2HTNA 4ZMCA 4RC8A 2MGYA 2CLBA 2Z5RA 3PW1A 1LKMA 2ZA6A 4TW3A 1QGHA 4ZKXA 3ERZA 2FG8A 2Z5PA 3WVUA 3EGMA 4KVSA 1XZ1A 2Z5QA 4TOFA 3E1MA 5GU3X 1JGCA 1JI5A 1DPSA 4CY9A 3QVDA 2AR0A 3AK8A 3BVFA 3PZAA 4TODA 1TKPA 5JDOA 2XGWA 4CVSA 4M34A 2FZFA 1LB3A 2N02A 3KXUA 3KWOA 4P18A 1N1QA 3BVLA 5JKLA 4DZ0A 1O9RA 2CHPA 4DYZA 4LQJA 4ITTA 4W4LB 3PWQC 1Z4AA 3VNXA 2G4HA 2VZBA 2IY4A 3HIUA 4TOGA 2RBDA 2CLUA 4CMYV 3F36A 2V2OA 4LQNA 3FVBA 3E6SA 1UMNA 1DATA 4PGKA 2FKZA 4ISPA 1R03A 3VV9A 4LYXA 1QYBA 2VXIA 4M33A 4EVCA 3VVAA 1JKVA 1IESA 3KA4A 4IWJA 3QZ3A 3R2HA 5FFBA 2ZA8A 3OGHA 3N6OA 5D8RA 3EZUA 5D8YA 4LYUA 5CMRA 3UOFA 3PWQA 4CYBA 1L8IA 3BVEA 3GGYA 3RD0A 3E1JA 2BJYA 3AJQA 1RCGA 3M6JA 3QHCA 5FFEA 1XZ3A 3R2LA 5FEJA 2XKQA 3PVYB 3MPSA 3PW8A 1GWGA 4TOCA 4KXRB 4MN9A 2YW7A 3AK9A 4II4B 1VLGA 4MUDA 3NOZX 3PWFA 1S2ZA 1VEIA 4DI0A 3PW1B 3F37A 4YXMA 2WLUA 4DYUA 4ZKWA 2GS4A 1ZS3A 5LBHA 1MOJA 2V2PA 5D8PA 4ZLWA 5D8SA 3RAVA 4MXPA 4M32A 5I4JA 3O7RA 1RCDA 5JDOB 2BKCA 2V2IA 3PVYA 3E1QA 2ZG8X 1MFRA 2CWLA 3Q4NA 5IX6A 2V8TA 4R42A 1F33A 4DYXA 1NNQA 3KDQA 4II4A 4Y08A 2V2LA 4DYYA 4W4KB 3SIDA 1F30A 4KVRA 3EZ0A 4RC7B 4EVEA 4TOHA 3F33A 3R2RA 5K52A 3F35A 2HR5A 1OTKA 5E2DA 5GU2X 3HL1A 2FHAA 2PYBA 5J93A 4XKSA 2C41A 2V2MA 2FJCA 4RC6A 4TOAA 3KX9A 4MY7A 4YVZA 4RC5B 2D5KA 5GN8B 3WNWA 1RCCA 4KVQA 2ITBA 1RCEA 2CHIA 3T9JA 1J30A 4ZL5A 4RC7A 1JREA 3QHBA 4PGIA 3F34A 1AEWA
chains in the Genus database with same CATH topology
4ZL6A 1O9IA 1NF6A 3UFBA 3BT5A 1EUMA 2VXXA 1Z6OM 4LPNA 5GU0X 1B71A 3BVIA 4IXKA 2BW1A 4OYNA 2YJJA 5CZUA 1RCIA 3IS8A 1BFRA 2Y44A 5ERJA 3KA3A 3C1YA 2JD70 4RC5A 1H96A 5GN8A 1ZUJA 5CMQA 1VEQA 4LQVA 3ES3A 5FFDA 4YKHA 5GOUA 4MJYA 5J8WA 4PG0A 4AM4A 4CYAA 2CN6A 3GHQA 5LG2A 3SE1A 2YJKA 3H7GA 3WVWA 2WWXB 2IU2A 2Z6MA 2WTLA 3TA8A 1DVBA 5ERKA 3NP0X 1SOFA 3LKDA 3C21A 3DBYA 3E1OA 3AJPA 2QF9A 3R2OA 3F32A 2C2UA 1JKUA 3ISEA 4CVTA 2C2JA 3GE4A 1Z6OA 3C1ZA 1S3QA 2FL0A 4XKTA 5D8QA 4TOEA 4Z3BA 2CEIA 4LPMA 4E6KA 3RBCA 1JI4A 1YUXA 2CF7A 2V2RA 3A68A 2W0OA 3OJ5A 5D8OA 2JD80 3D19A 2V2SA 5D8XA 4RC6B 5AXSA 3R2SA 1FHAA 2GYQA 2G38B 2C6RA 5HJHA 1NFVA 3PVRA 4X0JA 3E1PA 3SHXA 2OKCA 3KA9A 3PVTA 2XJOA 5LG8A 3Q4OA 3L0MA 5JKLG 2WLAA 1JIGA 4AM2A 2Y3QA 2CN7A 3Q4RA 5C6FA 1JYBA 1SQ3A 2V8UA 2QQYA 2FG4A 3UOIA 4TO9A 5E1UA 4ISMA 5FFAA 3AF8X 4ZJKA 2OH3A 1KRQA 5K53A 3GVYA 1TK6A 4ML5A 2XJMA 3W54A 1BCFA 3RGDA 3AF7X 4Z5SA 2ZG7X 5JKMG 5HU6D 2IB0A 2V2JA 4PG1A 3JZ9A 2V15A 1LKOA 2GYDA 2ZURX 4QUWA 2C2FA 4XKUA 5GU1X 3IS7A 1YUZA 2JD60 3R2MA 4AM5A 4MKUA 3ISFA 4U3GA 3KA8A 1LKPA 2ZA7A 1L8HA 4DE6A 4IWKA 4ERUA 3FRSA 4CVPA 3NP2X 3PW8C 5J9VA 3KHKA 1RYTA 3F38A 3FI6A 4YXJA 4LPJA 3R2KA 4A25A 3KA6A 5JKMA 4DASA 3BKNA 2ZG9X 1TKOA 3WVVA 3GGZA 3Q4QA 3E1LA 5HQOA 3SH6A 3JZAB 5J8SA 4LQHA 3O7SA 3RE7A 1VELA 1JTSA 3V3KB 3PVRB 4ZKHA 3E1NA 2F7NA 3IQ1A 3PVTB 1VJXA 1YV1A 2BK6A 4WJG4 4ETRA 4CMYA 3U90A 2Z90A 4TOBA 3QB9A 2XJNA 2OC5A 5JACA 4M35A 2CIHA 1S30A 3QD8A 1BG7A 3AJOA 3AF9X 1NF4A 2FFXJ 3E2CA 3F39A 2UX1A 2V2NA 4EVBA 3A9QA 3E6RA 4REUA 4XGSA 2X170 1UVHA 4EVDA 3FSEA 4ZTTA 3UNOA 4ITWA 4E40A 5FFCA 1HRSA 3FRRA 5LS9A 1TJOA 1IERA 3BVKA 4CVRA 5HJFA 3C23A 2YW6A 2HTNA 4ZMCA 4RC8A 2MGYA 2CLBA 2Z5RA 3PW1A 1LKMA 2ZA6A 4TW3A 1QGHA 4ZKXA 3ERZA 2FG8A 2Z5PA 3WVUA 3EGMA 4KVSA 1XZ1A 2Z5QA 4TOFA 3E1MA 5GU3X 1JGCA 1JI5A 1DPSA 4CY9A 3QVDA 2AR0A 3AK8A 3BVFA 3PZAA 4TODA 1TKPA 5JDOA 2XGWA 4CVSA 4M34A 2FZFA 1LB3A 2N02A 3KXUA 3KWOA 4P18A 1N1QA 3BVLA 5JKLA 4DZ0A 1O9RA 2CHPA 4DYZA 4LQJA 4ITTA 4W4LB 3PWQC 1Z4AA 3VNXA 2G4HA 2VZBA 2IY4A 3HIUA 4TOGA 2RBDA 2CLUA 4CMYV 3F36A 2V2OA 4LQNA 3FVBA 3E6SA 1UMNA 1DATA 4PGKA 2FKZA 4ISPA 1R03A 3VV9A 4LYXA 1QYBA 2VXIA 4M33A 4EVCA 3VVAA 1JKVA 1IESA 3KA4A 4IWJA 3QZ3A 3R2HA 5FFBA 2ZA8A 3OGHA 3N6OA 5D8RA 3EZUA 5D8YA 4LYUA 5CMRA 3UOFA 3PWQA 4CYBA 1L8IA 3BVEA 3GGYA 3RD0A 3E1JA 2BJYA 3AJQA 1RCGA 3M6JA 3QHCA 5FFEA 1XZ3A 3R2LA 5FEJA 2XKQA 3PVYB 3MPSA 3PW8A 1GWGA 4TOCA 4KXRB 4MN9A 2YW7A 3AK9A 4II4B 1VLGA 4MUDA 3NOZX 3PWFA 1S2ZA 1VEIA 4DI0A 3PW1B 3F37A 4YXMA 2WLUA 4DYUA 4ZKWA 2GS4A 1ZS3A 5LBHA 1MOJA 2V2PA 5D8PA 4ZLWA 5D8SA 3RAVA 4MXPA 4M32A 5I4JA 3O7RA 1RCDA 5JDOB 2BKCA 2V2IA 3PVYA 3E1QA 2ZG8X 1MFRA 2CWLA 3Q4NA 5IX6A 2V8TA 4R42A 1F33A 4DYXA 1NNQA 3KDQA 4II4A 4Y08A 2V2LA 4DYYA 4W4KB 3SIDA 1F30A 4KVRA 3EZ0A 4RC7B 4EVEA 4TOHA 3F33A 3R2RA 5K52A 3F35A 2HR5A 1OTKA 5E2DA 5GU2X 3HL1A 2FHAA 2PYBA 5J93A 4XKSA 2C41A 2V2MA 2FJCA 4RC6A 4TOAA 3KX9A 4MY7A 4YVZA 4RC5B 2D5KA 5GN8B 3WNWA 1RCCA 4KVQA 2ITBA 1RCEA 2CHIA 3T9JA 1J30A 4ZL5A 4RC7A 1JREA 3QHBA 4PGIA 3F34A 1AEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZL6 A;  1O9I A;  1NF6 A;  3BT5 A;  1EUM A;  2VXX A;  1Z6O M;  4LPN A;  5GU0 X;  1B71 A;  3BVI A;  4IXK A;  2BW1 A;  4OYN A;  2YJJ A;  5CZU A;  1RCI A;  3IS8 A;  1BFR A;  5ERJ A;  3KA3 A;  2JD7 0;  4RC5 A;  1H96 A;  5GN8 A;  1ZUJ A;  5CMQ A;  1VEQ A;  4LQV A;  3ES3 A;  5FFD A;  4YKH A;  5GOU A;  4MJY A;  5J8W A;  4PG0 A;  4AM4 A;  4CYA A;  2CN6 A;  3GHQ A;  5LG2 A;  3SE1 A;  2YJK A;  3H7G A;  3WVW A;  2IU2 A;  2Z6M A;  2WTL A;  3TA8 A;  1DVB A;  5ERK A;  3NP0 X;  1SOF A;  3E1O A;  3AJP A;  2QF9 A;  3R2O A;  3F32 A;  2C2U A;  1JKU A;  3ISE A;  4CVT A;  2C2J A;  3GE4 A;  1Z6O A;  1S3Q A;  2FL0 A;  4XKT A;  5D8Q A;  4TOE A;  4Z3B A;  2CEI A;  4LPM A;  4E6K A;  3RBC A;  1JI4 A;  1YUX A;  2CF7 A;  2V2R A;  3A68 A;  2W0O A;  3OJ5 A;  5D8O A;  2JD8 0;  2V2S A;  5D8X A;  4RC6 B;  5AXS A;  3R2S A;  1FHA A;  2GYQ A;  2C6R A;  5HJH A;  1NFV A;  3PVR A;  3SHX A;  3E1P A;  3KA9 A;  3PVT A;  2XJO A;  5LG8 A;  3Q4O A;  5JKL G;  2WLA A;  1JIG A;  4AM2 A;  2Y3Q A;  2CN7 A;  3Q4R A;  5C6F A;  1JYB A;  1SQ3 A;  2QQY A;  2FG4 A;  3UOI A;  4TO9 A;  5E1U A;  4ISM A;  5FFA A;  3AF8 X;  4ZJK A;  2OH3 A;  1KRQ A;  5K53 A;  3GVY A;  1TK6 A;  4ML5 A;  2XJM A;  1BCF A;  3RGD A;  3AF7 X;  4Z5S A;  2ZG7 X;  5JKM G;  2IB0 A;  2V2J A;  4PG1 A;  2V15 A;  1LKO A;  2GYD A;  2ZUR X;  4QUW A;  2C2F A;  4XKU A;  5GU1 X;  3IS7 A;  1YUZ A;  2JD6 0;  3R2M A;  4AM5 A;  4MKU A;  3ISF A;  4U3G A;  3KA8 A;  1LKP A;  2ZA7 A;  1L8H A;  4DE6 A;  4IWK A;  4ERU A;  4CVP A;  3NP2 X;  3PW8 C;  5J9V A;  1RYT A;  3F38 A;  3FI6 A;  4LPJ A;  3R2K A;  4A25 A;  3KA6 A;  5JKM A;  4DAS A;  3BKN A;  2ZG9 X;  1TKO A;  3WVV A;  3Q4Q A;  3E1L A;  5HQO A;  3SH6 A;  5J8S A;  4LQH A;  3O7S A;  3RE7 A;  1VEL A;  1JTS A;  3PVR B;  4ZKH A;  3E1N A;  2F7N A;  3IQ1 A;  3PVT B;  1VJX A;  1YV1 A;  2BK6 A;  4ETR A;  4CMY A;  3U90 A;  2Z90 A;  4TOB A;  3QB9 A;  2XJN A;  2OC5 A;  5JAC A;  4M35 A;  2CIH A;  1S30 A;  3QD8 A;  1BG7 A;  3AJO A;  3AF9 X;  1NF4 A;  2FFX J;  3E2C A;  3F39 A;  2UX1 A;  2V2N A;  4EVB A;  3A9Q A;  3E6R A;  4REU A;  4XGS A;  2X17 0;  1UVH A;  4EVD A;  3FSE A;  4ZTT A;  3UNO A;  4ITW A;  5FFC A;  1HRS A;  5LS9 A;  1TJO A;  1IER A;  3BVK A;  4CVR A;  5HJF A;  2YW6 A;  2HTN A;  4ZMC A;  4RC8 A;  2CLB A;  2Z5R A;  3PW1 A;  1LKM A;  2ZA6 A;  4TW3 A;  1QGH A;  4ZKX A;  3ERZ A;  2FG8 A;  2Z5P A;  3WVU A;  3EGM A;  4KVS A;  1XZ1 A;  2Z5Q A;  4TOF A;  3E1M A;  5GU3 X;  1JGC A;  1JI5 A;  1DPS A;  4CY9 A;  3AK8 A;  3QVD A;  3BVF A;  3PZA A;  4TOD A;  1TKP A;  2XGW A;  4CVS A;  4M34 A;  2FZF A;  1LB3 A;  3KXU A;  3KWO A;  4P18 A;  1N1Q A;  3BVL A;  5JKL A;  4DZ0 A;  1O9R A;  2CHP A;  4DYZ A;  4LQJ A;  4ITT A;  3PWQ C;  1Z4A A;  3VNX A;  2G4H A;  2VZB A;  2IY4 A;  3HIU A;  4TOG A;  2RBD A;  2CLU A;  4CMY V;  3F36 A;  2V2O A;  4LQN A;  3FVB A;  3E6S A;  1UMN A;  1DAT A;  4PGK A;  2FKZ A;  4ISP A;  1R03 A;  4LYX A;  1QYB A;  2VXI A;  4M33 A;  4EVC A;  1JKV A;  1IES A;  3KA4 A;  4IWJ A;  3QZ3 A;  3R2H A;  5FFB A;  2ZA8 A;  3OGH A;  5D8R A;  3EZU A;  5D8Y A;  4LYU A;  5CMR A;  3UOF A;  3PWQ A;  4CYB A;  1L8I A;  3BVE A;  3RD0 A;  3E1J A;  2BJY A;  3AJQ A;  1RCG A;  3QHC A;  5FFE A;  1XZ3 A;  3R2L A;  5FEJ A;  2XKQ A;  3PVY B;  3MPS A;  3PW8 A;  1GWG A;  4TOC A;  4MN9 A;  2YW7 A;  3AK9 A;  4II4 B;  1VLG A;  4MUD A;  3NOZ X;  3PWF A;  1S2Z A;  1VEI A;  4DI0 A;  3PW1 B;  3F37 A;  2WLU A;  4DYU A;  4ZKW A;  2GS4 A;  1ZS3 A;  5LBH A;  1MOJ A;  2V2P A;  5D8P A;  4ZLW A;  5D8S A;  3RAV A;  4M32 A;  5I4J A;  3O7R A;  1RCD A;  2BKC A;  2V2I A;  3PVY A;  3E1Q A;  2ZG8 X;  1MFR A;  3Q4N A;  5IX6 A;  4R42 A;  1F33 A;  4DYX A;  1NNQ A;  4II4 A;  4Y08 A;  2V2L A;  4DYY A;  3SID A;  1F30 A;  4KVR A;  3EZ0 A;  4RC7 B;  4EVE A;  4TOH A;  3F33 A;  3R2R A;  5K52 A;  3F35 A;  2HR5 A;  1OTK A;  5E2D A;  5GU2 X;  3HL1 A;  2FHA A;  2PYB A;  5J93 A;  4XKS A;  2C41 A;  2V2M A;  2FJC A;  4RC6 A;  4TOA A;  3KX9 A;  4MY7 A;  4RC5 B;  2D5K A;  5GN8 B;  3WNW A;  1RCC A;  4KVQ A;  2ITB A;  1RCE A;  2CHI A;  3T9J A;  1J30 A;  4ZL5 A;  4RC7 A;  1JRE A;  3QHB A;  4PGI A;  3F34 A;  1AEW A; 
#chains in the Genus database with same CATH topology
 4ZL6 A;  1O9I A;  1NF6 A;  3UFB A;  3BT5 A;  1EUM A;  2VXX A;  1Z6O M;  4LPN A;  5GU0 X;  1B71 A;  3BVI A;  4IXK A;  2BW1 A;  4OYN A;  2YJJ A;  5CZU A;  1RCI A;  3IS8 A;  1BFR A;  2Y44 A;  5ERJ A;  3KA3 A;  3C1Y A;  2JD7 0;  4RC5 A;  1H96 A;  5GN8 A;  1ZUJ A;  5CMQ A;  1VEQ A;  4LQV A;  3ES3 A;  5FFD A;  4YKH A;  5GOU A;  4MJY A;  5J8W A;  4PG0 A;  4AM4 A;  4CYA A;  2CN6 A;  3GHQ A;  5LG2 A;  3SE1 A;  2YJK A;  3H7G A;  3WVW A;  2WWX B;  2IU2 A;  2Z6M A;  2WTL A;  3TA8 A;  1DVB A;  5ERK A;  3NP0 X;  1SOF A;  3LKD A;  3C21 A;  3DBY A;  3E1O A;  3AJP A;  2QF9 A;  3R2O A;  3F32 A;  2C2U A;  1JKU A;  3ISE A;  4CVT A;  2C2J A;  3GE4 A;  1Z6O A;  3C1Z A;  1S3Q A;  2FL0 A;  4XKT A;  5D8Q A;  4TOE A;  4Z3B A;  2CEI A;  4LPM A;  4E6K A;  3RBC A;  1JI4 A;  1YUX A;  2CF7 A;  2V2R A;  3A68 A;  2W0O A;  3OJ5 A;  5D8O A;  2JD8 0;  3D19 A;  2V2S A;  5D8X A;  4RC6 B;  5AXS A;  3R2S A;  1FHA A;  2GYQ A;  2G38 B;  2C6R A;  5HJH A;  1NFV A;  3PVR A;  4X0J A;  3E1P A;  3SHX A;  2OKC A;  3KA9 A;  3PVT A;  2XJO A;  5LG8 A;  3Q4O A;  3L0M A;  5JKL G;  2WLA A;  1JIG A;  4AM2 A;  2Y3Q A;  2CN7 A;  3Q4R A;  5C6F A;  1JYB A;  1SQ3 A;  2V8U A;  2QQY A;  2FG4 A;  3UOI A;  4TO9 A;  5E1U A;  4ISM A;  5FFA A;  3AF8 X;  4ZJK A;  2OH3 A;  1KRQ A;  5K53 A;  3GVY A;  1TK6 A;  4ML5 A;  2XJM A;  3W54 A;  1BCF A;  3RGD A;  3AF7 X;  4Z5S A;  2ZG7 X;  5JKM G;  5HU6 D;  2IB0 A;  2V2J A;  4PG1 A;  3JZ9 A;  2V15 A;  1LKO A;  2GYD A;  2ZUR X;  4QUW A;  2C2F A;  4XKU A;  5GU1 X;  3IS7 A;  1YUZ A;  2JD6 0;  3R2M A;  4AM5 A;  4MKU A;  3ISF A;  4U3G A;  3KA8 A;  1LKP A;  2ZA7 A;  1L8H A;  4DE6 A;  4IWK A;  4ERU A;  3FRS A;  4CVP A;  3NP2 X;  3PW8 C;  5J9V A;  3KHK A;  1RYT A;  3F38 A;  3FI6 A;  4YXJ A;  4LPJ A;  3R2K A;  4A25 A;  3KA6 A;  5JKM A;  4DAS A;  3BKN A;  2ZG9 X;  1TKO A;  3WVV A;  3GGZ A;  3Q4Q A;  3E1L A;  5HQO A;  3SH6 A;  3JZA B;  5J8S A;  4LQH A;  3O7S A;  3RE7 A;  1VEL A;  1JTS A;  3V3K B;  3PVR B;  4ZKH A;  3E1N A;  2F7N A;  3IQ1 A;  3PVT B;  1VJX A;  1YV1 A;  2BK6 A;  4WJG 4;  4ETR A;  4CMY A;  3U90 A;  2Z90 A;  4TOB A;  3QB9 A;  2XJN A;  2OC5 A;  5JAC A;  4M35 A;  2CIH A;  1S30 A;  3QD8 A;  1BG7 A;  3AJO A;  3AF9 X;  1NF4 A;  2FFX J;  3E2C A;  3F39 A;  2UX1 A;  2V2N A;  4EVB A;  3A9Q A;  3E6R A;  4REU A;  4XGS A;  2X17 0;  1UVH A;  4EVD A;  3FSE A;  4ZTT A;  3UNO A;  4ITW A;  4E40 A;  5FFC A;  1HRS A;  3FRR A;  5LS9 A;  1TJO A;  1IER A;  3BVK A;  4CVR A;  5HJF A;  3C23 A;  2YW6 A;  2HTN A;  4ZMC A;  4RC8 A;  2MGY A;  2CLB A;  2Z5R A;  3PW1 A;  1LKM A;  2ZA6 A;  4TW3 A;  1QGH A;  4ZKX A;  3ERZ A;  2FG8 A;  2Z5P A;  3WVU A;  3EGM A;  4KVS A;  1XZ1 A;  2Z5Q A;  4TOF A;  3E1M A;  5GU3 X;  1JGC A;  1JI5 A;  1DPS A;  4CY9 A;  3QVD A;  2AR0 A;  3AK8 A;  3BVF A;  3PZA A;  4TOD A;  1TKP A;  5JDO A;  2XGW A;  4CVS A;  4M34 A;  2FZF A;  1LB3 A;  2N02 A;  3KXU A;  3KWO A;  4P18 A;  1N1Q A;  3BVL A;  5JKL A;  4DZ0 A;  1O9R A;  2CHP A;  4DYZ A;  4LQJ A;  4ITT A;  4W4L B;  3PWQ C;  1Z4A A;  3VNX A;  2G4H A;  2VZB A;  2IY4 A;  3HIU A;  4TOG A;  2RBD A;  2CLU A;  4CMY V;  3F36 A;  2V2O A;  4LQN A;  3FVB A;  3E6S A;  1UMN A;  1DAT A;  4PGK A;  2FKZ A;  4ISP A;  1R03 A;  3VV9 A;  4LYX A;  1QYB A;  2VXI A;  4M33 A;  4EVC A;  3VVA A;  1JKV A;  1IES A;  3KA4 A;  4IWJ A;  3QZ3 A;  3R2H A;  5FFB A;  2ZA8 A;  3OGH A;  3N6O A;  5D8R A;  3EZU A;  5D8Y A;  4LYU A;  5CMR A;  3UOF A;  3PWQ A;  4CYB A;  1L8I A;  3BVE A;  3GGY A;  3RD0 A;  3E1J A;  2BJY A;  3AJQ A;  1RCG A;  3M6J A;  3QHC A;  5FFE A;  1XZ3 A;  3R2L A;  5FEJ A;  2XKQ A;  3PVY B;  3MPS A;  3PW8 A;  1GWG A;  4TOC A;  4KXR B;  4MN9 A;  2YW7 A;  3AK9 A;  4II4 B;  1VLG A;  4MUD A;  3NOZ X;  3PWF A;  1S2Z A;  1VEI A;  4DI0 A;  3PW1 B;  3F37 A;  4YXM A;  2WLU A;  4DYU A;  4ZKW A;  2GS4 A;  1ZS3 A;  5LBH A;  1MOJ A;  2V2P A;  5D8P A;  4ZLW A;  5D8S A;  3RAV A;  4MXP A;  4M32 A;  5I4J A;  3O7R A;  1RCD A;  5JDO B;  2BKC A;  2V2I A;  3PVY A;  3E1Q A;  2ZG8 X;  1MFR A;  2CWL A;  3Q4N A;  5IX6 A;  2V8T A;  4R42 A;  1F33 A;  4DYX A;  1NNQ A;  3KDQ A;  4II4 A;  4Y08 A;  2V2L A;  4DYY A;  4W4K B;  3SID A;  1F30 A;  4KVR A;  3EZ0 A;  4RC7 B;  4EVE A;  4TOH A;  3F33 A;  3R2R A;  5K52 A;  3F35 A;  2HR5 A;  1OTK A;  5E2D A;  5GU2 X;  3HL1 A;  2FHA A;  2PYB A;  5J93 A;  4XKS A;  2C41 A;  2V2M A;  2FJC A;  4RC6 A;  4TOA A;  3KX9 A;  4MY7 A;  4YVZ A;  4RC5 B;  2D5K A;  5GN8 B;  3WNW A;  1RCC A;  4KVQ A;  2ITB A;  1RCE A;  2CHI A;  3T9J A;  1J30 A;  4ZL5 A;  4RC7 A;  1JRE A;  3QHB A;  4PGI A;  3F34 A;  1AEW A; 
#chains in the Genus database with same CATH homology
 4ZL6 A;  1O9I A;  1NF6 A;  3UFB A;  3BT5 A;  1EUM A;  2VXX A;  1Z6O M;  4LPN A;  5GU0 X;  1B71 A;  3BVI A;  4IXK A;  2BW1 A;  4OYN A;  2YJJ A;  5CZU A;  1RCI A;  3IS8 A;  1BFR A;  2Y44 A;  5ERJ A;  3KA3 A;  3C1Y A;  2JD7 0;  4RC5 A;  1H96 A;  5GN8 A;  1ZUJ A;  5CMQ A;  1VEQ A;  4LQV A;  3ES3 A;  5FFD A;  4YKH A;  5GOU A;  4MJY A;  5J8W A;  4PG0 A;  4AM4 A;  4CYA A;  2CN6 A;  3GHQ A;  5LG2 A;  3SE1 A;  2YJK A;  3H7G A;  3WVW A;  2WWX B;  2IU2 A;  2Z6M A;  2WTL A;  3TA8 A;  1DVB A;  5ERK A;  3NP0 X;  1SOF A;  3LKD A;  3C21 A;  3DBY A;  3E1O A;  3AJP A;  2QF9 A;  3R2O A;  3F32 A;  2C2U A;  1JKU A;  3ISE A;  4CVT A;  2C2J A;  3GE4 A;  1Z6O A;  3C1Z A;  1S3Q A;  2FL0 A;  4XKT A;  5D8Q A;  4TOE A;  4Z3B A;  2CEI A;  4LPM A;  4E6K A;  3RBC A;  1JI4 A;  1YUX A;  2CF7 A;  2V2R A;  3A68 A;  2W0O A;  3OJ5 A;  5D8O A;  2JD8 0;  3D19 A;  2V2S A;  5D8X A;  4RC6 B;  5AXS A;  3R2S A;  1FHA A;  2GYQ A;  2G38 B;  2C6R A;  5HJH A;  1NFV A;  3PVR A;  4X0J A;  3E1P A;  3SHX A;  2OKC A;  3KA9 A;  3PVT A;  2XJO A;  5LG8 A;  3Q4O A;  3L0M A;  5JKL G;  2WLA A;  1JIG A;  4AM2 A;  2Y3Q A;  2CN7 A;  3Q4R A;  5C6F A;  1JYB A;  1SQ3 A;  2V8U A;  2QQY A;  2FG4 A;  3UOI A;  4TO9 A;  5E1U A;  4ISM A;  5FFA A;  3AF8 X;  4ZJK A;  2OH3 A;  1KRQ A;  5K53 A;  3GVY A;  1TK6 A;  4ML5 A;  2XJM A;  3W54 A;  1BCF A;  3RGD A;  3AF7 X;  4Z5S A;  2ZG7 X;  5JKM G;  5HU6 D;  2IB0 A;  2V2J A;  4PG1 A;  3JZ9 A;  2V15 A;  1LKO A;  2GYD A;  2ZUR X;  4QUW A;  2C2F A;  4XKU A;  5GU1 X;  3IS7 A;  1YUZ A;  2JD6 0;  3R2M A;  4AM5 A;  4MKU A;  3ISF A;  4U3G A;  3KA8 A;  1LKP A;  2ZA7 A;  1L8H A;  4DE6 A;  4IWK A;  4ERU A;  3FRS A;  4CVP A;  3NP2 X;  3PW8 C;  5J9V A;  3KHK A;  1RYT A;  3F38 A;  3FI6 A;  4YXJ A;  4LPJ A;  3R2K A;  4A25 A;  3KA6 A;  5JKM A;  4DAS A;  3BKN A;  2ZG9 X;  1TKO A;  3WVV A;  3GGZ A;  3Q4Q A;  3E1L A;  5HQO A;  3SH6 A;  3JZA B;  5J8S A;  4LQH A;  3O7S A;  3RE7 A;  1VEL A;  1JTS A;  3V3K B;  3PVR B;  4ZKH A;  3E1N A;  2F7N A;  3IQ1 A;  3PVT B;  1VJX A;  1YV1 A;  2BK6 A;  4WJG 4;  4ETR A;  4CMY A;  3U90 A;  2Z90 A;  4TOB A;  3QB9 A;  2XJN A;  2OC5 A;  5JAC A;  4M35 A;  2CIH A;  1S30 A;  3QD8 A;  1BG7 A;  3AJO A;  3AF9 X;  1NF4 A;  2FFX J;  3E2C A;  3F39 A;  2UX1 A;  2V2N A;  4EVB A;  3A9Q A;  3E6R A;  4REU A;  4XGS A;  2X17 0;  1UVH A;  4EVD A;  3FSE A;  4ZTT A;  3UNO A;  4ITW A;  4E40 A;  5FFC A;  1HRS A;  3FRR A;  5LS9 A;  1TJO A;  1IER A;  3BVK A;  4CVR A;  5HJF A;  3C23 A;  2YW6 A;  2HTN A;  4ZMC A;  4RC8 A;  2MGY A;  2CLB A;  2Z5R A;  3PW1 A;  1LKM A;  2ZA6 A;  4TW3 A;  1QGH A;  4ZKX A;  3ERZ A;  2FG8 A;  2Z5P A;  3WVU A;  3EGM A;  4KVS A;  1XZ1 A;  2Z5Q A;  4TOF A;  3E1M A;  5GU3 X;  1JGC A;  1JI5 A;  1DPS A;  4CY9 A;  3QVD A;  2AR0 A;  3AK8 A;  3BVF A;  3PZA A;  4TOD A;  1TKP A;  5JDO A;  2XGW A;  4CVS A;  4M34 A;  2FZF A;  1LB3 A;  2N02 A;  3KXU A;  3KWO A;  4P18 A;  1N1Q A;  3BVL A;  5JKL A;  4DZ0 A;  1O9R A;  2CHP A;  4DYZ A;  4LQJ A;  4ITT A;  4W4L B;  3PWQ C;  1Z4A A;  3VNX A;  2G4H A;  2VZB A;  2IY4 A;  3HIU A;  4TOG A;  2RBD A;  2CLU A;  4CMY V;  3F36 A;  2V2O A;  4LQN A;  3FVB A;  3E6S A;  1UMN A;  1DAT A;  4PGK A;  2FKZ A;  4ISP A;  1R03 A;  3VV9 A;  4LYX A;  1QYB A;  2VXI A;  4M33 A;  4EVC A;  3VVA A;  1JKV A;  1IES A;  3KA4 A;  4IWJ A;  3QZ3 A;  3R2H A;  5FFB A;  2ZA8 A;  3OGH A;  3N6O A;  5D8R A;  3EZU A;  5D8Y A;  4LYU A;  5CMR A;  3UOF A;  3PWQ A;  4CYB A;  1L8I A;  3BVE A;  3GGY A;  3RD0 A;  3E1J A;  2BJY A;  3AJQ A;  1RCG A;  3M6J A;  3QHC A;  5FFE A;  1XZ3 A;  3R2L A;  5FEJ A;  2XKQ A;  3PVY B;  3MPS A;  3PW8 A;  1GWG A;  4TOC A;  4KXR B;  4MN9 A;  2YW7 A;  3AK9 A;  4II4 B;  1VLG A;  4MUD A;  3NOZ X;  3PWF A;  1S2Z A;  1VEI A;  4DI0 A;  3PW1 B;  3F37 A;  4YXM A;  2WLU A;  4DYU A;  4ZKW A;  2GS4 A;  1ZS3 A;  5LBH A;  1MOJ A;  2V2P A;  5D8P A;  4ZLW A;  5D8S A;  3RAV A;  4MXP A;  4M32 A;  5I4J A;  3O7R A;  1RCD A;  5JDO B;  2BKC A;  2V2I A;  3PVY A;  3E1Q A;  2ZG8 X;  1MFR A;  2CWL A;  3Q4N A;  5IX6 A;  2V8T A;  4R42 A;  1F33 A;  4DYX A;  1NNQ A;  3KDQ A;  4II4 A;  4Y08 A;  2V2L A;  4DYY A;  4W4K B;  3SID A;  1F30 A;  4KVR A;  3EZ0 A;  4RC7 B;  4EVE A;  4TOH A;  3F33 A;  3R2R A;  5K52 A;  3F35 A;  2HR5 A;  1OTK A;  5E2D A;  5GU2 X;  3HL1 A;  2FHA A;  2PYB A;  5J93 A;  4XKS A;  2C41 A;  2V2M A;  2FJC A;  4RC6 A;  4TOA A;  3KX9 A;  4MY7 A;  4YVZ A;  4RC5 B;  2D5K A;  5GN8 B;  3WNW A;  1RCC A;  4KVQ A;  2ITB A;  1RCE A;  2CHI A;  3T9J A;  1J30 A;  4ZL5 A;  4RC7 A;  1JRE A;  3QHB A;  4PGI A;  3F34 A;  1AEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...