2JD60

Crystal structure of the as isolated ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
167
structure length
167
Chain Sequence
MLSERMLKALNDQLNRELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEIPKPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLEWFINEQVEEEASVKKILDKLKFAKDSPQILFMLDKELSARAPKLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERRITIN HOMOLOG
publication title Crystal Structure of the Ferritin from the Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 73
structure length 167
sequence length 167
chains with identical sequence 1, 2, 3, 4, 5, 6, 7, 8, 9, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2jd6000
1ZS3A 4IWKA 2VXXA 2CHIA 1JREA 1J30A 4IWJA 2C41A 5FEJA 3AF8X 5FFEA 4ZL5A 4TO9A 3R2SA 5ERJA 4A25A 1UMNA 2CF7A 3EZUA 2FG8A 3UOIA 1YUZA 5CMRA 1LB3A 2HR5A 1SOFA 2FHAA 3Q4QA 2Z5RA 3IS7A 2GYQA 1ZUJA 2Y3QA 4MKUA 3R2MA 3RAVA 2V2NA 4LQVA 1JYBA 1LKMA 4M33A 4QUWA 3F38A 5JKLA 3F36A 1Z6OA 4ZKXA 4ISPA 1S3QA 1BG7A 1IERA 4Y08A 1N1QA 3PVTA 3SE1A 1VELA 4CVPA 5CZUA 4XKSA 4DZ0A 4ML5A 2Z5QA 3PWQC 5D8XA 3PW8A 5LS9A 4PG1A 3UOFA 5JKLG 1EUMA 3KA3A 1JTSA 2BW1A 4ITTA 5D8YA 3AF7X 3KA8A 4YKHA 4AM2A 3O7RA 4RC7A 2CEIA 2V2SA 1BFRA 3GE4A 2Z6MA 3FI6A 5K53A 4ZL6A 1IESA 2FKZA 2ZA7A 3QHCA 2V2IA 4OYNA 2HTNA 3R2LA 1O9RA 2FG4A 1MOJA 3VNXA 4LYXA 4MJYA 4PGIA 3MPSA 4CY9A 1VEIA 4II4B 5JKMA 1S2ZA 2ITBA 4TOHA 4REUA 4U3GA 3RD0A 5GN8A 3F35A 4CVTA 5D8SA 2CN7A 2C2FA 1QYBA 3HIUA 3E1LA 5LBHA 1JKUA 1O9IA 2BK6A 3NOZX 2ZA6A 3AF9X 3GHQA 3H7GA 3F32A 3R2KA 3O7SA 3E1PA 5D8QA 3PVYA 2IU2A 4KVRA 3E1JA 1RCDA 2F7NA 4IXKA 4LQNA 4XKUA 4LPJA 1BCFA 4E6KA 4EVEA 3Q4NA 4TODA 2FFXJ 3PW1A 2UX1A 3RGDA 4CYBA 3T9JA 2V2RA 4EVBA 3AJPA 4LQJA 5K52A 3KWOA 2Z90A 3OJ5A 3E2CA 2V2MA 3QVDA 1TK6A 5C6FA 2IB0A 3AJOA 4LYUA 3WNWA 1AEWA 2PYBA 1H96A 3BVKA 3WVUA 3PW8C 3BVFA 4TW3A 2GYDA 3OGHA 5FFCA 2V2LA 3BVLA 4ISMA 5GOUA 2CIHA 1DVBA 1NF6A 1NF4A 2WTLA 5J93A 2XGWA 3KA4A 1Z4AA 3QZ3A 4ZTTA 5D8PA 4RC7B 5E2DA 3KX9A 4Z5SA 2C2JA 4ZLWA 1RCCA 2CLUA 3BT5A 4CMYV 4M34A 5D8RA 4PG0A 3IQ1A 3WVWA 2IY4A 2XJOA 4KVSA 4ZJKA 3SH6A 1JGCA 3R2HA 1LKOA 4EVCA 3FSEA 2ZG8X 2QQYA 3QB9A 4ETRA 1XZ1A 4LQHA 2FZFA 2Z5PA 4MN9A 1S30A 3R2RA 5FFAA 2D5KA 4RC5A 2XJMA 2ZG9X 4XKTA 5HJHA 3QHBA 4DI0A 4Z3BA 2RBDA 4TOCA 2V2OA 5I4JA 1TKOA 1R03A 3NP2X 1L8HA 2YW7A 3E6SA 3HL1A 3E1NA 3Q4OA 4M32A 3RE7A 4RC6A 4ZMCA 4PGKA 5HJFA 2V2JA 4ERUA 2BKCA 2CHPA 5D8OA 1DPSA 2OH3A 5JKMG 1NFVA 2ZG7X 3ERZA 2G4HA 1B71A 5E1UA 4ZKHA 1FHAA 1Z6OM 3AK8A 3PVRA 3SHXA 3PZAA 2X170 3U90A 1QGHA 1TJOA 4II4A 3ISFA 3KA9A 5LG2A 3TA8A 4MUDA 3KA6A 3F39A 3A9QA 1JIGA 4DYXA 3PVTB 2YW6A 4ZKWA 1DATA 3QD8A 4M35A 1F33A 2GS4A 4TOFA 4XGSA 5ERKA 2QF9A 4CVRA 2BJYA 2C6RA 3E1QA 3IS8A 5GU0X 1KRQA 2ZURX 1VLGA 5JACA 4LPMA 2YJKA 3ES3A 4TOBA 3E1OA 2CLBA 4KVQA 3UNOA 5CMQA 2VZBA 4DYZA 5J8WA 3KXUA 4TOEA 4AM4A 4EVDA 1XZ3A 5IX6A 4CMYA 3BKNA 4RC5B 3A68A 2V15A 1YV1A 4RC8A 2WLUA 3AJQA 2OC5A 4DYYA 2V2PA 1L8IA 3WVVA 1JKVA 1YUXA 5GU1X 2VXIA 4ITWA 5LG8A 3BVEA 3EGMA 1RCGA 3BVIA 5FFDA 1UVHA 4DASA 5GN8B 3NP0X 1LKPA 4CVSA 3Q4RA 3F34A 4RC6B 4MY7A 4LPNA 1MFRA 3PWQA 3E6RA 3E1MA 3PWFA 1F30A 1RYTA 2FJCA 2JD60 5GU2X 3SIDA 2FL0A 5GU3X 5HQOA 2XKQA 4TOAA 3AK9A 3PVYB 5J8SA 4DE6A 1RCEA 2CN6A 4AM5A 4DYUA 3F37A 3FVBA 3PVRB 1VJXA 1JI5A 2WLAA 1VEQA 2W0OA 2JD80 1HRSA 2ZA8A 3PW1B 2C2UA 2JD70 5AXSA 1TKPA 5J9VA 3GVYA 3EZ0A 1OTKA 5FFBA 2YJJA 4P18A 1SQ3A 2XJNA 3F33A 3ISEA 3RBCA 4R42A 4TOGA 3R2OA 1JI4A 1NNQA 1RCIA 1GWGA 4CYAA
chains in the Genus database with same CATH superfamily
1ZS3A 4IWKA 2VXXA 2OKCA 2CHIA 1JREA 1J30A 4IWJA 2C41A 5FEJA 3AF8X 5FFEA 4ZL5A 4TO9A 2AR0A 3R2SA 5ERJA 4A25A 3FRRA 1UMNA 2CF7A 3EZUA 2FG8A 3UOIA 1YUZA 2CWLA 5CMRA 5JDOB 1LB3A 2HR5A 1SOFA 2FHAA 3Q4QA 2Z5RA 3IS7A 2GYQA 1ZUJA 2Y3QA 4MKUA 3R2MA 3RAVA 2V2NA 4LQVA 3W54A 2V8TA 1JYBA 3VV9A 1LKMA 4M33A 4QUWA 3F38A 5JKLA 3F36A 1Z6OA 2N02A 4ISPA 1S3QA 4ZKXA 1BG7A 1IERA 4Y08A 3C1YA 1N1QA 3PVTA 3SE1A 1VELA 4CVPA 5CZUA 4XKSA 4DZ0A 4ML5A 2Z5QA 3PWQC 5D8XA 3PW8A 5LS9A 4PG1A 3UOFA 4YXMA 5JKLG 1EUMA 3KA3A 1JTSA 2BW1A 4ITTA 5D8YA 3AF7X 3KA8A 4WJG4 4YKHA 4AM2A 3KHKA 3O7RA 4RC7A 2CEIA 2V2SA 1BFRA 3GE4A 3LKDA 2Z6MA 3FI6A 5K53A 4ZL6A 1IESA 2FKZA 2ZA7A 3QHCA 2V2IA 4OYNA 2HTNA 3R2LA 1O9RA 2FG4A 1MOJA 3VNXA 4LYXA 4MJYA 4PGIA 3MPSA 4CY9A 1VEIA 4II4B 5JKMA 1S2ZA 2ITBA 4TOHA 3VVAA 4REUA 4U3GA 2MGYA 3RD0A 3D19A 5GN8A 3F35A 4CVTA 5D8SA 2CN7A 2C2FA 1QYBA 3HIUA 3E1LA 5LBHA 1JKUA 1O9IA 3KDQA 2BK6A 3NOZX 2ZA6A 3AF9X 3GHQA 3H7GA 3F32A 3R2KA 3O7SA 3E1PA 4YVZA 5D8QA 3PVYA 2IU2A 4KVRA 3E1JA 1RCDA 2F7NA 4IXKA 4LQNA 4XKUA 4LPJA 1BCFA 3UFBA 4E6KA 4EVEA 3Q4NA 4TODA 3FRSA 2FFXJ 3PW1A 2UX1A 3RGDA 4CYBA 3T9JA 2V2RA 4EVBA 3AJPA 4LQJA 5K52A 3KWOA 2Z90A 3C21A 3DBYA 3OJ5A 3E2CA 2V2MA 3QVDA 4W4LB 1TK6A 5C6FA 2IB0A 3AJOA 4LYUA 3WNWA 1AEWA 2PYBA 1H96A 3BVKA 3WVUA 3PW8C 3BVFA 4TW3A 2GYDA 3OGHA 5FFCA 2V2LA 3BVLA 4ISMA 5GOUA 2CIHA 1DVBA 1NF6A 1NF4A 2WTLA 5J93A 2XGWA 3KA4A 1Z4AA 3QZ3A 4ZTTA 5D8PA 4RC7B 5E2DA 3KX9A 4Z5SA 2C2JA 4ZLWA 1RCCA 4MXPA 2CLUA 3BT5A 4CMYV 3L0MA 4M34A 3V3KB 5D8RA 3GGZA 4PG0A 3IQ1A 3WVWA 2IY4A 2XJOA 4KVSA 4ZJKA 3SH6A 1JGCA 3R2HA 1LKOA 4EVCA 3FSEA 2ZG8X 2QQYA 3QB9A 4ETRA 1XZ1A 4LQHA 2FZFA 2Z5PA 2V8UA 3JZAB 4MN9A 3C23A 1S30A 3R2RA 5FFAA 2D5KA 4RC5A 2XJMA 2ZG9X 4XKTA 5HJHA 3QHBA 4DI0A 4Z3BA 2RBDA 4TOCA 2V2OA 5I4JA 1TKOA 1R03A 3NP2X 1L8HA 2YW7A 3E6SA 3HL1A 3E1NA 3Q4OA 4M32A 3RE7A 4RC6A 4ZMCA 4PGKA 2WWXB 5HJFA 2V2JA 4ERUA 2BKCA 2CHPA 5D8OA 1DPSA 2OH3A 5JKMG 1NFVA 2ZG7X 2G38B 3ERZA 2G4HA 1B71A 5E1UA 4ZKHA 1FHAA 1Z6OM 3AK8A 3PVRA 3SHXA 3PZAA 2X170 3U90A 5HU6D 1QGHA 1TJOA 4II4A 3ISFA 3KA9A 5LG2A 3TA8A 4MUDA 3KA6A 3F39A 3A9QA 1JIGA 4DYXA 3PVTB 2YW6A 4ZKWA 1DATA 3QD8A 4M35A 1F33A 2GS4A 4TOFA 4XGSA 5ERKA 2QF9A 4CVRA 2BJYA 2C6RA 3E1QA 4KXRB 3IS8A 3GGYA 5GU0X 1KRQA 2ZURX 1VLGA 5JACA 4LPMA 2YJKA 3ES3A 4TOBA 3E1OA 2CLBA 4KVQA 3UNOA 5CMQA 2VZBA 5JDOA 4DYZA 5J8WA 3KXUA 4TOEA 4AM4A 4EVDA 1XZ3A 5IX6A 4CMYA 3BKNA 4RC5B 3A68A 2V15A 1YV1A 4RC8A 4YXJA 2WLUA 3AJQA 2OC5A 4DYYA 2V2PA 1L8IA 3WVVA 1JKVA 1YUXA 3C1ZA 5GU1X 4E40A 2VXIA 4ITWA 5LG8A 3BVEA 3EGMA 1RCGA 3BVIA 5FFDA 1UVHA 4DASA 5GN8B 3NP0X 1LKPA 4CVSA 3Q4RA 3N6OA 3F34A 4RC6B 4MY7A 4LPNA 1MFRA 3PWQA 3E6RA 3E1MA 3PWFA 1F30A 1RYTA 2FJCA 2JD60 5GU2X 3SIDA 2FL0A 5GU3X 5HQOA 2XKQA 4TOAA 3AK9A 3PVYB 5J8SA 4DE6A 1RCEA 2CN6A 4AM5A 4DYUA 3F37A 4X0JA 3FVBA 3PVRB 1VJXA 3JZ9A 1JI5A 2WLAA 1VEQA 2W0OA 2JD80 1HRSA 2ZA8A 3PW1B 2C2UA 2JD70 5AXSA 1TKPA 5J9VA 3GVYA 3EZ0A 1OTKA 5FFBA 2YJJA 4P18A 1SQ3A 2XJNA 3F33A 3ISEA 3RBCA 4R42A 4TOGA 4W4KB 2Y44A 3M6JA 3R2OA 1JI4A 1NNQA 1RCIA 1GWGA 4CYAA
chains in the Genus database with same CATH topology
1ZS3A 4IWKA 2VXXA 2OKCA 2CHIA 1JREA 1J30A 4IWJA 2C41A 5FEJA 3AF8X 5FFEA 4ZL5A 4TO9A 2AR0A 3R2SA 5ERJA 4A25A 3FRRA 1UMNA 2CF7A 3EZUA 2FG8A 3UOIA 1YUZA 2CWLA 5CMRA 5JDOB 1LB3A 2HR5A 1SOFA 2FHAA 3Q4QA 2Z5RA 3IS7A 2GYQA 1ZUJA 2Y3QA 4MKUA 3R2MA 3RAVA 2V2NA 4LQVA 3W54A 2V8TA 1JYBA 3VV9A 1LKMA 4M33A 4QUWA 3F38A 5JKLA 3F36A 1Z6OA 2N02A 4ISPA 1S3QA 4ZKXA 1BG7A 1IERA 4Y08A 3C1YA 1N1QA 3PVTA 3SE1A 1VELA 4CVPA 5CZUA 4XKSA 4DZ0A 4ML5A 2Z5QA 3PWQC 5D8XA 3PW8A 5LS9A 4PG1A 3UOFA 4YXMA 5JKLG 1EUMA 3KA3A 1JTSA 2BW1A 4ITTA 5D8YA 3AF7X 3KA8A 4WJG4 4YKHA 4AM2A 3KHKA 3O7RA 4RC7A 2CEIA 2V2SA 1BFRA 3GE4A 3LKDA 2Z6MA 3FI6A 5K53A 4ZL6A 1IESA 2FKZA 2ZA7A 3QHCA 2V2IA 4OYNA 2HTNA 3R2LA 1O9RA 2FG4A 1MOJA 3VNXA 4LYXA 4MJYA 4PGIA 3MPSA 4CY9A 1VEIA 4II4B 5JKMA 1S2ZA 2ITBA 4TOHA 3VVAA 4REUA 4U3GA 2MGYA 3RD0A 3D19A 5GN8A 3F35A 4CVTA 5D8SA 2CN7A 2C2FA 1QYBA 3HIUA 3E1LA 5LBHA 1JKUA 1O9IA 3KDQA 2BK6A 3NOZX 2ZA6A 3AF9X 3GHQA 3H7GA 3F32A 3R2KA 3O7SA 3E1PA 4YVZA 5D8QA 3PVYA 2IU2A 4KVRA 3E1JA 1RCDA 2F7NA 4IXKA 4LQNA 4XKUA 4LPJA 1BCFA 3UFBA 4E6KA 4EVEA 3Q4NA 4TODA 3FRSA 2FFXJ 3PW1A 2UX1A 3RGDA 4CYBA 3T9JA 2V2RA 4EVBA 3AJPA 4LQJA 5K52A 3KWOA 2Z90A 3C21A 3DBYA 3OJ5A 3E2CA 2V2MA 3QVDA 4W4LB 1TK6A 5C6FA 2IB0A 3AJOA 4LYUA 3WNWA 1AEWA 2PYBA 1H96A 3BVKA 3WVUA 3PW8C 3BVFA 4TW3A 2GYDA 3OGHA 5FFCA 2V2LA 3BVLA 4ISMA 5GOUA 2CIHA 1DVBA 1NF6A 1NF4A 2WTLA 5J93A 2XGWA 3KA4A 1Z4AA 3QZ3A 4ZTTA 5D8PA 4RC7B 5E2DA 3KX9A 4Z5SA 2C2JA 4ZLWA 1RCCA 4MXPA 2CLUA 3BT5A 4CMYV 3L0MA 4M34A 3V3KB 5D8RA 3GGZA 4PG0A 3IQ1A 3WVWA 2IY4A 2XJOA 4KVSA 4ZJKA 3SH6A 1JGCA 3R2HA 1LKOA 4EVCA 3FSEA 2ZG8X 2QQYA 3QB9A 4ETRA 1XZ1A 4LQHA 2FZFA 2Z5PA 2V8UA 3JZAB 4MN9A 3C23A 1S30A 3R2RA 5FFAA 2D5KA 4RC5A 2XJMA 2ZG9X 4XKTA 5HJHA 3QHBA 4DI0A 4Z3BA 2RBDA 4TOCA 2V2OA 5I4JA 1TKOA 1R03A 3NP2X 1L8HA 2YW7A 3E6SA 3HL1A 3E1NA 3Q4OA 4M32A 3RE7A 4RC6A 4ZMCA 4PGKA 2WWXB 5HJFA 2V2JA 4ERUA 2BKCA 2CHPA 5D8OA 1DPSA 2OH3A 5JKMG 1NFVA 2ZG7X 2G38B 3ERZA 2G4HA 1B71A 5E1UA 4ZKHA 1FHAA 1Z6OM 3AK8A 3PVRA 3SHXA 3PZAA 2X170 3U90A 5HU6D 1QGHA 1TJOA 4II4A 3ISFA 3KA9A 5LG2A 3TA8A 4MUDA 3KA6A 3F39A 3A9QA 1JIGA 4DYXA 3PVTB 2YW6A 4ZKWA 1DATA 3QD8A 4M35A 1F33A 2GS4A 4TOFA 4XGSA 5ERKA 2QF9A 4CVRA 2BJYA 2C6RA 3E1QA 4KXRB 3IS8A 3GGYA 5GU0X 1KRQA 2ZURX 1VLGA 5JACA 4LPMA 2YJKA 3ES3A 4TOBA 3E1OA 2CLBA 4KVQA 3UNOA 5CMQA 2VZBA 5JDOA 4DYZA 5J8WA 3KXUA 4TOEA 4AM4A 4EVDA 1XZ3A 5IX6A 4CMYA 3BKNA 4RC5B 3A68A 2V15A 1YV1A 4RC8A 4YXJA 2WLUA 3AJQA 2OC5A 4DYYA 2V2PA 1L8IA 3WVVA 1JKVA 1YUXA 3C1ZA 5GU1X 4E40A 2VXIA 4ITWA 5LG8A 3BVEA 3EGMA 1RCGA 3BVIA 5FFDA 1UVHA 4DASA 5GN8B 3NP0X 1LKPA 4CVSA 3Q4RA 3N6OA 3F34A 4RC6B 4MY7A 4LPNA 1MFRA 3PWQA 3E6RA 3E1MA 3PWFA 1F30A 1RYTA 2FJCA 2JD60 5GU2X 3SIDA 2FL0A 5GU3X 5HQOA 2XKQA 4TOAA 3AK9A 3PVYB 5J8SA 4DE6A 1RCEA 2CN6A 4AM5A 4DYUA 3F37A 4X0JA 3FVBA 3PVRB 1VJXA 3JZ9A 1JI5A 2WLAA 1VEQA 2W0OA 2JD80 1HRSA 2ZA8A 3PW1B 2C2UA 2JD70 5AXSA 1TKPA 5J9VA 3GVYA 3EZ0A 1OTKA 5FFBA 2YJJA 4P18A 1SQ3A 2XJNA 3F33A 3ISEA 3RBCA 4R42A 4TOGA 4W4KB 2Y44A 3M6JA 3R2OA 1JI4A 1NNQA 1RCIA 1GWGA 4CYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS3 A;  4IWK A;  2VXX A;  2CHI A;  1JRE A;  1J30 A;  4IWJ A;  2C41 A;  5FEJ A;  3AF8 X;  5FFE A;  4ZL5 A;  4TO9 A;  3R2S A;  5ERJ A;  4A25 A;  1UMN A;  2CF7 A;  3EZU A;  2FG8 A;  3UOI A;  1YUZ A;  5CMR A;  1LB3 A;  2HR5 A;  1SOF A;  2FHA A;  3Q4Q A;  2Z5R A;  3IS7 A;  2GYQ A;  1ZUJ A;  2Y3Q A;  4MKU A;  3R2M A;  3RAV A;  2V2N A;  4LQV A;  1JYB A;  1LKM A;  4M33 A;  4QUW A;  3F38 A;  5JKL A;  3F36 A;  1Z6O A;  4ZKX A;  4ISP A;  1S3Q A;  1BG7 A;  1IER A;  4Y08 A;  1N1Q A;  3PVT A;  3SE1 A;  1VEL A;  4CVP A;  5CZU A;  4XKS A;  4DZ0 A;  4ML5 A;  2Z5Q A;  3PWQ C;  5D8X A;  3PW8 A;  5LS9 A;  4PG1 A;  3UOF A;  5JKL G;  1EUM A;  3KA3 A;  1JTS A;  2BW1 A;  4ITT A;  5D8Y A;  3AF7 X;  3KA8 A;  4YKH A;  4AM2 A;  3O7R A;  4RC7 A;  2CEI A;  2V2S A;  1BFR A;  3GE4 A;  2Z6M A;  3FI6 A;  5K53 A;  4ZL6 A;  1IES A;  2FKZ A;  2ZA7 A;  3QHC A;  2V2I A;  4OYN A;  2HTN A;  3R2L A;  1O9R A;  2FG4 A;  1MOJ A;  3VNX A;  4LYX A;  4MJY A;  4PGI A;  3MPS A;  4CY9 A;  1VEI A;  4II4 B;  5JKM A;  1S2Z A;  2ITB A;  4TOH A;  4REU A;  4U3G A;  3RD0 A;  5GN8 A;  3F35 A;  4CVT A;  5D8S A;  2CN7 A;  2C2F A;  1QYB A;  3HIU A;  3E1L A;  5LBH A;  1JKU A;  1O9I A;  2BK6 A;  3NOZ X;  2ZA6 A;  3AF9 X;  3GHQ A;  3H7G A;  3F32 A;  3R2K A;  3O7S A;  3E1P A;  5D8Q A;  3PVY A;  2IU2 A;  4KVR A;  3E1J A;  1RCD A;  2F7N A;  4IXK A;  4LQN A;  4XKU A;  4LPJ A;  1BCF A;  4E6K A;  4EVE A;  3Q4N A;  4TOD A;  2FFX J;  3PW1 A;  2UX1 A;  3RGD A;  4CYB A;  3T9J A;  2V2R A;  4EVB A;  3AJP A;  4LQJ A;  5K52 A;  3KWO A;  2Z90 A;  3OJ5 A;  3E2C A;  2V2M A;  3QVD A;  1TK6 A;  5C6F A;  2IB0 A;  3AJO A;  4LYU A;  3WNW A;  1AEW A;  2PYB A;  1H96 A;  3BVK A;  3WVU A;  3PW8 C;  3BVF A;  4TW3 A;  2GYD A;  3OGH A;  5FFC A;  2V2L A;  3BVL A;  4ISM A;  5GOU A;  2CIH A;  1DVB A;  1NF6 A;  1NF4 A;  2WTL A;  5J93 A;  2XGW A;  3KA4 A;  1Z4A A;  3QZ3 A;  4ZTT A;  5D8P A;  4RC7 B;  5E2D A;  3KX9 A;  4Z5S A;  2C2J A;  4ZLW A;  1RCC A;  2CLU A;  3BT5 A;  4CMY V;  4M34 A;  5D8R A;  4PG0 A;  3IQ1 A;  3WVW A;  2IY4 A;  2XJO A;  4KVS A;  4ZJK A;  3SH6 A;  1JGC A;  3R2H A;  1LKO A;  4EVC A;  3FSE A;  2ZG8 X;  2QQY A;  3QB9 A;  4ETR A;  1XZ1 A;  4LQH A;  2FZF A;  2Z5P A;  4MN9 A;  1S30 A;  3R2R A;  5FFA A;  2D5K A;  4RC5 A;  2XJM A;  2ZG9 X;  4XKT A;  5HJH A;  3QHB A;  4DI0 A;  4Z3B A;  2RBD A;  4TOC A;  2V2O A;  5I4J A;  1TKO A;  1R03 A;  3NP2 X;  1L8H A;  2YW7 A;  3E6S A;  3HL1 A;  3E1N A;  3Q4O A;  4M32 A;  3RE7 A;  4RC6 A;  4ZMC A;  4PGK A;  5HJF A;  2V2J A;  4ERU A;  2BKC A;  2CHP A;  5D8O A;  1DPS A;  2OH3 A;  5JKM G;  1NFV A;  2ZG7 X;  3ERZ A;  2G4H A;  1B71 A;  5E1U A;  4ZKH A;  1FHA A;  1Z6O M;  3AK8 A;  3PVR A;  3SHX A;  3PZA A;  2X17 0;  3U90 A;  1QGH A;  1TJO A;  4II4 A;  3ISF A;  3KA9 A;  5LG2 A;  3TA8 A;  4MUD A;  3KA6 A;  3F39 A;  3A9Q A;  1JIG A;  4DYX A;  3PVT B;  2YW6 A;  4ZKW A;  1DAT A;  3QD8 A;  4M35 A;  1F33 A;  2GS4 A;  4TOF A;  4XGS A;  5ERK A;  2QF9 A;  4CVR A;  2BJY A;  2C6R A;  3E1Q A;  3IS8 A;  5GU0 X;  1KRQ A;  2ZUR X;  1VLG A;  5JAC A;  4LPM A;  2YJK A;  3ES3 A;  4TOB A;  3E1O A;  2CLB A;  4KVQ A;  3UNO A;  5CMQ A;  2VZB A;  4DYZ A;  5J8W A;  3KXU A;  4TOE A;  4AM4 A;  4EVD A;  1XZ3 A;  5IX6 A;  4CMY A;  3BKN A;  4RC5 B;  3A68 A;  2V15 A;  1YV1 A;  4RC8 A;  2WLU A;  3AJQ A;  2OC5 A;  4DYY A;  2V2P A;  1L8I A;  3WVV A;  1JKV A;  1YUX A;  5GU1 X;  2VXI A;  4ITW A;  5LG8 A;  3BVE A;  3EGM A;  1RCG A;  3BVI A;  5FFD A;  1UVH A;  4DAS A;  5GN8 B;  3NP0 X;  1LKP A;  4CVS A;  3Q4R A;  3F34 A;  4RC6 B;  4MY7 A;  4LPN A;  1MFR A;  3PWQ A;  3E6R A;  3E1M A;  3PWF A;  1F30 A;  1RYT A;  2FJC A;  2JD6 0;  5GU2 X;  3SID A;  2FL0 A;  5GU3 X;  5HQO A;  2XKQ A;  4TOA A;  3AK9 A;  3PVY B;  5J8S A;  4DE6 A;  1RCE A;  2CN6 A;  4AM5 A;  4DYU A;  3F37 A;  3FVB A;  3PVR B;  1VJX A;  1JI5 A;  2WLA A;  1VEQ A;  2W0O A;  2JD8 0;  1HRS A;  2ZA8 A;  3PW1 B;  2C2U A;  2JD7 0;  5AXS A;  1TKP A;  5J9V A;  3GVY A;  3EZ0 A;  1OTK A;  5FFB A;  2YJJ A;  4P18 A;  1SQ3 A;  2XJN A;  3F33 A;  3ISE A;  3RBC A;  4R42 A;  4TOG A;  3R2O A;  1JI4 A;  1NNQ A;  1RCI A;  1GWG A;  4CYA A; 
#chains in the Genus database with same CATH topology
 1ZS3 A;  4IWK A;  2VXX A;  2OKC A;  2CHI A;  1JRE A;  1J30 A;  4IWJ A;  2C41 A;  5FEJ A;  3AF8 X;  5FFE A;  4ZL5 A;  4TO9 A;  2AR0 A;  3R2S A;  5ERJ A;  4A25 A;  3FRR A;  1UMN A;  2CF7 A;  3EZU A;  2FG8 A;  3UOI A;  1YUZ A;  2CWL A;  5CMR A;  5JDO B;  1LB3 A;  2HR5 A;  1SOF A;  2FHA A;  3Q4Q A;  2Z5R A;  3IS7 A;  2GYQ A;  1ZUJ A;  2Y3Q A;  4MKU A;  3R2M A;  3RAV A;  2V2N A;  4LQV A;  3W54 A;  2V8T A;  1JYB A;  3VV9 A;  1LKM A;  4M33 A;  4QUW A;  3F38 A;  5JKL A;  3F36 A;  1Z6O A;  2N02 A;  4ISP A;  1S3Q A;  4ZKX A;  1BG7 A;  1IER A;  4Y08 A;  3C1Y A;  1N1Q A;  3PVT A;  3SE1 A;  1VEL A;  4CVP A;  5CZU A;  4XKS A;  4DZ0 A;  4ML5 A;  2Z5Q A;  3PWQ C;  5D8X A;  3PW8 A;  5LS9 A;  4PG1 A;  3UOF A;  4YXM A;  5JKL G;  1EUM A;  3KA3 A;  1JTS A;  2BW1 A;  4ITT A;  5D8Y A;  3AF7 X;  3KA8 A;  4WJG 4;  4YKH A;  4AM2 A;  3KHK A;  3O7R A;  4RC7 A;  2CEI A;  2V2S A;  1BFR A;  3GE4 A;  3LKD A;  2Z6M A;  3FI6 A;  5K53 A;  4ZL6 A;  1IES A;  2FKZ A;  2ZA7 A;  3QHC A;  2V2I A;  4OYN A;  2HTN A;  3R2L A;  1O9R A;  2FG4 A;  1MOJ A;  3VNX A;  4LYX A;  4MJY A;  4PGI A;  3MPS A;  4CY9 A;  1VEI A;  4II4 B;  5JKM A;  1S2Z A;  2ITB A;  4TOH A;  3VVA A;  4REU A;  4U3G A;  2MGY A;  3RD0 A;  3D19 A;  5GN8 A;  3F35 A;  4CVT A;  5D8S A;  2CN7 A;  2C2F A;  1QYB A;  3HIU A;  3E1L A;  5LBH A;  1JKU A;  1O9I A;  3KDQ A;  2BK6 A;  3NOZ X;  2ZA6 A;  3AF9 X;  3GHQ A;  3H7G A;  3F32 A;  3R2K A;  3O7S A;  3E1P A;  4YVZ A;  5D8Q A;  3PVY A;  2IU2 A;  4KVR A;  3E1J A;  1RCD A;  2F7N A;  4IXK A;  4LQN A;  4XKU A;  4LPJ A;  1BCF A;  3UFB A;  4E6K A;  4EVE A;  3Q4N A;  4TOD A;  3FRS A;  2FFX J;  3PW1 A;  2UX1 A;  3RGD A;  4CYB A;  3T9J A;  2V2R A;  4EVB A;  3AJP A;  4LQJ A;  5K52 A;  3KWO A;  2Z90 A;  3C21 A;  3DBY A;  3OJ5 A;  3E2C A;  2V2M A;  3QVD A;  4W4L B;  1TK6 A;  5C6F A;  2IB0 A;  3AJO A;  4LYU A;  3WNW A;  1AEW A;  2PYB A;  1H96 A;  3BVK A;  3WVU A;  3PW8 C;  3BVF A;  4TW3 A;  2GYD A;  3OGH A;  5FFC A;  2V2L A;  3BVL A;  4ISM A;  5GOU A;  2CIH A;  1DVB A;  1NF6 A;  1NF4 A;  2WTL A;  5J93 A;  2XGW A;  3KA4 A;  1Z4A A;  3QZ3 A;  4ZTT A;  5D8P A;  4RC7 B;  5E2D A;  3KX9 A;  4Z5S A;  2C2J A;  4ZLW A;  1RCC A;  4MXP A;  2CLU A;  3BT5 A;  4CMY V;  3L0M A;  4M34 A;  3V3K B;  5D8R A;  3GGZ A;  4PG0 A;  3IQ1 A;  3WVW A;  2IY4 A;  2XJO A;  4KVS A;  4ZJK A;  3SH6 A;  1JGC A;  3R2H A;  1LKO A;  4EVC A;  3FSE A;  2ZG8 X;  2QQY A;  3QB9 A;  4ETR A;  1XZ1 A;  4LQH A;  2FZF A;  2Z5P A;  2V8U A;  3JZA B;  4MN9 A;  3C23 A;  1S30 A;  3R2R A;  5FFA A;  2D5K A;  4RC5 A;  2XJM A;  2ZG9 X;  4XKT A;  5HJH A;  3QHB A;  4DI0 A;  4Z3B A;  2RBD A;  4TOC A;  2V2O A;  5I4J A;  1TKO A;  1R03 A;  3NP2 X;  1L8H A;  2YW7 A;  3E6S A;  3HL1 A;  3E1N A;  3Q4O A;  4M32 A;  3RE7 A;  4RC6 A;  4ZMC A;  4PGK A;  2WWX B;  5HJF A;  2V2J A;  4ERU A;  2BKC A;  2CHP A;  5D8O A;  1DPS A;  2OH3 A;  5JKM G;  1NFV A;  2ZG7 X;  2G38 B;  3ERZ A;  2G4H A;  1B71 A;  5E1U A;  4ZKH A;  1FHA A;  1Z6O M;  3AK8 A;  3PVR A;  3SHX A;  3PZA A;  2X17 0;  3U90 A;  5HU6 D;  1QGH A;  1TJO A;  4II4 A;  3ISF A;  3KA9 A;  5LG2 A;  3TA8 A;  4MUD A;  3KA6 A;  3F39 A;  3A9Q A;  1JIG A;  4DYX A;  3PVT B;  2YW6 A;  4ZKW A;  1DAT A;  3QD8 A;  4M35 A;  1F33 A;  2GS4 A;  4TOF A;  4XGS A;  5ERK A;  2QF9 A;  4CVR A;  2BJY A;  2C6R A;  3E1Q A;  4KXR B;  3IS8 A;  3GGY A;  5GU0 X;  1KRQ A;  2ZUR X;  1VLG A;  5JAC A;  4LPM A;  2YJK A;  3ES3 A;  4TOB A;  3E1O A;  2CLB A;  4KVQ A;  3UNO A;  5CMQ A;  2VZB A;  5JDO A;  4DYZ A;  5J8W A;  3KXU A;  4TOE A;  4AM4 A;  4EVD A;  1XZ3 A;  5IX6 A;  4CMY A;  3BKN A;  4RC5 B;  3A68 A;  2V15 A;  1YV1 A;  4RC8 A;  4YXJ A;  2WLU A;  3AJQ A;  2OC5 A;  4DYY A;  2V2P A;  1L8I A;  3WVV A;  1JKV A;  1YUX A;  3C1Z A;  5GU1 X;  4E40 A;  2VXI A;  4ITW A;  5LG8 A;  3BVE A;  3EGM A;  1RCG A;  3BVI A;  5FFD A;  1UVH A;  4DAS A;  5GN8 B;  3NP0 X;  1LKP A;  4CVS A;  3Q4R A;  3N6O A;  3F34 A;  4RC6 B;  4MY7 A;  4LPN A;  1MFR A;  3PWQ A;  3E6R A;  3E1M A;  3PWF A;  1F30 A;  1RYT A;  2FJC A;  2JD6 0;  5GU2 X;  3SID A;  2FL0 A;  5GU3 X;  5HQO A;  2XKQ A;  4TOA A;  3AK9 A;  3PVY B;  5J8S A;  4DE6 A;  1RCE A;  2CN6 A;  4AM5 A;  4DYU A;  3F37 A;  4X0J A;  3FVB A;  3PVR B;  1VJX A;  3JZ9 A;  1JI5 A;  2WLA A;  1VEQ A;  2W0O A;  2JD8 0;  1HRS A;  2ZA8 A;  3PW1 B;  2C2U A;  2JD7 0;  5AXS A;  1TKP A;  5J9V A;  3GVY A;  3EZ0 A;  1OTK A;  5FFB A;  2YJJ A;  4P18 A;  1SQ3 A;  2XJN A;  3F33 A;  3ISE A;  3RBC A;  4R42 A;  4TOG A;  4W4K B;  2Y44 A;  3M6J A;  3R2O A;  1JI4 A;  1NNQ A;  1RCI A;  1GWG A;  4CYA A; 
#chains in the Genus database with same CATH homology
 1ZS3 A;  4IWK A;  2VXX A;  2OKC A;  2CHI A;  1JRE A;  1J30 A;  4IWJ A;  2C41 A;  5FEJ A;  3AF8 X;  5FFE A;  4ZL5 A;  4TO9 A;  2AR0 A;  3R2S A;  5ERJ A;  4A25 A;  3FRR A;  1UMN A;  2CF7 A;  3EZU A;  2FG8 A;  3UOI A;  1YUZ A;  2CWL A;  5CMR A;  5JDO B;  1LB3 A;  2HR5 A;  1SOF A;  2FHA A;  3Q4Q A;  2Z5R A;  3IS7 A;  2GYQ A;  1ZUJ A;  2Y3Q A;  4MKU A;  3R2M A;  3RAV A;  2V2N A;  4LQV A;  3W54 A;  2V8T A;  1JYB A;  3VV9 A;  1LKM A;  4M33 A;  4QUW A;  3F38 A;  5JKL A;  3F36 A;  1Z6O A;  2N02 A;  4ISP A;  1S3Q A;  4ZKX A;  1BG7 A;  1IER A;  4Y08 A;  3C1Y A;  1N1Q A;  3PVT A;  3SE1 A;  1VEL A;  4CVP A;  5CZU A;  4XKS A;  4DZ0 A;  4ML5 A;  2Z5Q A;  3PWQ C;  5D8X A;  3PW8 A;  5LS9 A;  4PG1 A;  3UOF A;  4YXM A;  5JKL G;  1EUM A;  3KA3 A;  1JTS A;  2BW1 A;  4ITT A;  5D8Y A;  3AF7 X;  3KA8 A;  4WJG 4;  4YKH A;  4AM2 A;  3KHK A;  3O7R A;  4RC7 A;  2CEI A;  2V2S A;  1BFR A;  3GE4 A;  3LKD A;  2Z6M A;  3FI6 A;  5K53 A;  4ZL6 A;  1IES A;  2FKZ A;  2ZA7 A;  3QHC A;  2V2I A;  4OYN A;  2HTN A;  3R2L A;  1O9R A;  2FG4 A;  1MOJ A;  3VNX A;  4LYX A;  4MJY A;  4PGI A;  3MPS A;  4CY9 A;  1VEI A;  4II4 B;  5JKM A;  1S2Z A;  2ITB A;  4TOH A;  3VVA A;  4REU A;  4U3G A;  2MGY A;  3RD0 A;  3D19 A;  5GN8 A;  3F35 A;  4CVT A;  5D8S A;  2CN7 A;  2C2F A;  1QYB A;  3HIU A;  3E1L A;  5LBH A;  1JKU A;  1O9I A;  3KDQ A;  2BK6 A;  3NOZ X;  2ZA6 A;  3AF9 X;  3GHQ A;  3H7G A;  3F32 A;  3R2K A;  3O7S A;  3E1P A;  4YVZ A;  5D8Q A;  3PVY A;  2IU2 A;  4KVR A;  3E1J A;  1RCD A;  2F7N A;  4IXK A;  4LQN A;  4XKU A;  4LPJ A;  1BCF A;  3UFB A;  4E6K A;  4EVE A;  3Q4N A;  4TOD A;  3FRS A;  2FFX J;  3PW1 A;  2UX1 A;  3RGD A;  4CYB A;  3T9J A;  2V2R A;  4EVB A;  3AJP A;  4LQJ A;  5K52 A;  3KWO A;  2Z90 A;  3C21 A;  3DBY A;  3OJ5 A;  3E2C A;  2V2M A;  3QVD A;  4W4L B;  1TK6 A;  5C6F A;  2IB0 A;  3AJO A;  4LYU A;  3WNW A;  1AEW A;  2PYB A;  1H96 A;  3BVK A;  3WVU A;  3PW8 C;  3BVF A;  4TW3 A;  2GYD A;  3OGH A;  5FFC A;  2V2L A;  3BVL A;  4ISM A;  5GOU A;  2CIH A;  1DVB A;  1NF6 A;  1NF4 A;  2WTL A;  5J93 A;  2XGW A;  3KA4 A;  1Z4A A;  3QZ3 A;  4ZTT A;  5D8P A;  4RC7 B;  5E2D A;  3KX9 A;  4Z5S A;  2C2J A;  4ZLW A;  1RCC A;  4MXP A;  2CLU A;  3BT5 A;  4CMY V;  3L0M A;  4M34 A;  3V3K B;  5D8R A;  3GGZ A;  4PG0 A;  3IQ1 A;  3WVW A;  2IY4 A;  2XJO A;  4KVS A;  4ZJK A;  3SH6 A;  1JGC A;  3R2H A;  1LKO A;  4EVC A;  3FSE A;  2ZG8 X;  2QQY A;  3QB9 A;  4ETR A;  1XZ1 A;  4LQH A;  2FZF A;  2Z5P A;  2V8U A;  3JZA B;  4MN9 A;  3C23 A;  1S30 A;  3R2R A;  5FFA A;  2D5K A;  4RC5 A;  2XJM A;  2ZG9 X;  4XKT A;  5HJH A;  3QHB A;  4DI0 A;  4Z3B A;  2RBD A;  4TOC A;  2V2O A;  5I4J A;  1TKO A;  1R03 A;  3NP2 X;  1L8H A;  2YW7 A;  3E6S A;  3HL1 A;  3E1N A;  3Q4O A;  4M32 A;  3RE7 A;  4RC6 A;  4ZMC A;  4PGK A;  2WWX B;  5HJF A;  2V2J A;  4ERU A;  2BKC A;  2CHP A;  5D8O A;  1DPS A;  2OH3 A;  5JKM G;  1NFV A;  2ZG7 X;  2G38 B;  3ERZ A;  2G4H A;  1B71 A;  5E1U A;  4ZKH A;  1FHA A;  1Z6O M;  3AK8 A;  3PVR A;  3SHX A;  3PZA A;  2X17 0;  3U90 A;  5HU6 D;  1QGH A;  1TJO A;  4II4 A;  3ISF A;  3KA9 A;  5LG2 A;  3TA8 A;  4MUD A;  3KA6 A;  3F39 A;  3A9Q A;  1JIG A;  4DYX A;  3PVT B;  2YW6 A;  4ZKW A;  1DAT A;  3QD8 A;  4M35 A;  1F33 A;  2GS4 A;  4TOF A;  4XGS A;  5ERK A;  2QF9 A;  4CVR A;  2BJY A;  2C6R A;  3E1Q A;  4KXR B;  3IS8 A;  3GGY A;  5GU0 X;  1KRQ A;  2ZUR X;  1VLG A;  5JAC A;  4LPM A;  2YJK A;  3ES3 A;  4TOB A;  3E1O A;  2CLB A;  4KVQ A;  3UNO A;  5CMQ A;  2VZB A;  5JDO A;  4DYZ A;  5J8W A;  3KXU A;  4TOE A;  4AM4 A;  4EVD A;  1XZ3 A;  5IX6 A;  4CMY A;  3BKN A;  4RC5 B;  3A68 A;  2V15 A;  1YV1 A;  4RC8 A;  4YXJ A;  2WLU A;  3AJQ A;  2OC5 A;  4DYY A;  2V2P A;  1L8I A;  3WVV A;  1JKV A;  1YUX A;  3C1Z A;  5GU1 X;  4E40 A;  2VXI A;  4ITW A;  5LG8 A;  3BVE A;  3EGM A;  1RCG A;  3BVI A;  5FFD A;  1UVH A;  4DAS A;  5GN8 B;  3NP0 X;  1LKP A;  4CVS A;  3Q4R A;  3N6O A;  3F34 A;  4RC6 B;  4MY7 A;  4LPN A;  1MFR A;  3PWQ A;  3E6R A;  3E1M A;  3PWF A;  1F30 A;  1RYT A;  2FJC A;  2JD6 0;  5GU2 X;  3SID A;  2FL0 A;  5GU3 X;  5HQO A;  2XKQ A;  4TOA A;  3AK9 A;  3PVY B;  5J8S A;  4DE6 A;  1RCE A;  2CN6 A;  4AM5 A;  4DYU A;  3F37 A;  4X0J A;  3FVB A;  3PVR B;  1VJX A;  3JZ9 A;  1JI5 A;  2WLA A;  1VEQ A;  2W0O A;  2JD8 0;  1HRS A;  2ZA8 A;  3PW1 B;  2C2U A;  2JD7 0;  5AXS A;  1TKP A;  5J9V A;  3GVY A;  3EZ0 A;  1OTK A;  5FFB A;  2YJJ A;  4P18 A;  1SQ3 A;  2XJN A;  3F33 A;  3ISE A;  3RBC A;  4R42 A;  4TOG A;  4W4K B;  2Y44 A;  3M6J A;  3R2O A;  1JI4 A;  1NNQ A;  1RCI A;  1GWG A;  4CYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...