4IWKA

Crystal structure of iron soaked (overnight) ferritin from pseudo-nitzschia multiseries
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
159
structure length
158
Chain Sequence
SEELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVVSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ferritin
publication title Mechanism of ferrous iron binding and oxidation by ferritin from a pennate diatom.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
total genus 71
structure length 158
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4iwkA00
5ERKA 3NP0X 3SIDA 1DATA 2XGWA 2C41A 3AJOA 4CVRA 2W0OA 1NFVA 3NOZX 4RC6A 5K53A 2YW7A 1QGHA 3AF9X 3AK9A 2GS4A 3KA8A 4TOEA 3UOIA 3PZAA 3E2CA 2YW6A 2BK6A 5D8YA 5JKLG 4AM4A 2CF7A 2OH3A 3KXUA 3UNOA 3ERZA 3BVFA 1RCIA 3E1NA 4ZL6A 2PYBA 1EUMA 1S2ZA 1TKPA 3OGHA 3TA8A 2CN6A 1JI4A 5JKLA 5J93A 1BFRA 3QZ3A 3AJPA 4XGSA 3RAVA 4Z3BA 5LG8A 4CMYV 2V2IA 2ZA7A 3HL1A 3SHXA 4ETRA 4LQVA 4MUDA 1VJXA 4ZKHA 2VXIA 2FL0A 2HR5A 1FHAA 2UX1A 2FJCA 2XJNA 4CY9A 3F35A 2Y3QA 1NF6A 1L8IA 4KVRA 5HJHA 2QF9A 3BVKA 2ZA6A 5LBHA 2JD70 5E1UA 5GU0X 1LKOA 3NP2X 4A25A 2V2SA 3IS7A 2IU2A 1RCDA 4DYXA 4EVCA 3SH6A 2ITBA 4YKHA 3R2RA 3PW1B 4E6KA 1F33A 1YV1A 3Q4RA 3R2HA 3RGDA 1O9RA 1Z6OM 1VEQA 4RC7A 1KRQA 3WVWA 2C6RA 3PVTA 1HRSA 2V2RA 2WLAA 3KA6A 3F33A 5J8WA 2ZG8X 3KA4A 1MFRA 3PWQA 3PVYB 5FFDA 3PVRA 4OYNA 2BKCA 4TW3A 4ML5A 1YUXA 3PW8A 2IY4A 3QVDA 4TOGA 4R42A 3O7RA 4LPNA 2V2PA 2C2FA 3RBCA 3F32A 4MY7A 1JYBA 1RCCA 5FFCA 4PG1A 1XZ3A 3RE7A 1JKVA 1JKUA 4MJYA 2CN7A 4ITWA 5C6FA 3F37A 2YJJA 1RCGA 3QHBA 3O7SA 3E1JA 1XZ1A 5D8XA 3BKNA 2RBDA 3H7GA 1AEWA 3R2KA 1LKPA 2FHAA 2Z5QA 2ZG9X 3PVYA 4Y08A 2C2UA 1BG7A 2CHPA 1Z4AA 4CYAA 4AM5A 5AXSA 4ZKWA 1H96A 2WLUA 3PWQC 1S3QA 1F30A 2XJMA 1SQ3A 3WNWA 4ZTTA 3KWOA 5FFAA 4IWJA 2FG8A 1N1QA 1S30A 3R2LA 3IS8A 5GU1X 3E1LA 5JKMG 5CZUA 2CIHA 3E6RA 4RC7B 1OTKA 4KVSA 5GU3X 3PVTB 1R03A 2CLUA 2BW1A 3ISFA 1O9IA 5JACA 5JKMA 5FFEA 3QD8A 1LKMA 2FZFA 2V15A 5D8QA 2CLBA 3PVRB 1VEIA 5D8RA 2CHIA 4ERUA 3R2SA 1NNQA 3QB9A 2BJYA 3Q4NA 4LQHA 1JREA 1YUZA 3ISEA 5IX6A 2WTLA 2Z6MA 3ES3A 4CVTA 5FEJA 3BVLA 4LYUA 1L8HA 1TKOA 2V2MA 4DZ0A 4RC8A 2FFXJ 3EZ0A 3R2MA 3F36A 1UMNA 1GWGA 4EVBA 5I4JA 3UOFA 3EGMA 2C2JA 3R2OA 3SE1A 4LQNA 1ZS3A 4ZJKA 4KVQA 3FI6A 3OJ5A 4DI0A 1JI5A 3WVVA 5E2DA 1DPSA 4M32A 5D8SA 2ZURX 4RC5A 3F38A 5HJFA 3E1PA 4DYZA 1RCEA 3A9QA 3Q4QA 1IESA 2VZBA 4LQJA 3E6SA 3U90A 3F39A 4CYBA 3AK8A 2QQYA 5GU2X 3KX9A 4TOHA 4TOFA 2Z5PA 3RD0A 3WVUA 2G4HA 1TK6A 4II4B 1JGCA 1JTSA 1UVHA 3PW8C 4ZLWA 2V2OA 3QHCA 3E1MA 4MKUA 2V2NA 1NF4A 3FVBA 4ZKXA 4DYYA 2XKQA 1DVBA 1ZUJA 3EZUA 5ERJA 3Q4OA 5D8PA 4DASA 4TOBA 4XKUA 5CMRA 3F34A 2YJKA 4AM2A 3GHQA 3BT5A 2XJOA 5FFBA 2ZA8A 4XKTA 4LPMA 4II4A 2Z90A 5K52A 3FSEA 2IB0A 2VXXA 4CVSA 4XKSA 4QUWA 4DYUA 4M34A 4P18A 1Z6OA 2V2LA 4CVPA 4MN9A 4Z5SA 4RC5B 1QYBA 3AF7X 4EVDA 1JIGA 5GOUA 4IWKA 4TO9A 5J9VA 3A68A 4ISMA 3T9JA 2GYDA 1VLGA 1IERA 4EVEA 2GYQA 2OC5A 3VNXA 3BVIA 3E1OA 2X170 5GN8B 4U3GA 4IXKA 5D8OA 4M35A 4PGKA 1J30A 1RYTA 2JD80 5J8SA 2FG4A 5LG2A 3IQ1A 4LYXA 3BVEA 1MOJA 2FKZA 4ZL5A 3AF8X 3HIUA 2D5KA 4TOCA 3GE4A 2JD60 1SOFA 4RC6B 5CMQA 2F7NA 3KA3A 1LB3A 2Z5RA 1B71A 4ITTA 3PWFA 4LPJA 4PGIA 2ZG7X 4ISPA 2CEIA 3PW1A 5GN8A 3MPSA 5LS9A 4REUA 1TJOA 3KA9A 4TODA 3E1QA 4TOAA 1VELA 3GVYA 2V2JA 4PG0A 4M33A 4ZMCA 4DE6A 5HQOA 1BCFA 4CMYA 3AJQA 2HTNA
chains in the Genus database with same CATH superfamily
5ERKA 3NP0X 3SIDA 4W4LB 3N6OA 3DBYA 1DATA 2XGWA 2C41A 3AJOA 4CVRA 2W0OA 1NFVA 3NOZX 4RC6A 5K53A 2YW7A 1QGHA 3AF9X 3AK9A 2GS4A 3KA8A 4TOEA 3UOIA 3PZAA 3E2CA 2YW6A 2BK6A 5D8YA 5JKLG 4AM4A 2CF7A 2OH3A 3KXUA 3UNOA 3ERZA 3BVFA 1RCIA 3E1NA 4ZL6A 2PYBA 1EUMA 1S2ZA 1TKPA 3OGHA 3TA8A 2G38B 2CN6A 1JI4A 5JKLA 5J93A 1BFRA 3QZ3A 3AJPA 4XGSA 3RAVA 4Z3BA 5LG8A 4CMYV 2V2IA 2ZA7A 3HL1A 3SHXA 4ETRA 4LQVA 4MUDA 1VJXA 4KXRB 4ZKHA 2VXIA 2FL0A 2HR5A 1FHAA 2UX1A 2FJCA 2XJNA 4CY9A 3F35A 2Y3QA 2CWLA 1NF6A 1L8IA 4KVRA 5HJHA 2QF9A 3BVKA 2ZA6A 3W54A 5LBHA 2JD70 5E1UA 5GU0X 1LKOA 4W4KB 3NP2X 4A25A 2V2SA 3IS7A 2IU2A 1RCDA 4DYXA 4EVCA 3SH6A 2ITBA 4YKHA 3R2RA 3PW1B 4E6KA 1F33A 1YV1A 3Q4RA 3R2HA 3RGDA 1O9RA 1Z6OM 1VEQA 3C1ZA 4RC7A 1KRQA 3WVWA 2C6RA 3PVTA 3C21A 1HRSA 2V2RA 2WLAA 3KA6A 4WJG4 3F33A 5J8WA 2ZG8X 3KA4A 1MFRA 3PWQA 3PVYB 5FFDA 3PVRA 4OYNA 2BKCA 4TW3A 4MXPA 4ML5A 1YUXA 3PW8A 2IY4A 3QVDA 4TOGA 4R42A 3O7RA 4LPNA 2V2PA 2C2FA 3RBCA 3F32A 4MY7A 1JYBA 1RCCA 5FFCA 4PG1A 1XZ3A 3RE7A 1JKVA 1JKUA 4MJYA 2CN7A 4ITWA 5C6FA 3F37A 2YJJA 1RCGA 3QHBA 3O7SA 3E1JA 1XZ1A 5D8XA 3BKNA 2RBDA 3H7GA 1AEWA 3R2KA 1LKPA 2FHAA 2Z5QA 2ZG9X 3PVYA 4Y08A 2C2UA 1BG7A 2V8TA 2CHPA 1Z4AA 4X0JA 4CYAA 4AM5A 5AXSA 4ZKWA 1H96A 2WLUA 3PWQC 1S3QA 1F30A 2XJMA 3C1YA 1SQ3A 3WNWA 4YVZA 4ZTTA 3KWOA 5FFAA 4IWJA 2FG8A 1N1QA 1S30A 3R2LA 3IS8A 5GU1X 3E1LA 5JKMG 5CZUA 2CIHA 3KDQA 3E6RA 4RC7B 1OTKA 3FRRA 4KVSA 5GU3X 3PVTB 3LKDA 1R03A 2CLUA 3GGYA 2BW1A 3ISFA 1O9IA 5JACA 5JKMA 5FFEA 3QD8A 1LKMA 2FZFA 2V15A 5D8QA 2CLBA 3PVRB 1VEIA 5D8RA 2CHIA 4ERUA 3R2SA 3JZAB 1NNQA 3QB9A 2BJYA 3KHKA 3Q4NA 4LQHA 1JREA 1YUZA 3ISEA 5IX6A 2WTLA 2Z6MA 3ES3A 4CVTA 3JZ9A 5FEJA 3BVLA 4LYUA 1L8HA 1TKOA 2V2MA 3UFBA 4DZ0A 4RC8A 2FFXJ 3EZ0A 3R2MA 2N02A 3F36A 1UMNA 1GWGA 4EVBA 5I4JA 3UOFA 3EGMA 2C2JA 3R2OA 3SE1A 4LQNA 1ZS3A 4ZJKA 4KVQA 3FI6A 3VVAA 3OJ5A 4DI0A 1JI5A 3WVVA 5E2DA 1DPSA 4YXMA 4M32A 5D8SA 2ZURX 4RC5A 3F38A 3FRSA 5HJFA 3E1PA 4DYZA 1RCEA 3A9QA 3M6JA 3Q4QA 1IESA 2VZBA 4LQJA 3E6SA 3U90A 2V8UA 3F39A 4CYBA 3AK8A 5JDOA 2QQYA 5GU2X 3KX9A 4TOHA 3VV9A 3GGZA 4TOFA 2Z5PA 3RD0A 3WVUA 2G4HA 1TK6A 4II4B 2WWXB 1JGCA 1JTSA 1UVHA 3PW8C 4ZLWA 2V2OA 3QHCA 3E1MA 4MKUA 2V2NA 1NF4A 3FVBA 4ZKXA 4DYYA 2XKQA 1DVBA 1ZUJA 3EZUA 5ERJA 2AR0A 3Q4OA 5D8PA 4DASA 4TOBA 4XKUA 5CMRA 3F34A 2YJKA 4AM2A 3GHQA 3BT5A 2XJOA 5FFBA 2ZA8A 4XKTA 3V3KB 4LPMA 4II4A 2Z90A 2OKCA 5K52A 3FSEA 2IB0A 2VXXA 4CVSA 4XKSA 4QUWA 4DYUA 4M34A 4P18A 1Z6OA 2V2LA 4CVPA 4MN9A 4Z5SA 4RC5B 1QYBA 3AF7X 4EVDA 1JIGA 5GOUA 4IWKA 4YXJA 4TO9A 2Y44A 5J9VA 3A68A 4ISMA 3T9JA 2MGYA 2GYDA 1VLGA 1IERA 4EVEA 2GYQA 2OC5A 3VNXA 3BVIA 3E1OA 2X170 5GN8B 5JDOB 3L0MA 4U3GA 4IXKA 5D8OA 4M35A 4PGKA 1J30A 3D19A 3C23A 4E40A 1RYTA 2JD80 5J8SA 2FG4A 5LG2A 3IQ1A 4LYXA 3BVEA 1MOJA 2FKZA 4ZL5A 3AF8X 3HIUA 2D5KA 4TOCA 3GE4A 2JD60 1SOFA 4RC6B 5CMQA 2F7NA 3KA3A 1LB3A 2Z5RA 5HU6D 1B71A 4ITTA 3PWFA 4LPJA 4PGIA 2ZG7X 4ISPA 2CEIA 3PW1A 5GN8A 3MPSA 5LS9A 4REUA 1TJOA 3KA9A 4TODA 3E1QA 4TOAA 1VELA 3GVYA 2V2JA 4PG0A 4M33A 4ZMCA 4DE6A 5HQOA 1BCFA 4CMYA 3AJQA 2HTNA
chains in the Genus database with same CATH topology
5ERKA 3NP0X 3SIDA 4W4LB 3N6OA 3DBYA 1DATA 2XGWA 2C41A 3AJOA 4CVRA 2W0OA 1NFVA 3NOZX 4RC6A 5K53A 2YW7A 1QGHA 3AF9X 3AK9A 2GS4A 3KA8A 4TOEA 3UOIA 3PZAA 3E2CA 2YW6A 2BK6A 5D8YA 5JKLG 4AM4A 2CF7A 2OH3A 3KXUA 3UNOA 3ERZA 3BVFA 1RCIA 3E1NA 4ZL6A 2PYBA 1EUMA 1S2ZA 1TKPA 3OGHA 3TA8A 2G38B 2CN6A 1JI4A 5JKLA 5J93A 1BFRA 3QZ3A 3AJPA 4XGSA 3RAVA 4Z3BA 5LG8A 4CMYV 2V2IA 2ZA7A 3HL1A 3SHXA 4ETRA 4LQVA 4MUDA 1VJXA 4KXRB 4ZKHA 2VXIA 2FL0A 2HR5A 1FHAA 2UX1A 2FJCA 2XJNA 4CY9A 3F35A 2Y3QA 2CWLA 1NF6A 1L8IA 4KVRA 5HJHA 2QF9A 3BVKA 2ZA6A 3W54A 5LBHA 2JD70 5E1UA 5GU0X 1LKOA 4W4KB 3NP2X 4A25A 2V2SA 3IS7A 2IU2A 1RCDA 4DYXA 4EVCA 3SH6A 2ITBA 4YKHA 3R2RA 3PW1B 4E6KA 1F33A 1YV1A 3Q4RA 3R2HA 3RGDA 1O9RA 1Z6OM 1VEQA 3C1ZA 4RC7A 1KRQA 3WVWA 2C6RA 3PVTA 3C21A 1HRSA 2V2RA 2WLAA 3KA6A 4WJG4 3F33A 5J8WA 2ZG8X 3KA4A 1MFRA 3PWQA 3PVYB 5FFDA 3PVRA 4OYNA 2BKCA 4TW3A 4MXPA 4ML5A 1YUXA 3PW8A 2IY4A 3QVDA 4TOGA 4R42A 3O7RA 4LPNA 2V2PA 2C2FA 3RBCA 3F32A 4MY7A 1JYBA 1RCCA 5FFCA 4PG1A 1XZ3A 3RE7A 1JKVA 1JKUA 4MJYA 2CN7A 4ITWA 5C6FA 3F37A 2YJJA 1RCGA 3QHBA 3O7SA 3E1JA 1XZ1A 5D8XA 3BKNA 2RBDA 3H7GA 1AEWA 3R2KA 1LKPA 2FHAA 2Z5QA 2ZG9X 3PVYA 4Y08A 2C2UA 1BG7A 2V8TA 2CHPA 1Z4AA 4X0JA 4CYAA 4AM5A 5AXSA 4ZKWA 1H96A 2WLUA 3PWQC 1S3QA 1F30A 2XJMA 3C1YA 1SQ3A 3WNWA 4YVZA 4ZTTA 3KWOA 5FFAA 4IWJA 2FG8A 1N1QA 1S30A 3R2LA 3IS8A 5GU1X 3E1LA 5JKMG 5CZUA 2CIHA 3KDQA 3E6RA 4RC7B 1OTKA 3FRRA 4KVSA 5GU3X 3PVTB 3LKDA 1R03A 2CLUA 3GGYA 2BW1A 3ISFA 1O9IA 5JACA 5JKMA 5FFEA 3QD8A 1LKMA 2FZFA 2V15A 5D8QA 2CLBA 3PVRB 1VEIA 5D8RA 2CHIA 4ERUA 3R2SA 3JZAB 1NNQA 3QB9A 2BJYA 3KHKA 3Q4NA 4LQHA 1JREA 1YUZA 3ISEA 5IX6A 2WTLA 2Z6MA 3ES3A 4CVTA 3JZ9A 5FEJA 3BVLA 4LYUA 1L8HA 1TKOA 2V2MA 3UFBA 4DZ0A 4RC8A 2FFXJ 3EZ0A 3R2MA 2N02A 3F36A 1UMNA 1GWGA 4EVBA 5I4JA 3UOFA 3EGMA 2C2JA 3R2OA 3SE1A 4LQNA 1ZS3A 4ZJKA 4KVQA 3FI6A 3VVAA 3OJ5A 4DI0A 1JI5A 3WVVA 5E2DA 1DPSA 4YXMA 4M32A 5D8SA 2ZURX 4RC5A 3F38A 3FRSA 5HJFA 3E1PA 4DYZA 1RCEA 3A9QA 3M6JA 3Q4QA 1IESA 2VZBA 4LQJA 3E6SA 3U90A 2V8UA 3F39A 4CYBA 3AK8A 5JDOA 2QQYA 5GU2X 3KX9A 4TOHA 3VV9A 3GGZA 4TOFA 2Z5PA 3RD0A 3WVUA 2G4HA 1TK6A 4II4B 2WWXB 1JGCA 1JTSA 1UVHA 3PW8C 4ZLWA 2V2OA 3QHCA 3E1MA 4MKUA 2V2NA 1NF4A 3FVBA 4ZKXA 4DYYA 2XKQA 1DVBA 1ZUJA 3EZUA 5ERJA 2AR0A 3Q4OA 5D8PA 4DASA 4TOBA 4XKUA 5CMRA 3F34A 2YJKA 4AM2A 3GHQA 3BT5A 2XJOA 5FFBA 2ZA8A 4XKTA 3V3KB 4LPMA 4II4A 2Z90A 2OKCA 5K52A 3FSEA 2IB0A 2VXXA 4CVSA 4XKSA 4QUWA 4DYUA 4M34A 4P18A 1Z6OA 2V2LA 4CVPA 4MN9A 4Z5SA 4RC5B 1QYBA 3AF7X 4EVDA 1JIGA 5GOUA 4IWKA 4YXJA 4TO9A 2Y44A 5J9VA 3A68A 4ISMA 3T9JA 2MGYA 2GYDA 1VLGA 1IERA 4EVEA 2GYQA 2OC5A 3VNXA 3BVIA 3E1OA 2X170 5GN8B 5JDOB 3L0MA 4U3GA 4IXKA 5D8OA 4M35A 4PGKA 1J30A 3D19A 3C23A 4E40A 1RYTA 2JD80 5J8SA 2FG4A 5LG2A 3IQ1A 4LYXA 3BVEA 1MOJA 2FKZA 4ZL5A 3AF8X 3HIUA 2D5KA 4TOCA 3GE4A 2JD60 1SOFA 4RC6B 5CMQA 2F7NA 3KA3A 1LB3A 2Z5RA 5HU6D 1B71A 4ITTA 3PWFA 4LPJA 4PGIA 2ZG7X 4ISPA 2CEIA 3PW1A 5GN8A 3MPSA 5LS9A 4REUA 1TJOA 3KA9A 4TODA 3E1QA 4TOAA 1VELA 3GVYA 2V2JA 4PG0A 4M33A 4ZMCA 4DE6A 5HQOA 1BCFA 4CMYA 3AJQA 2HTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ERK A;  3NP0 X;  3SID A;  1DAT A;  2XGW A;  2C41 A;  3AJO A;  4CVR A;  2W0O A;  1NFV A;  3NOZ X;  4RC6 A;  5K53 A;  2YW7 A;  1QGH A;  3AF9 X;  3AK9 A;  2GS4 A;  3KA8 A;  4TOE A;  3UOI A;  3PZA A;  3E2C A;  2YW6 A;  2BK6 A;  5D8Y A;  5JKL G;  4AM4 A;  2CF7 A;  2OH3 A;  3KXU A;  3UNO A;  3ERZ A;  3BVF A;  1RCI A;  3E1N A;  4ZL6 A;  2PYB A;  1EUM A;  1S2Z A;  1TKP A;  3OGH A;  3TA8 A;  2CN6 A;  1JI4 A;  5JKL A;  5J93 A;  1BFR A;  3QZ3 A;  3AJP A;  4XGS A;  3RAV A;  4Z3B A;  5LG8 A;  4CMY V;  2V2I A;  2ZA7 A;  3HL1 A;  3SHX A;  4ETR A;  4LQV A;  4MUD A;  1VJX A;  4ZKH A;  2VXI A;  2FL0 A;  2HR5 A;  1FHA A;  2UX1 A;  2FJC A;  2XJN A;  4CY9 A;  3F35 A;  2Y3Q A;  1NF6 A;  1L8I A;  4KVR A;  5HJH A;  2QF9 A;  3BVK A;  2ZA6 A;  5LBH A;  2JD7 0;  5E1U A;  5GU0 X;  1LKO A;  3NP2 X;  4A25 A;  2V2S A;  3IS7 A;  2IU2 A;  1RCD A;  4DYX A;  4EVC A;  3SH6 A;  2ITB A;  4YKH A;  3R2R A;  3PW1 B;  4E6K A;  1F33 A;  1YV1 A;  3Q4R A;  3R2H A;  3RGD A;  1O9R A;  1Z6O M;  1VEQ A;  4RC7 A;  1KRQ A;  3WVW A;  2C6R A;  3PVT A;  1HRS A;  2V2R A;  2WLA A;  3KA6 A;  3F33 A;  5J8W A;  2ZG8 X;  3KA4 A;  1MFR A;  3PWQ A;  3PVY B;  5FFD A;  3PVR A;  4OYN A;  2BKC A;  4TW3 A;  4ML5 A;  1YUX A;  3PW8 A;  2IY4 A;  3QVD A;  4TOG A;  4R42 A;  3O7R A;  4LPN A;  2V2P A;  2C2F A;  3RBC A;  3F32 A;  4MY7 A;  1JYB A;  1RCC A;  5FFC A;  4PG1 A;  1XZ3 A;  3RE7 A;  1JKV A;  1JKU A;  4MJY A;  2CN7 A;  4ITW A;  5C6F A;  3F37 A;  2YJJ A;  1RCG A;  3QHB A;  3O7S A;  3E1J A;  1XZ1 A;  5D8X A;  3BKN A;  2RBD A;  3H7G A;  1AEW A;  3R2K A;  1LKP A;  2FHA A;  2Z5Q A;  2ZG9 X;  3PVY A;  4Y08 A;  2C2U A;  1BG7 A;  2CHP A;  1Z4A A;  4CYA A;  4AM5 A;  5AXS A;  4ZKW A;  1H96 A;  2WLU A;  3PWQ C;  1S3Q A;  1F30 A;  2XJM A;  1SQ3 A;  3WNW A;  4ZTT A;  3KWO A;  5FFA A;  4IWJ A;  2FG8 A;  1N1Q A;  1S30 A;  3R2L A;  3IS8 A;  5GU1 X;  3E1L A;  5JKM G;  5CZU A;  2CIH A;  3E6R A;  4RC7 B;  1OTK A;  4KVS A;  5GU3 X;  3PVT B;  1R03 A;  2CLU A;  2BW1 A;  3ISF A;  1O9I A;  5JAC A;  5JKM A;  5FFE A;  3QD8 A;  1LKM A;  2FZF A;  2V15 A;  5D8Q A;  2CLB A;  3PVR B;  1VEI A;  5D8R A;  2CHI A;  4ERU A;  3R2S A;  1NNQ A;  3QB9 A;  2BJY A;  3Q4N A;  4LQH A;  1JRE A;  1YUZ A;  3ISE A;  5IX6 A;  2WTL A;  2Z6M A;  3ES3 A;  4CVT A;  5FEJ A;  3BVL A;  4LYU A;  1L8H A;  1TKO A;  2V2M A;  4DZ0 A;  4RC8 A;  2FFX J;  3EZ0 A;  3R2M A;  3F36 A;  1UMN A;  1GWG A;  4EVB A;  5I4J A;  3UOF A;  3EGM A;  2C2J A;  3R2O A;  3SE1 A;  4LQN A;  1ZS3 A;  4ZJK A;  4KVQ A;  3FI6 A;  3OJ5 A;  4DI0 A;  1JI5 A;  3WVV A;  5E2D A;  1DPS A;  4M32 A;  5D8S A;  2ZUR X;  4RC5 A;  3F38 A;  5HJF A;  3E1P A;  4DYZ A;  1RCE A;  3A9Q A;  3Q4Q A;  1IES A;  2VZB A;  4LQJ A;  3E6S A;  3U90 A;  3F39 A;  4CYB A;  3AK8 A;  2QQY A;  5GU2 X;  3KX9 A;  4TOH A;  4TOF A;  2Z5P A;  3RD0 A;  3WVU A;  2G4H A;  1TK6 A;  4II4 B;  1JGC A;  1JTS A;  1UVH A;  3PW8 C;  4ZLW A;  2V2O A;  3QHC A;  3E1M A;  4MKU A;  2V2N A;  1NF4 A;  3FVB A;  4ZKX A;  4DYY A;  2XKQ A;  1DVB A;  1ZUJ A;  3EZU A;  5ERJ A;  3Q4O A;  5D8P A;  4DAS A;  4TOB A;  4XKU A;  5CMR A;  3F34 A;  2YJK A;  4AM2 A;  3GHQ A;  3BT5 A;  2XJO A;  5FFB A;  2ZA8 A;  4XKT A;  4LPM A;  4II4 A;  2Z90 A;  5K52 A;  3FSE A;  2IB0 A;  2VXX A;  4CVS A;  4XKS A;  4QUW A;  4DYU A;  4M34 A;  4P18 A;  1Z6O A;  2V2L A;  4CVP A;  4MN9 A;  4Z5S A;  4RC5 B;  1QYB A;  3AF7 X;  4EVD A;  1JIG A;  5GOU A;  4IWK A;  4TO9 A;  5J9V A;  3A68 A;  4ISM A;  3T9J A;  2GYD A;  1VLG A;  1IER A;  4EVE A;  2GYQ A;  2OC5 A;  3VNX A;  3BVI A;  3E1O A;  2X17 0;  5GN8 B;  4U3G A;  4IXK A;  5D8O A;  4M35 A;  4PGK A;  1J30 A;  1RYT A;  2JD8 0;  5J8S A;  2FG4 A;  5LG2 A;  3IQ1 A;  4LYX A;  3BVE A;  1MOJ A;  2FKZ A;  4ZL5 A;  3AF8 X;  3HIU A;  2D5K A;  4TOC A;  3GE4 A;  2JD6 0;  1SOF A;  4RC6 B;  5CMQ A;  2F7N A;  3KA3 A;  1LB3 A;  2Z5R A;  1B71 A;  4ITT A;  3PWF A;  4LPJ A;  4PGI A;  2ZG7 X;  4ISP A;  2CEI A;  3PW1 A;  5GN8 A;  3MPS A;  5LS9 A;  4REU A;  1TJO A;  3KA9 A;  4TOD A;  3E1Q A;  4TOA A;  1VEL A;  3GVY A;  2V2J A;  4PG0 A;  4M33 A;  4ZMC A;  4DE6 A;  5HQO A;  1BCF A;  4CMY A;  3AJQ A;  2HTN A; 
#chains in the Genus database with same CATH topology
 5ERK A;  3NP0 X;  3SID A;  4W4L B;  3N6O A;  3DBY A;  1DAT A;  2XGW A;  2C41 A;  3AJO A;  4CVR A;  2W0O A;  1NFV A;  3NOZ X;  4RC6 A;  5K53 A;  2YW7 A;  1QGH A;  3AF9 X;  3AK9 A;  2GS4 A;  3KA8 A;  4TOE A;  3UOI A;  3PZA A;  3E2C A;  2YW6 A;  2BK6 A;  5D8Y A;  5JKL G;  4AM4 A;  2CF7 A;  2OH3 A;  3KXU A;  3UNO A;  3ERZ A;  3BVF A;  1RCI A;  3E1N A;  4ZL6 A;  2PYB A;  1EUM A;  1S2Z A;  1TKP A;  3OGH A;  3TA8 A;  2G38 B;  2CN6 A;  1JI4 A;  5JKL A;  5J93 A;  1BFR A;  3QZ3 A;  3AJP A;  4XGS A;  3RAV A;  4Z3B A;  5LG8 A;  4CMY V;  2V2I A;  2ZA7 A;  3HL1 A;  3SHX A;  4ETR A;  4LQV A;  4MUD A;  1VJX A;  4KXR B;  4ZKH A;  2VXI A;  2FL0 A;  2HR5 A;  1FHA A;  2UX1 A;  2FJC A;  2XJN A;  4CY9 A;  3F35 A;  2Y3Q A;  2CWL A;  1NF6 A;  1L8I A;  4KVR A;  5HJH A;  2QF9 A;  3BVK A;  2ZA6 A;  3W54 A;  5LBH A;  2JD7 0;  5E1U A;  5GU0 X;  1LKO A;  4W4K B;  3NP2 X;  4A25 A;  2V2S A;  3IS7 A;  2IU2 A;  1RCD A;  4DYX A;  4EVC A;  3SH6 A;  2ITB A;  4YKH A;  3R2R A;  3PW1 B;  4E6K A;  1F33 A;  1YV1 A;  3Q4R A;  3R2H A;  3RGD A;  1O9R A;  1Z6O M;  1VEQ A;  3C1Z A;  4RC7 A;  1KRQ A;  3WVW A;  2C6R A;  3PVT A;  3C21 A;  1HRS A;  2V2R A;  2WLA A;  3KA6 A;  4WJG 4;  3F33 A;  5J8W A;  2ZG8 X;  3KA4 A;  1MFR A;  3PWQ A;  3PVY B;  5FFD A;  3PVR A;  4OYN A;  2BKC A;  4TW3 A;  4MXP A;  4ML5 A;  1YUX A;  3PW8 A;  2IY4 A;  3QVD A;  4TOG A;  4R42 A;  3O7R A;  4LPN A;  2V2P A;  2C2F A;  3RBC A;  3F32 A;  4MY7 A;  1JYB A;  1RCC A;  5FFC A;  4PG1 A;  1XZ3 A;  3RE7 A;  1JKV A;  1JKU A;  4MJY A;  2CN7 A;  4ITW A;  5C6F A;  3F37 A;  2YJJ A;  1RCG A;  3QHB A;  3O7S A;  3E1J A;  1XZ1 A;  5D8X A;  3BKN A;  2RBD A;  3H7G A;  1AEW A;  3R2K A;  1LKP A;  2FHA A;  2Z5Q A;  2ZG9 X;  3PVY A;  4Y08 A;  2C2U A;  1BG7 A;  2V8T A;  2CHP A;  1Z4A A;  4X0J A;  4CYA A;  4AM5 A;  5AXS A;  4ZKW A;  1H96 A;  2WLU A;  3PWQ C;  1S3Q A;  1F30 A;  2XJM A;  3C1Y A;  1SQ3 A;  3WNW A;  4YVZ A;  4ZTT A;  3KWO A;  5FFA A;  4IWJ A;  2FG8 A;  1N1Q A;  1S30 A;  3R2L A;  3IS8 A;  5GU1 X;  3E1L A;  5JKM G;  5CZU A;  2CIH A;  3KDQ A;  3E6R A;  4RC7 B;  1OTK A;  3FRR A;  4KVS A;  5GU3 X;  3PVT B;  3LKD A;  1R03 A;  2CLU A;  3GGY A;  2BW1 A;  3ISF A;  1O9I A;  5JAC A;  5JKM A;  5FFE A;  3QD8 A;  1LKM A;  2FZF A;  2V15 A;  5D8Q A;  2CLB A;  3PVR B;  1VEI A;  5D8R A;  2CHI A;  4ERU A;  3R2S A;  3JZA B;  1NNQ A;  3QB9 A;  2BJY A;  3KHK A;  3Q4N A;  4LQH A;  1JRE A;  1YUZ A;  3ISE A;  5IX6 A;  2WTL A;  2Z6M A;  3ES3 A;  4CVT A;  3JZ9 A;  5FEJ A;  3BVL A;  4LYU A;  1L8H A;  1TKO A;  2V2M A;  3UFB A;  4DZ0 A;  4RC8 A;  2FFX J;  3EZ0 A;  3R2M A;  2N02 A;  3F36 A;  1UMN A;  1GWG A;  4EVB A;  5I4J A;  3UOF A;  3EGM A;  2C2J A;  3R2O A;  3SE1 A;  4LQN A;  1ZS3 A;  4ZJK A;  4KVQ A;  3FI6 A;  3VVA A;  3OJ5 A;  4DI0 A;  1JI5 A;  3WVV A;  5E2D A;  1DPS A;  4YXM A;  4M32 A;  5D8S A;  2ZUR X;  4RC5 A;  3F38 A;  3FRS A;  5HJF A;  3E1P A;  4DYZ A;  1RCE A;  3A9Q A;  3M6J A;  3Q4Q A;  1IES A;  2VZB A;  4LQJ A;  3E6S A;  3U90 A;  2V8U A;  3F39 A;  4CYB A;  3AK8 A;  5JDO A;  2QQY A;  5GU2 X;  3KX9 A;  4TOH A;  3VV9 A;  3GGZ A;  4TOF A;  2Z5P A;  3RD0 A;  3WVU A;  2G4H A;  1TK6 A;  4II4 B;  2WWX B;  1JGC A;  1JTS A;  1UVH A;  3PW8 C;  4ZLW A;  2V2O A;  3QHC A;  3E1M A;  4MKU A;  2V2N A;  1NF4 A;  3FVB A;  4ZKX A;  4DYY A;  2XKQ A;  1DVB A;  1ZUJ A;  3EZU A;  5ERJ A;  2AR0 A;  3Q4O A;  5D8P A;  4DAS A;  4TOB A;  4XKU A;  5CMR A;  3F34 A;  2YJK A;  4AM2 A;  3GHQ A;  3BT5 A;  2XJO A;  5FFB A;  2ZA8 A;  4XKT A;  3V3K B;  4LPM A;  4II4 A;  2Z90 A;  2OKC A;  5K52 A;  3FSE A;  2IB0 A;  2VXX A;  4CVS A;  4XKS A;  4QUW A;  4DYU A;  4M34 A;  4P18 A;  1Z6O A;  2V2L A;  4CVP A;  4MN9 A;  4Z5S A;  4RC5 B;  1QYB A;  3AF7 X;  4EVD A;  1JIG A;  5GOU A;  4IWK A;  4YXJ A;  4TO9 A;  2Y44 A;  5J9V A;  3A68 A;  4ISM A;  3T9J A;  2MGY A;  2GYD A;  1VLG A;  1IER A;  4EVE A;  2GYQ A;  2OC5 A;  3VNX A;  3BVI A;  3E1O A;  2X17 0;  5GN8 B;  5JDO B;  3L0M A;  4U3G A;  4IXK A;  5D8O A;  4M35 A;  4PGK A;  1J30 A;  3D19 A;  3C23 A;  4E40 A;  1RYT A;  2JD8 0;  5J8S A;  2FG4 A;  5LG2 A;  3IQ1 A;  4LYX A;  3BVE A;  1MOJ A;  2FKZ A;  4ZL5 A;  3AF8 X;  3HIU A;  2D5K A;  4TOC A;  3GE4 A;  2JD6 0;  1SOF A;  4RC6 B;  5CMQ A;  2F7N A;  3KA3 A;  1LB3 A;  2Z5R A;  5HU6 D;  1B71 A;  4ITT A;  3PWF A;  4LPJ A;  4PGI A;  2ZG7 X;  4ISP A;  2CEI A;  3PW1 A;  5GN8 A;  3MPS A;  5LS9 A;  4REU A;  1TJO A;  3KA9 A;  4TOD A;  3E1Q A;  4TOA A;  1VEL A;  3GVY A;  2V2J A;  4PG0 A;  4M33 A;  4ZMC A;  4DE6 A;  5HQO A;  1BCF A;  4CMY A;  3AJQ A;  2HTN A; 
#chains in the Genus database with same CATH homology
 5ERK A;  3NP0 X;  3SID A;  4W4L B;  3N6O A;  3DBY A;  1DAT A;  2XGW A;  2C41 A;  3AJO A;  4CVR A;  2W0O A;  1NFV A;  3NOZ X;  4RC6 A;  5K53 A;  2YW7 A;  1QGH A;  3AF9 X;  3AK9 A;  2GS4 A;  3KA8 A;  4TOE A;  3UOI A;  3PZA A;  3E2C A;  2YW6 A;  2BK6 A;  5D8Y A;  5JKL G;  4AM4 A;  2CF7 A;  2OH3 A;  3KXU A;  3UNO A;  3ERZ A;  3BVF A;  1RCI A;  3E1N A;  4ZL6 A;  2PYB A;  1EUM A;  1S2Z A;  1TKP A;  3OGH A;  3TA8 A;  2G38 B;  2CN6 A;  1JI4 A;  5JKL A;  5J93 A;  1BFR A;  3QZ3 A;  3AJP A;  4XGS A;  3RAV A;  4Z3B A;  5LG8 A;  4CMY V;  2V2I A;  2ZA7 A;  3HL1 A;  3SHX A;  4ETR A;  4LQV A;  4MUD A;  1VJX A;  4KXR B;  4ZKH A;  2VXI A;  2FL0 A;  2HR5 A;  1FHA A;  2UX1 A;  2FJC A;  2XJN A;  4CY9 A;  3F35 A;  2Y3Q A;  2CWL A;  1NF6 A;  1L8I A;  4KVR A;  5HJH A;  2QF9 A;  3BVK A;  2ZA6 A;  3W54 A;  5LBH A;  2JD7 0;  5E1U A;  5GU0 X;  1LKO A;  4W4K B;  3NP2 X;  4A25 A;  2V2S A;  3IS7 A;  2IU2 A;  1RCD A;  4DYX A;  4EVC A;  3SH6 A;  2ITB A;  4YKH A;  3R2R A;  3PW1 B;  4E6K A;  1F33 A;  1YV1 A;  3Q4R A;  3R2H A;  3RGD A;  1O9R A;  1Z6O M;  1VEQ A;  3C1Z A;  4RC7 A;  1KRQ A;  3WVW A;  2C6R A;  3PVT A;  3C21 A;  1HRS A;  2V2R A;  2WLA A;  3KA6 A;  4WJG 4;  3F33 A;  5J8W A;  2ZG8 X;  3KA4 A;  1MFR A;  3PWQ A;  3PVY B;  5FFD A;  3PVR A;  4OYN A;  2BKC A;  4TW3 A;  4MXP A;  4ML5 A;  1YUX A;  3PW8 A;  2IY4 A;  3QVD A;  4TOG A;  4R42 A;  3O7R A;  4LPN A;  2V2P A;  2C2F A;  3RBC A;  3F32 A;  4MY7 A;  1JYB A;  1RCC A;  5FFC A;  4PG1 A;  1XZ3 A;  3RE7 A;  1JKV A;  1JKU A;  4MJY A;  2CN7 A;  4ITW A;  5C6F A;  3F37 A;  2YJJ A;  1RCG A;  3QHB A;  3O7S A;  3E1J A;  1XZ1 A;  5D8X A;  3BKN A;  2RBD A;  3H7G A;  1AEW A;  3R2K A;  1LKP A;  2FHA A;  2Z5Q A;  2ZG9 X;  3PVY A;  4Y08 A;  2C2U A;  1BG7 A;  2V8T A;  2CHP A;  1Z4A A;  4X0J A;  4CYA A;  4AM5 A;  5AXS A;  4ZKW A;  1H96 A;  2WLU A;  3PWQ C;  1S3Q A;  1F30 A;  2XJM A;  3C1Y A;  1SQ3 A;  3WNW A;  4YVZ A;  4ZTT A;  3KWO A;  5FFA A;  4IWJ A;  2FG8 A;  1N1Q A;  1S30 A;  3R2L A;  3IS8 A;  5GU1 X;  3E1L A;  5JKM G;  5CZU A;  2CIH A;  3KDQ A;  3E6R A;  4RC7 B;  1OTK A;  3FRR A;  4KVS A;  5GU3 X;  3PVT B;  3LKD A;  1R03 A;  2CLU A;  3GGY A;  2BW1 A;  3ISF A;  1O9I A;  5JAC A;  5JKM A;  5FFE A;  3QD8 A;  1LKM A;  2FZF A;  2V15 A;  5D8Q A;  2CLB A;  3PVR B;  1VEI A;  5D8R A;  2CHI A;  4ERU A;  3R2S A;  3JZA B;  1NNQ A;  3QB9 A;  2BJY A;  3KHK A;  3Q4N A;  4LQH A;  1JRE A;  1YUZ A;  3ISE A;  5IX6 A;  2WTL A;  2Z6M A;  3ES3 A;  4CVT A;  3JZ9 A;  5FEJ A;  3BVL A;  4LYU A;  1L8H A;  1TKO A;  2V2M A;  3UFB A;  4DZ0 A;  4RC8 A;  2FFX J;  3EZ0 A;  3R2M A;  2N02 A;  3F36 A;  1UMN A;  1GWG A;  4EVB A;  5I4J A;  3UOF A;  3EGM A;  2C2J A;  3R2O A;  3SE1 A;  4LQN A;  1ZS3 A;  4ZJK A;  4KVQ A;  3FI6 A;  3VVA A;  3OJ5 A;  4DI0 A;  1JI5 A;  3WVV A;  5E2D A;  1DPS A;  4YXM A;  4M32 A;  5D8S A;  2ZUR X;  4RC5 A;  3F38 A;  3FRS A;  5HJF A;  3E1P A;  4DYZ A;  1RCE A;  3A9Q A;  3M6J A;  3Q4Q A;  1IES A;  2VZB A;  4LQJ A;  3E6S A;  3U90 A;  2V8U A;  3F39 A;  4CYB A;  3AK8 A;  5JDO A;  2QQY A;  5GU2 X;  3KX9 A;  4TOH A;  3VV9 A;  3GGZ A;  4TOF A;  2Z5P A;  3RD0 A;  3WVU A;  2G4H A;  1TK6 A;  4II4 B;  2WWX B;  1JGC A;  1JTS A;  1UVH A;  3PW8 C;  4ZLW A;  2V2O A;  3QHC A;  3E1M A;  4MKU A;  2V2N A;  1NF4 A;  3FVB A;  4ZKX A;  4DYY A;  2XKQ A;  1DVB A;  1ZUJ A;  3EZU A;  5ERJ A;  2AR0 A;  3Q4O A;  5D8P A;  4DAS A;  4TOB A;  4XKU A;  5CMR A;  3F34 A;  2YJK A;  4AM2 A;  3GHQ A;  3BT5 A;  2XJO A;  5FFB A;  2ZA8 A;  4XKT A;  3V3K B;  4LPM A;  4II4 A;  2Z90 A;  2OKC A;  5K52 A;  3FSE A;  2IB0 A;  2VXX A;  4CVS A;  4XKS A;  4QUW A;  4DYU A;  4M34 A;  4P18 A;  1Z6O A;  2V2L A;  4CVP A;  4MN9 A;  4Z5S A;  4RC5 B;  1QYB A;  3AF7 X;  4EVD A;  1JIG A;  5GOU A;  4IWK A;  4YXJ A;  4TO9 A;  2Y44 A;  5J9V A;  3A68 A;  4ISM A;  3T9J A;  2MGY A;  2GYD A;  1VLG A;  1IER A;  4EVE A;  2GYQ A;  2OC5 A;  3VNX A;  3BVI A;  3E1O A;  2X17 0;  5GN8 B;  5JDO B;  3L0M A;  4U3G A;  4IXK A;  5D8O A;  4M35 A;  4PGK A;  1J30 A;  3D19 A;  3C23 A;  4E40 A;  1RYT A;  2JD8 0;  5J8S A;  2FG4 A;  5LG2 A;  3IQ1 A;  4LYX A;  3BVE A;  1MOJ A;  2FKZ A;  4ZL5 A;  3AF8 X;  3HIU A;  2D5K A;  4TOC A;  3GE4 A;  2JD6 0;  1SOF A;  4RC6 B;  5CMQ A;  2F7N A;  3KA3 A;  1LB3 A;  2Z5R A;  5HU6 D;  1B71 A;  4ITT A;  3PWF A;  4LPJ A;  4PGI A;  2ZG7 X;  4ISP A;  2CEI A;  3PW1 A;  5GN8 A;  3MPS A;  5LS9 A;  4REU A;  1TJO A;  3KA9 A;  4TOD A;  3E1Q A;  4TOA A;  1VEL A;  3GVY A;  2V2J A;  4PG0 A;  4M33 A;  4ZMC A;  4DE6 A;  5HQO A;  1BCF A;  4CMY A;  3AJQ A;  2HTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...