3E1LA

Crystal structure of e. coli bacterioferritin (bfr) soaked in phosphate with an alternative conformation of the unoccupied ferroxidase centre (apo-bfr ii).
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIOFERRITIN
publication title Structural basis for iron mineralization by bacterioferritin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 73
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e1lA00
2GS4A 1SQ3A 3SE1A 1TJOA 3KA9A 4CVPA 2Z5RA 4M33A 4PG0A 3ES3A 3Q4QA 2CN6A 4MUDA 1GWGA 1ZS3A 2CLUA 4DZ0A 1NF6A 3E1OA 3NP0X 4CVTA 1F33A 2RBDA 3F38A 3AF7X 2CLBA 1N1QA 3PWFA 2V15A 5GU2X 5GU1X 1J30A 4DE6A 5JKLA 2G4HA 5J8SA 4MKUA 4XKUA 1EUMA 4RC7B 4DYYA 3E2CA 2JD60 3R2MA 2JD80 3SHXA 1H96A 3NOZX 3SH6A 5D8XA 4LYUA 4MY7A 4EVDA 5FFEA 4PGKA 3E1PA 3E6SA 1UVHA 2CEIA 3RGDA 3BVEA 1RCCA 4RC5A 1VLGA 4TOHA 5CMQA 1DPSA 5GU3X 4LPJA 3VNXA 2Z5QA 1RCIA 1HRSA 3HIUA 2XJNA 2YJJA 2ZA8A 4EVBA 2VXXA 3WNWA 3F34A 3PVYA 2CF7A 2W0OA 2CHPA 2UX1A 5HJFA 2V2NA 3Q4NA 4ISMA 1IERA 2BW1A 2CIHA 5FEJA 2FKZA 2VXIA 5GOUA 3FVBA 4M32A 2QQYA 2ZG7X 5FFCA 4TOBA 3R2HA 4TODA 4ERUA 2PYBA 2CHIA 3AJOA 1XZ1A 2ZG9X 4RC7A 4DI0A 4Z5SA 2Z6MA 1MFRA 4RC5B 2V2MA 4Y08A 4IWKA 3KXUA 3R2RA 3HL1A 4AM2A 4M35A 3UOFA 3QVDA 4TO9A 4CMYA 4II4A 4YKHA 5GU0X 5D8QA 5E2DA 2FL0A 1ZUJA 3F37A 3FI6A 5LS9A 3QB9A 4ZTTA 2IY4A 3Q4OA 4DYZA 2F7NA 1XZ3A 3PVYB 4DYUA 2X170 3FSEA 3TA8A 3PWQC 3RD0A 4LQJA 4PG1A 3AF8X 1Z6OA 2XJMA 5CZUA 5E1UA 3IS8A 1NFVA 4CMYV 3KA6A 5I4JA 5D8OA 4ZMCA 4PGIA 3WVWA 1QYBA 5D8YA 3OJ5A 3E6RA 1IESA 2Z90A 2C2FA 2OC5A 4RC6A 1QGHA 1JKVA 4ML5A 4XKTA 3R2SA 4IXKA 4CVRA 4TOGA 2C6RA 1AEWA 1Z6OM 2GYDA 2V2LA 5GN8B 2FHAA 4ZKXA 3KWOA 4RC8A 1NNQA 4KVQA 5D8PA 1BG7A 1JYBA 4TW3A 5JKMA 4II4B 3PW1A 3ERZA 4M34A 4QUWA 5JKLG 2V2PA 2OH3A 3Q4RA 4E6KA 4ZL6A 2ZG8X 1LB3A 2ZURX 3AK8A 5K52A 2BJYA 2ZA6A 3QD8A 4ITTA 2HTNA 4LQNA 4R42A 3MPSA 2XJOA 1KRQA 1NF4A 4ZL5A 4Z3BA 4OYNA 1TKOA 2V2SA 4RC6B 1F30A 1OTKA 2FG4A 5D8RA 1VEIA 2Z5PA 5LG2A 1O9RA 4LYXA 1YV1A 4CY9A 3RAVA 3BVIA 3ISFA 1JIGA 3QHCA 3PVTA 3KA3A 4IWJA 3U90A 3A9QA 5D8SA 3O7SA 3E1MA 3F32A 4KVSA 1SOFA 3PWQA 3IQ1A 1JI5A 4LQHA 5FFAA 3PW1B 3E1JA 5GN8A 1LKMA 4DYXA 3E1NA 1JGCA 1JKUA 3R2KA 3GVYA 3T9JA 1JTSA 4XGSA 5HJHA 4MN9A 3AK9A 4ZKWA 1RCGA 1RYTA 3ISEA 2XKQA 3R2OA 4LPMA 1LKPA 3BVFA 1BFRA 1VEQA 3KA8A 1DATA 1JI4A 3AJQA 3QHBA 4CYAA 1LKOA 2C2JA 4KVRA 2WLUA 4TOCA 1VELA 2IB0A 3E1QA 3EZ0A 3EZUA 2V2RA 3PVRA 3F39A 3R2LA 3PVTB 4ISPA 4LPNA 5FFDA 2XGWA 5C6FA 3BVLA 4TOFA 3PW8A 4CYBA 3NP2X 1YUZA 4REUA 2C2UA 5HQOA 4EVEA 2V2IA 3IS7A 2FFXJ 3QZ3A 2Y3QA 4A25A 4ETRA 2HR5A 1R03A 5J9VA 1YUXA 3AF9X 2IU2A 4ZLWA 4EVCA 5FFBA 1O9IA 2WLAA 3E1LA 3H7GA 4ZJKA 4AM4A 5JACA 2BK6A 2C41A 1FHAA 3PW8C 5AXSA 5ERJA 3UNOA 4TOEA 3WVUA 4TOAA 5CMRA 2YW6A 3UOIA 1S3QA 1JREA 5J93A 2FZFA 3F35A 2ITBA 1BCFA 5JKMG 3PVRB 2GYQA 2FG8A 2JD70 4ZKHA 2WTLA 1MOJA 1DVBA 1RCDA 2YW7A 3WVVA 4ITWA 5J8WA 3AJPA 5LBHA 1TKPA 2YJKA 2QF9A 1S30A 1Z4AA 1L8HA 5ERKA 1S2ZA 1B71A 3RE7A 4P18A 4MJYA 1RCEA 1UMNA 3F36A 5K53A 4U3GA 1L8IA 4LQVA 3KX9A 3BT5A 2BKCA 3RBCA 4DASA 4CVSA 1VJXA 3O7RA 5LG8A 2V2OA 3BKNA 3EGMA 2FJCA 2VZBA 3GHQA 5IX6A 3BVKA 3SIDA 2ZA7A 2D5KA 3GE4A 4XKSA 3OGHA 3KA4A 3PZAA 3F33A 4AM5A 3A68A 2V2JA 2CN7A 1TK6A
chains in the Genus database with same CATH superfamily
2GS4A 1SQ3A 3SE1A 1TJOA 3KA9A 4CVPA 5JDOB 2Z5RA 4M33A 4PG0A 3ES3A 4W4LB 3Q4QA 2CN6A 4MUDA 1GWGA 1ZS3A 2CLUA 4DZ0A 1NF6A 3E1OA 3NP0X 4CVTA 1F33A 2RBDA 3F38A 3AF7X 2CLBA 1N1QA 3PWFA 2V15A 5GU2X 5GU1X 1J30A 4DE6A 4YXJA 5JKLA 2G4HA 5J8SA 4MKUA 4XKUA 1EUMA 4RC7B 4DYYA 3E2CA 3KDQA 2JD60 3R2MA 2JD80 3SHXA 1H96A 2V8TA 3NOZX 3SH6A 3DBYA 5D8XA 4LYUA 4MY7A 4EVDA 5FFEA 4PGKA 3E1PA 3E6SA 1UVHA 2CEIA 3RGDA 3BVEA 1RCCA 4RC5A 1VLGA 4TOHA 5CMQA 1DPSA 5GU3X 4LPJA 3VNXA 2Z5QA 1RCIA 1HRSA 3HIUA 2XJNA 2YJJA 2ZA8A 2MGYA 4EVBA 2VXXA 3WNWA 3F34A 3PVYA 2CF7A 2W0OA 2CHPA 2UX1A 5HJFA 2CWLA 2V2NA 3Q4NA 4ISMA 1IERA 2BW1A 2CIHA 5FEJA 2FKZA 3C1YA 2VXIA 4X0JA 5GOUA 3FVBA 4M32A 2QQYA 2ZG7X 5FFCA 4TOBA 3R2HA 4TODA 3LKDA 4ERUA 2PYBA 2CHIA 3AJOA 1XZ1A 3FRSA 2ZG9X 4RC7A 4DI0A 2Y44A 4Z5SA 2Z6MA 1MFRA 4RC5B 2G38B 2V2MA 4Y08A 4IWKA 3KXUA 3UFBA 3R2RA 3V3KB 3HL1A 4KXRB 3C23A 4AM2A 4M35A 3UOFA 3QVDA 4TO9A 4CMYA 4II4A 4YKHA 3VV9A 5GU0X 5D8QA 4MXPA 5E2DA 2FL0A 1ZUJA 3F37A 3FI6A 5LS9A 3QB9A 4ZTTA 2IY4A 3Q4OA 4DYZA 2F7NA 1XZ3A 3PVYB 4DYUA 2X170 3FSEA 3TA8A 3PWQC 2OKCA 3RD0A 4LQJA 4PG1A 3AF8X 1Z6OA 2XJMA 5CZUA 5E1UA 3IS8A 1NFVA 4CMYV 3KA6A 5I4JA 5D8OA 4ZMCA 4PGIA 3WVWA 1QYBA 5D8YA 3OJ5A 3E6RA 1IESA 2Z90A 2C2FA 2OC5A 4RC6A 1QGHA 1JKVA 4ML5A 3N6OA 4XKTA 3JZ9A 3R2SA 3C21A 4IXKA 4CVRA 4TOGA 2C6RA 1AEWA 1Z6OM 2GYDA 2V2LA 5GN8B 2FHAA 4ZKXA 3L0MA 3KWOA 4RC8A 1NNQA 4KVQA 5D8PA 1BG7A 1JYBA 4TW3A 5JKMA 4II4B 3PW1A 3ERZA 4M34A 4QUWA 5JKLG 2V2PA 2OH3A 3Q4RA 5HU6D 4E6KA 4ZL6A 2ZG8X 1LB3A 2ZURX 3AK8A 5K52A 2BJYA 2ZA6A 3QD8A 4ITTA 2HTNA 4LQNA 4R42A 3MPSA 2XJOA 1KRQA 4YXMA 1NF4A 4ZL5A 3W54A 4Z3BA 4OYNA 4YVZA 1TKOA 2V2SA 4RC6B 1F30A 1OTKA 2FG4A 5D8RA 1VEIA 2Z5PA 5LG2A 1O9RA 3KHKA 4LYXA 1YV1A 3C1ZA 4CY9A 3RAVA 3BVIA 3ISFA 1JIGA 3QHCA 3PVTA 3KA3A 4IWJA 3U90A 3A9QA 5D8SA 3O7SA 3E1MA 3F32A 4KVSA 1SOFA 3PWQA 3IQ1A 1JI5A 4LQHA 5FFAA 3PW1B 3E1JA 5GN8A 1LKMA 4DYXA 3E1NA 1JGCA 1JKUA 3R2KA 3GVYA 3T9JA 1JTSA 4XGSA 5HJHA 4MN9A 3AK9A 2AR0A 4ZKWA 1RCGA 1RYTA 3ISEA 2XKQA 3R2OA 4LPMA 1LKPA 3BVFA 3JZAB 1BFRA 1VEQA 3KA8A 1DATA 1JI4A 3AJQA 3QHBA 4CYAA 1LKOA 2C2JA 2WWXB 4KVRA 2WLUA 4TOCA 1VELA 2IB0A 3E1QA 3EZ0A 3EZUA 2V2RA 3PVRA 3F39A 3R2LA 3PVTB 4ISPA 4LPNA 5FFDA 2XGWA 5C6FA 3BVLA 4TOFA 3PW8A 4W4KB 4CYBA 3NP2X 1YUZA 4REUA 2C2UA 5HQOA 4EVEA 2V2IA 3IS7A 2FFXJ 3QZ3A 2Y3QA 4E40A 4A25A 4ETRA 2HR5A 1R03A 5J9VA 1YUXA 3AF9X 3FRRA 2IU2A 4ZLWA 4EVCA 5FFBA 1O9IA 2WLAA 3E1LA 3D19A 3H7GA 4ZJKA 4AM4A 5JACA 2BK6A 2C41A 1FHAA 3PW8C 5AXSA 5ERJA 3UNOA 4TOEA 3WVUA 4TOAA 5CMRA 2YW6A 3UOIA 1S3QA 1JREA 4WJG4 5J93A 2FZFA 3F35A 2ITBA 1BCFA 5JKMG 3PVRB 2GYQA 2FG8A 2JD70 4ZKHA 2WTLA 1MOJA 1DVBA 1RCDA 2YW7A 5JDOA 3WVVA 4ITWA 5J8WA 3AJPA 5LBHA 2N02A 1TKPA 2YJKA 2QF9A 1S30A 1Z4AA 1L8HA 5ERKA 1S2ZA 2V8UA 1B71A 3RE7A 4P18A 4MJYA 1RCEA 1UMNA 3F36A 5K53A 4U3GA 1L8IA 4LQVA 3KX9A 3BT5A 2BKCA 3RBCA 4DASA 4CVSA 1VJXA 3O7RA 5LG8A 2V2OA 3BKNA 3EGMA 2FJCA 2VZBA 3GGZA 3GHQA 5IX6A 3BVKA 3SIDA 2ZA7A 2D5KA 3GE4A 4XKSA 3OGHA 3KA4A 3PZAA 3VVAA 3GGYA 3F33A 4AM5A 3A68A 2V2JA 2CN7A 1TK6A 3M6JA
chains in the Genus database with same CATH topology
2GS4A 1SQ3A 3SE1A 1TJOA 3KA9A 4CVPA 5JDOB 2Z5RA 4M33A 4PG0A 3ES3A 4W4LB 3Q4QA 2CN6A 4MUDA 1GWGA 1ZS3A 2CLUA 4DZ0A 1NF6A 3E1OA 3NP0X 4CVTA 1F33A 2RBDA 3F38A 3AF7X 2CLBA 1N1QA 3PWFA 2V15A 5GU2X 5GU1X 1J30A 4DE6A 4YXJA 5JKLA 2G4HA 5J8SA 4MKUA 4XKUA 1EUMA 4RC7B 4DYYA 3E2CA 3KDQA 2JD60 3R2MA 2JD80 3SHXA 1H96A 2V8TA 3NOZX 3SH6A 3DBYA 5D8XA 4LYUA 4MY7A 4EVDA 5FFEA 4PGKA 3E1PA 3E6SA 1UVHA 2CEIA 3RGDA 3BVEA 1RCCA 4RC5A 1VLGA 4TOHA 5CMQA 1DPSA 5GU3X 4LPJA 3VNXA 2Z5QA 1RCIA 1HRSA 3HIUA 2XJNA 2YJJA 2ZA8A 2MGYA 4EVBA 2VXXA 3WNWA 3F34A 3PVYA 2CF7A 2W0OA 2CHPA 2UX1A 5HJFA 2CWLA 2V2NA 3Q4NA 4ISMA 1IERA 2BW1A 2CIHA 5FEJA 2FKZA 3C1YA 2VXIA 4X0JA 5GOUA 3FVBA 4M32A 2QQYA 2ZG7X 5FFCA 4TOBA 3R2HA 4TODA 3LKDA 4ERUA 2PYBA 2CHIA 3AJOA 1XZ1A 3FRSA 2ZG9X 4RC7A 4DI0A 2Y44A 4Z5SA 2Z6MA 1MFRA 4RC5B 2G38B 2V2MA 4Y08A 4IWKA 3KXUA 3UFBA 3R2RA 3V3KB 3HL1A 4KXRB 3C23A 4AM2A 4M35A 3UOFA 3QVDA 4TO9A 4CMYA 4II4A 4YKHA 3VV9A 5GU0X 5D8QA 4MXPA 5E2DA 2FL0A 1ZUJA 3F37A 3FI6A 5LS9A 3QB9A 4ZTTA 2IY4A 3Q4OA 4DYZA 2F7NA 1XZ3A 3PVYB 4DYUA 2X170 3FSEA 3TA8A 3PWQC 2OKCA 3RD0A 4LQJA 4PG1A 3AF8X 1Z6OA 2XJMA 5CZUA 5E1UA 3IS8A 1NFVA 4CMYV 3KA6A 5I4JA 5D8OA 4ZMCA 4PGIA 3WVWA 1QYBA 5D8YA 3OJ5A 3E6RA 1IESA 2Z90A 2C2FA 2OC5A 4RC6A 1QGHA 1JKVA 4ML5A 3N6OA 4XKTA 3JZ9A 3R2SA 3C21A 4IXKA 4CVRA 4TOGA 2C6RA 1AEWA 1Z6OM 2GYDA 2V2LA 5GN8B 2FHAA 4ZKXA 3L0MA 3KWOA 4RC8A 1NNQA 4KVQA 5D8PA 1BG7A 1JYBA 4TW3A 5JKMA 4II4B 3PW1A 3ERZA 4M34A 4QUWA 5JKLG 2V2PA 2OH3A 3Q4RA 5HU6D 4E6KA 4ZL6A 2ZG8X 1LB3A 2ZURX 3AK8A 5K52A 2BJYA 2ZA6A 3QD8A 4ITTA 2HTNA 4LQNA 4R42A 3MPSA 2XJOA 1KRQA 4YXMA 1NF4A 4ZL5A 3W54A 4Z3BA 4OYNA 4YVZA 1TKOA 2V2SA 4RC6B 1F30A 1OTKA 2FG4A 5D8RA 1VEIA 2Z5PA 5LG2A 1O9RA 3KHKA 4LYXA 1YV1A 3C1ZA 4CY9A 3RAVA 3BVIA 3ISFA 1JIGA 3QHCA 3PVTA 3KA3A 4IWJA 3U90A 3A9QA 5D8SA 3O7SA 3E1MA 3F32A 4KVSA 1SOFA 3PWQA 3IQ1A 1JI5A 4LQHA 5FFAA 3PW1B 3E1JA 5GN8A 1LKMA 4DYXA 3E1NA 1JGCA 1JKUA 3R2KA 3GVYA 3T9JA 1JTSA 4XGSA 5HJHA 4MN9A 3AK9A 2AR0A 4ZKWA 1RCGA 1RYTA 3ISEA 2XKQA 3R2OA 4LPMA 1LKPA 3BVFA 3JZAB 1BFRA 1VEQA 3KA8A 1DATA 1JI4A 3AJQA 3QHBA 4CYAA 1LKOA 2C2JA 2WWXB 4KVRA 2WLUA 4TOCA 1VELA 2IB0A 3E1QA 3EZ0A 3EZUA 2V2RA 3PVRA 3F39A 3R2LA 3PVTB 4ISPA 4LPNA 5FFDA 2XGWA 5C6FA 3BVLA 4TOFA 3PW8A 4W4KB 4CYBA 3NP2X 1YUZA 4REUA 2C2UA 5HQOA 4EVEA 2V2IA 3IS7A 2FFXJ 3QZ3A 2Y3QA 4E40A 4A25A 4ETRA 2HR5A 1R03A 5J9VA 1YUXA 3AF9X 3FRRA 2IU2A 4ZLWA 4EVCA 5FFBA 1O9IA 2WLAA 3E1LA 3D19A 3H7GA 4ZJKA 4AM4A 5JACA 2BK6A 2C41A 1FHAA 3PW8C 5AXSA 5ERJA 3UNOA 4TOEA 3WVUA 4TOAA 5CMRA 2YW6A 3UOIA 1S3QA 1JREA 4WJG4 5J93A 2FZFA 3F35A 2ITBA 1BCFA 5JKMG 3PVRB 2GYQA 2FG8A 2JD70 4ZKHA 2WTLA 1MOJA 1DVBA 1RCDA 2YW7A 5JDOA 3WVVA 4ITWA 5J8WA 3AJPA 5LBHA 2N02A 1TKPA 2YJKA 2QF9A 1S30A 1Z4AA 1L8HA 5ERKA 1S2ZA 2V8UA 1B71A 3RE7A 4P18A 4MJYA 1RCEA 1UMNA 3F36A 5K53A 4U3GA 1L8IA 4LQVA 3KX9A 3BT5A 2BKCA 3RBCA 4DASA 4CVSA 1VJXA 3O7RA 5LG8A 2V2OA 3BKNA 3EGMA 2FJCA 2VZBA 3GGZA 3GHQA 5IX6A 3BVKA 3SIDA 2ZA7A 2D5KA 3GE4A 4XKSA 3OGHA 3KA4A 3PZAA 3VVAA 3GGYA 3F33A 4AM5A 3A68A 2V2JA 2CN7A 1TK6A 3M6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GS4 A;  1SQ3 A;  3SE1 A;  1TJO A;  3KA9 A;  4CVP A;  2Z5R A;  4M33 A;  4PG0 A;  3ES3 A;  3Q4Q A;  2CN6 A;  4MUD A;  1GWG A;  1ZS3 A;  2CLU A;  4DZ0 A;  1NF6 A;  3E1O A;  3NP0 X;  4CVT A;  1F33 A;  2RBD A;  3F38 A;  3AF7 X;  2CLB A;  1N1Q A;  3PWF A;  2V15 A;  5GU2 X;  5GU1 X;  1J30 A;  4DE6 A;  5JKL A;  2G4H A;  5J8S A;  4MKU A;  4XKU A;  1EUM A;  4RC7 B;  4DYY A;  3E2C A;  2JD6 0;  3R2M A;  2JD8 0;  3SHX A;  1H96 A;  3NOZ X;  3SH6 A;  5D8X A;  4LYU A;  4MY7 A;  4EVD A;  5FFE A;  4PGK A;  3E1P A;  3E6S A;  1UVH A;  2CEI A;  3RGD A;  3BVE A;  1RCC A;  4RC5 A;  1VLG A;  4TOH A;  5CMQ A;  1DPS A;  5GU3 X;  4LPJ A;  3VNX A;  2Z5Q A;  1RCI A;  1HRS A;  3HIU A;  2XJN A;  2YJJ A;  2ZA8 A;  4EVB A;  2VXX A;  3WNW A;  3F34 A;  3PVY A;  2CF7 A;  2W0O A;  2CHP A;  2UX1 A;  5HJF A;  2V2N A;  3Q4N A;  4ISM A;  1IER A;  2BW1 A;  2CIH A;  5FEJ A;  2FKZ A;  2VXI A;  5GOU A;  3FVB A;  4M32 A;  2QQY A;  2ZG7 X;  5FFC A;  4TOB A;  3R2H A;  4TOD A;  4ERU A;  2PYB A;  2CHI A;  3AJO A;  1XZ1 A;  2ZG9 X;  4RC7 A;  4DI0 A;  4Z5S A;  2Z6M A;  1MFR A;  4RC5 B;  2V2M A;  4Y08 A;  4IWK A;  3KXU A;  3R2R A;  3HL1 A;  4AM2 A;  4M35 A;  3UOF A;  3QVD A;  4TO9 A;  4CMY A;  4II4 A;  4YKH A;  5GU0 X;  5D8Q A;  5E2D A;  2FL0 A;  1ZUJ A;  3F37 A;  3FI6 A;  5LS9 A;  3QB9 A;  4ZTT A;  2IY4 A;  3Q4O A;  4DYZ A;  2F7N A;  1XZ3 A;  3PVY B;  4DYU A;  2X17 0;  3FSE A;  3TA8 A;  3PWQ C;  3RD0 A;  4LQJ A;  4PG1 A;  3AF8 X;  1Z6O A;  2XJM A;  5CZU A;  5E1U A;  3IS8 A;  1NFV A;  4CMY V;  3KA6 A;  5I4J A;  5D8O A;  4ZMC A;  4PGI A;  3WVW A;  1QYB A;  5D8Y A;  3OJ5 A;  3E6R A;  1IES A;  2Z90 A;  2C2F A;  2OC5 A;  4RC6 A;  1QGH A;  1JKV A;  4ML5 A;  4XKT A;  3R2S A;  4IXK A;  4CVR A;  4TOG A;  2C6R A;  1AEW A;  1Z6O M;  2GYD A;  2V2L A;  5GN8 B;  2FHA A;  4ZKX A;  3KWO A;  4RC8 A;  1NNQ A;  4KVQ A;  5D8P A;  1BG7 A;  1JYB A;  4TW3 A;  5JKM A;  4II4 B;  3PW1 A;  3ERZ A;  4M34 A;  4QUW A;  5JKL G;  2V2P A;  2OH3 A;  3Q4R A;  4E6K A;  4ZL6 A;  2ZG8 X;  1LB3 A;  2ZUR X;  3AK8 A;  5K52 A;  2BJY A;  2ZA6 A;  3QD8 A;  4ITT A;  2HTN A;  4LQN A;  4R42 A;  3MPS A;  2XJO A;  1KRQ A;  1NF4 A;  4ZL5 A;  4Z3B A;  4OYN A;  1TKO A;  2V2S A;  4RC6 B;  1F30 A;  1OTK A;  2FG4 A;  5D8R A;  1VEI A;  2Z5P A;  5LG2 A;  1O9R A;  4LYX A;  1YV1 A;  4CY9 A;  3RAV A;  3BVI A;  3ISF A;  1JIG A;  3QHC A;  3PVT A;  3KA3 A;  4IWJ A;  3U90 A;  3A9Q A;  5D8S A;  3O7S A;  3E1M A;  3F32 A;  4KVS A;  1SOF A;  3PWQ A;  3IQ1 A;  1JI5 A;  4LQH A;  5FFA A;  3PW1 B;  3E1J A;  5GN8 A;  1LKM A;  4DYX A;  3E1N A;  1JGC A;  1JKU A;  3R2K A;  3GVY A;  3T9J A;  1JTS A;  4XGS A;  5HJH A;  4MN9 A;  3AK9 A;  4ZKW A;  1RCG A;  1RYT A;  3ISE A;  2XKQ A;  3R2O A;  4LPM A;  1LKP A;  3BVF A;  1BFR A;  1VEQ A;  3KA8 A;  1DAT A;  1JI4 A;  3AJQ A;  3QHB A;  4CYA A;  1LKO A;  2C2J A;  4KVR A;  2WLU A;  4TOC A;  1VEL A;  2IB0 A;  3E1Q A;  3EZ0 A;  3EZU A;  2V2R A;  3PVR A;  3F39 A;  3R2L A;  3PVT B;  4ISP A;  4LPN A;  5FFD A;  2XGW A;  5C6F A;  3BVL A;  4TOF A;  3PW8 A;  4CYB A;  3NP2 X;  1YUZ A;  4REU A;  2C2U A;  5HQO A;  4EVE A;  2V2I A;  3IS7 A;  2FFX J;  3QZ3 A;  2Y3Q A;  4A25 A;  4ETR A;  2HR5 A;  1R03 A;  5J9V A;  1YUX A;  3AF9 X;  2IU2 A;  4ZLW A;  4EVC A;  5FFB A;  1O9I A;  2WLA A;  3E1L A;  3H7G A;  4ZJK A;  4AM4 A;  5JAC A;  2BK6 A;  2C41 A;  1FHA A;  3PW8 C;  5AXS A;  5ERJ A;  3UNO A;  4TOE A;  3WVU A;  4TOA A;  5CMR A;  2YW6 A;  3UOI A;  1S3Q A;  1JRE A;  5J93 A;  2FZF A;  3F35 A;  2ITB A;  1BCF A;  5JKM G;  3PVR B;  2GYQ A;  2FG8 A;  2JD7 0;  4ZKH A;  2WTL A;  1MOJ A;  1DVB A;  1RCD A;  2YW7 A;  3WVV A;  4ITW A;  5J8W A;  3AJP A;  5LBH A;  1TKP A;  2YJK A;  2QF9 A;  1S30 A;  1Z4A A;  1L8H A;  5ERK A;  1S2Z A;  1B71 A;  3RE7 A;  4P18 A;  4MJY A;  1RCE A;  1UMN A;  3F36 A;  5K53 A;  4U3G A;  1L8I A;  4LQV A;  3KX9 A;  3BT5 A;  2BKC A;  3RBC A;  4DAS A;  4CVS A;  1VJX A;  3O7R A;  5LG8 A;  2V2O A;  3BKN A;  3EGM A;  2FJC A;  2VZB A;  3GHQ A;  5IX6 A;  3BVK A;  3SID A;  2ZA7 A;  2D5K A;  3GE4 A;  4XKS A;  3OGH A;  3KA4 A;  3PZA A;  3F33 A;  4AM5 A;  3A68 A;  2V2J A;  2CN7 A;  1TK6 A; 
#chains in the Genus database with same CATH topology
 2GS4 A;  1SQ3 A;  3SE1 A;  1TJO A;  3KA9 A;  4CVP A;  5JDO B;  2Z5R A;  4M33 A;  4PG0 A;  3ES3 A;  4W4L B;  3Q4Q A;  2CN6 A;  4MUD A;  1GWG A;  1ZS3 A;  2CLU A;  4DZ0 A;  1NF6 A;  3E1O A;  3NP0 X;  4CVT A;  1F33 A;  2RBD A;  3F38 A;  3AF7 X;  2CLB A;  1N1Q A;  3PWF A;  2V15 A;  5GU2 X;  5GU1 X;  1J30 A;  4DE6 A;  4YXJ A;  5JKL A;  2G4H A;  5J8S A;  4MKU A;  4XKU A;  1EUM A;  4RC7 B;  4DYY A;  3E2C A;  3KDQ A;  2JD6 0;  3R2M A;  2JD8 0;  3SHX A;  1H96 A;  2V8T A;  3NOZ X;  3SH6 A;  3DBY A;  5D8X A;  4LYU A;  4MY7 A;  4EVD A;  5FFE A;  4PGK A;  3E1P A;  3E6S A;  1UVH A;  2CEI A;  3RGD A;  3BVE A;  1RCC A;  4RC5 A;  1VLG A;  4TOH A;  5CMQ A;  1DPS A;  5GU3 X;  4LPJ A;  3VNX A;  2Z5Q A;  1RCI A;  1HRS A;  3HIU A;  2XJN A;  2YJJ A;  2ZA8 A;  2MGY A;  4EVB A;  2VXX A;  3WNW A;  3F34 A;  3PVY A;  2CF7 A;  2W0O A;  2CHP A;  2UX1 A;  5HJF A;  2CWL A;  2V2N A;  3Q4N A;  4ISM A;  1IER A;  2BW1 A;  2CIH A;  5FEJ A;  2FKZ A;  3C1Y A;  2VXI A;  4X0J A;  5GOU A;  3FVB A;  4M32 A;  2QQY A;  2ZG7 X;  5FFC A;  4TOB A;  3R2H A;  4TOD A;  3LKD A;  4ERU A;  2PYB A;  2CHI A;  3AJO A;  1XZ1 A;  3FRS A;  2ZG9 X;  4RC7 A;  4DI0 A;  2Y44 A;  4Z5S A;  2Z6M A;  1MFR A;  4RC5 B;  2G38 B;  2V2M A;  4Y08 A;  4IWK A;  3KXU A;  3UFB A;  3R2R A;  3V3K B;  3HL1 A;  4KXR B;  3C23 A;  4AM2 A;  4M35 A;  3UOF A;  3QVD A;  4TO9 A;  4CMY A;  4II4 A;  4YKH A;  3VV9 A;  5GU0 X;  5D8Q A;  4MXP A;  5E2D A;  2FL0 A;  1ZUJ A;  3F37 A;  3FI6 A;  5LS9 A;  3QB9 A;  4ZTT A;  2IY4 A;  3Q4O A;  4DYZ A;  2F7N A;  1XZ3 A;  3PVY B;  4DYU A;  2X17 0;  3FSE A;  3TA8 A;  3PWQ C;  2OKC A;  3RD0 A;  4LQJ A;  4PG1 A;  3AF8 X;  1Z6O A;  2XJM A;  5CZU A;  5E1U A;  3IS8 A;  1NFV A;  4CMY V;  3KA6 A;  5I4J A;  5D8O A;  4ZMC A;  4PGI A;  3WVW A;  1QYB A;  5D8Y A;  3OJ5 A;  3E6R A;  1IES A;  2Z90 A;  2C2F A;  2OC5 A;  4RC6 A;  1QGH A;  1JKV A;  4ML5 A;  3N6O A;  4XKT A;  3JZ9 A;  3R2S A;  3C21 A;  4IXK A;  4CVR A;  4TOG A;  2C6R A;  1AEW A;  1Z6O M;  2GYD A;  2V2L A;  5GN8 B;  2FHA A;  4ZKX A;  3L0M A;  3KWO A;  4RC8 A;  1NNQ A;  4KVQ A;  5D8P A;  1BG7 A;  1JYB A;  4TW3 A;  5JKM A;  4II4 B;  3PW1 A;  3ERZ A;  4M34 A;  4QUW A;  5JKL G;  2V2P A;  2OH3 A;  3Q4R A;  5HU6 D;  4E6K A;  4ZL6 A;  2ZG8 X;  1LB3 A;  2ZUR X;  3AK8 A;  5K52 A;  2BJY A;  2ZA6 A;  3QD8 A;  4ITT A;  2HTN A;  4LQN A;  4R42 A;  3MPS A;  2XJO A;  1KRQ A;  4YXM A;  1NF4 A;  4ZL5 A;  3W54 A;  4Z3B A;  4OYN A;  4YVZ A;  1TKO A;  2V2S A;  4RC6 B;  1F30 A;  1OTK A;  2FG4 A;  5D8R A;  1VEI A;  2Z5P A;  5LG2 A;  1O9R A;  3KHK A;  4LYX A;  1YV1 A;  3C1Z A;  4CY9 A;  3RAV A;  3BVI A;  3ISF A;  1JIG A;  3QHC A;  3PVT A;  3KA3 A;  4IWJ A;  3U90 A;  3A9Q A;  5D8S A;  3O7S A;  3E1M A;  3F32 A;  4KVS A;  1SOF A;  3PWQ A;  3IQ1 A;  1JI5 A;  4LQH A;  5FFA A;  3PW1 B;  3E1J A;  5GN8 A;  1LKM A;  4DYX A;  3E1N A;  1JGC A;  1JKU A;  3R2K A;  3GVY A;  3T9J A;  1JTS A;  4XGS A;  5HJH A;  4MN9 A;  3AK9 A;  2AR0 A;  4ZKW A;  1RCG A;  1RYT A;  3ISE A;  2XKQ A;  3R2O A;  4LPM A;  1LKP A;  3BVF A;  3JZA B;  1BFR A;  1VEQ A;  3KA8 A;  1DAT A;  1JI4 A;  3AJQ A;  3QHB A;  4CYA A;  1LKO A;  2C2J A;  2WWX B;  4KVR A;  2WLU A;  4TOC A;  1VEL A;  2IB0 A;  3E1Q A;  3EZ0 A;  3EZU A;  2V2R A;  3PVR A;  3F39 A;  3R2L A;  3PVT B;  4ISP A;  4LPN A;  5FFD A;  2XGW A;  5C6F A;  3BVL A;  4TOF A;  3PW8 A;  4W4K B;  4CYB A;  3NP2 X;  1YUZ A;  4REU A;  2C2U A;  5HQO A;  4EVE A;  2V2I A;  3IS7 A;  2FFX J;  3QZ3 A;  2Y3Q A;  4E40 A;  4A25 A;  4ETR A;  2HR5 A;  1R03 A;  5J9V A;  1YUX A;  3AF9 X;  3FRR A;  2IU2 A;  4ZLW A;  4EVC A;  5FFB A;  1O9I A;  2WLA A;  3E1L A;  3D19 A;  3H7G A;  4ZJK A;  4AM4 A;  5JAC A;  2BK6 A;  2C41 A;  1FHA A;  3PW8 C;  5AXS A;  5ERJ A;  3UNO A;  4TOE A;  3WVU A;  4TOA A;  5CMR A;  2YW6 A;  3UOI A;  1S3Q A;  1JRE A;  4WJG 4;  5J93 A;  2FZF A;  3F35 A;  2ITB A;  1BCF A;  5JKM G;  3PVR B;  2GYQ A;  2FG8 A;  2JD7 0;  4ZKH A;  2WTL A;  1MOJ A;  1DVB A;  1RCD A;  2YW7 A;  5JDO A;  3WVV A;  4ITW A;  5J8W A;  3AJP A;  5LBH A;  2N02 A;  1TKP A;  2YJK A;  2QF9 A;  1S30 A;  1Z4A A;  1L8H A;  5ERK A;  1S2Z A;  2V8U A;  1B71 A;  3RE7 A;  4P18 A;  4MJY A;  1RCE A;  1UMN A;  3F36 A;  5K53 A;  4U3G A;  1L8I A;  4LQV A;  3KX9 A;  3BT5 A;  2BKC A;  3RBC A;  4DAS A;  4CVS A;  1VJX A;  3O7R A;  5LG8 A;  2V2O A;  3BKN A;  3EGM A;  2FJC A;  2VZB A;  3GGZ A;  3GHQ A;  5IX6 A;  3BVK A;  3SID A;  2ZA7 A;  2D5K A;  3GE4 A;  4XKS A;  3OGH A;  3KA4 A;  3PZA A;  3VVA A;  3GGY A;  3F33 A;  4AM5 A;  3A68 A;  2V2J A;  2CN7 A;  1TK6 A;  3M6J A; 
#chains in the Genus database with same CATH homology
 2GS4 A;  1SQ3 A;  3SE1 A;  1TJO A;  3KA9 A;  4CVP A;  5JDO B;  2Z5R A;  4M33 A;  4PG0 A;  3ES3 A;  4W4L B;  3Q4Q A;  2CN6 A;  4MUD A;  1GWG A;  1ZS3 A;  2CLU A;  4DZ0 A;  1NF6 A;  3E1O A;  3NP0 X;  4CVT A;  1F33 A;  2RBD A;  3F38 A;  3AF7 X;  2CLB A;  1N1Q A;  3PWF A;  2V15 A;  5GU2 X;  5GU1 X;  1J30 A;  4DE6 A;  4YXJ A;  5JKL A;  2G4H A;  5J8S A;  4MKU A;  4XKU A;  1EUM A;  4RC7 B;  4DYY A;  3E2C A;  3KDQ A;  2JD6 0;  3R2M A;  2JD8 0;  3SHX A;  1H96 A;  2V8T A;  3NOZ X;  3SH6 A;  3DBY A;  5D8X A;  4LYU A;  4MY7 A;  4EVD A;  5FFE A;  4PGK A;  3E1P A;  3E6S A;  1UVH A;  2CEI A;  3RGD A;  3BVE A;  1RCC A;  4RC5 A;  1VLG A;  4TOH A;  5CMQ A;  1DPS A;  5GU3 X;  4LPJ A;  3VNX A;  2Z5Q A;  1RCI A;  1HRS A;  3HIU A;  2XJN A;  2YJJ A;  2ZA8 A;  2MGY A;  4EVB A;  2VXX A;  3WNW A;  3F34 A;  3PVY A;  2CF7 A;  2W0O A;  2CHP A;  2UX1 A;  5HJF A;  2CWL A;  2V2N A;  3Q4N A;  4ISM A;  1IER A;  2BW1 A;  2CIH A;  5FEJ A;  2FKZ A;  3C1Y A;  2VXI A;  4X0J A;  5GOU A;  3FVB A;  4M32 A;  2QQY A;  2ZG7 X;  5FFC A;  4TOB A;  3R2H A;  4TOD A;  3LKD A;  4ERU A;  2PYB A;  2CHI A;  3AJO A;  1XZ1 A;  3FRS A;  2ZG9 X;  4RC7 A;  4DI0 A;  2Y44 A;  4Z5S A;  2Z6M A;  1MFR A;  4RC5 B;  2G38 B;  2V2M A;  4Y08 A;  4IWK A;  3KXU A;  3UFB A;  3R2R A;  3V3K B;  3HL1 A;  4KXR B;  3C23 A;  4AM2 A;  4M35 A;  3UOF A;  3QVD A;  4TO9 A;  4CMY A;  4II4 A;  4YKH A;  3VV9 A;  5GU0 X;  5D8Q A;  4MXP A;  5E2D A;  2FL0 A;  1ZUJ A;  3F37 A;  3FI6 A;  5LS9 A;  3QB9 A;  4ZTT A;  2IY4 A;  3Q4O A;  4DYZ A;  2F7N A;  1XZ3 A;  3PVY B;  4DYU A;  2X17 0;  3FSE A;  3TA8 A;  3PWQ C;  2OKC A;  3RD0 A;  4LQJ A;  4PG1 A;  3AF8 X;  1Z6O A;  2XJM A;  5CZU A;  5E1U A;  3IS8 A;  1NFV A;  4CMY V;  3KA6 A;  5I4J A;  5D8O A;  4ZMC A;  4PGI A;  3WVW A;  1QYB A;  5D8Y A;  3OJ5 A;  3E6R A;  1IES A;  2Z90 A;  2C2F A;  2OC5 A;  4RC6 A;  1QGH A;  1JKV A;  4ML5 A;  3N6O A;  4XKT A;  3JZ9 A;  3R2S A;  3C21 A;  4IXK A;  4CVR A;  4TOG A;  2C6R A;  1AEW A;  1Z6O M;  2GYD A;  2V2L A;  5GN8 B;  2FHA A;  4ZKX A;  3L0M A;  3KWO A;  4RC8 A;  1NNQ A;  4KVQ A;  5D8P A;  1BG7 A;  1JYB A;  4TW3 A;  5JKM A;  4II4 B;  3PW1 A;  3ERZ A;  4M34 A;  4QUW A;  5JKL G;  2V2P A;  2OH3 A;  3Q4R A;  5HU6 D;  4E6K A;  4ZL6 A;  2ZG8 X;  1LB3 A;  2ZUR X;  3AK8 A;  5K52 A;  2BJY A;  2ZA6 A;  3QD8 A;  4ITT A;  2HTN A;  4LQN A;  4R42 A;  3MPS A;  2XJO A;  1KRQ A;  4YXM A;  1NF4 A;  4ZL5 A;  3W54 A;  4Z3B A;  4OYN A;  4YVZ A;  1TKO A;  2V2S A;  4RC6 B;  1F30 A;  1OTK A;  2FG4 A;  5D8R A;  1VEI A;  2Z5P A;  5LG2 A;  1O9R A;  3KHK A;  4LYX A;  1YV1 A;  3C1Z A;  4CY9 A;  3RAV A;  3BVI A;  3ISF A;  1JIG A;  3QHC A;  3PVT A;  3KA3 A;  4IWJ A;  3U90 A;  3A9Q A;  5D8S A;  3O7S A;  3E1M A;  3F32 A;  4KVS A;  1SOF A;  3PWQ A;  3IQ1 A;  1JI5 A;  4LQH A;  5FFA A;  3PW1 B;  3E1J A;  5GN8 A;  1LKM A;  4DYX A;  3E1N A;  1JGC A;  1JKU A;  3R2K A;  3GVY A;  3T9J A;  1JTS A;  4XGS A;  5HJH A;  4MN9 A;  3AK9 A;  2AR0 A;  4ZKW A;  1RCG A;  1RYT A;  3ISE A;  2XKQ A;  3R2O A;  4LPM A;  1LKP A;  3BVF A;  3JZA B;  1BFR A;  1VEQ A;  3KA8 A;  1DAT A;  1JI4 A;  3AJQ A;  3QHB A;  4CYA A;  1LKO A;  2C2J A;  2WWX B;  4KVR A;  2WLU A;  4TOC A;  1VEL A;  2IB0 A;  3E1Q A;  3EZ0 A;  3EZU A;  2V2R A;  3PVR A;  3F39 A;  3R2L A;  3PVT B;  4ISP A;  4LPN A;  5FFD A;  2XGW A;  5C6F A;  3BVL A;  4TOF A;  3PW8 A;  4W4K B;  4CYB A;  3NP2 X;  1YUZ A;  4REU A;  2C2U A;  5HQO A;  4EVE A;  2V2I A;  3IS7 A;  2FFX J;  3QZ3 A;  2Y3Q A;  4E40 A;  4A25 A;  4ETR A;  2HR5 A;  1R03 A;  5J9V A;  1YUX A;  3AF9 X;  3FRR A;  2IU2 A;  4ZLW A;  4EVC A;  5FFB A;  1O9I A;  2WLA A;  3E1L A;  3D19 A;  3H7G A;  4ZJK A;  4AM4 A;  5JAC A;  2BK6 A;  2C41 A;  1FHA A;  3PW8 C;  5AXS A;  5ERJ A;  3UNO A;  4TOE A;  3WVU A;  4TOA A;  5CMR A;  2YW6 A;  3UOI A;  1S3Q A;  1JRE A;  4WJG 4;  5J93 A;  2FZF A;  3F35 A;  2ITB A;  1BCF A;  5JKM G;  3PVR B;  2GYQ A;  2FG8 A;  2JD7 0;  4ZKH A;  2WTL A;  1MOJ A;  1DVB A;  1RCD A;  2YW7 A;  5JDO A;  3WVV A;  4ITW A;  5J8W A;  3AJP A;  5LBH A;  2N02 A;  1TKP A;  2YJK A;  2QF9 A;  1S30 A;  1Z4A A;  1L8H A;  5ERK A;  1S2Z A;  2V8U A;  1B71 A;  3RE7 A;  4P18 A;  4MJY A;  1RCE A;  1UMN A;  3F36 A;  5K53 A;  4U3G A;  1L8I A;  4LQV A;  3KX9 A;  3BT5 A;  2BKC A;  3RBC A;  4DAS A;  4CVS A;  1VJX A;  3O7R A;  5LG8 A;  2V2O A;  3BKN A;  3EGM A;  2FJC A;  2VZB A;  3GGZ A;  3GHQ A;  5IX6 A;  3BVK A;  3SID A;  2ZA7 A;  2D5K A;  3GE4 A;  4XKS A;  3OGH A;  3KA4 A;  3PZA A;  3VVA A;  3GGY A;  3F33 A;  4AM5 A;  3A68 A;  2V2J A;  2CN7 A;  1TK6 A;  3M6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...