4IWKA

Crystal structure of iron soaked (overnight) ferritin from pseudo-nitzschia multiseries
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
159
structure length
158
Chain Sequence
SEELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVVSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title Mechanism of ferrous iron binding and oxidation by ferritin from a pennate diatom.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
molecule tags Transport protein
total genus 71
structure length 158
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4iwkA00
4XKUA 2RBDA 1Z6OA 2CHIA 4ZJKA 1RCIA 4LYUA 1EUMA 2XGWA 3KXUA 3F35A 2IU2A 3E6SA 2ZG8X 3PVYA 4M34A 3R2SA 4LPNA 4DI0A 2V2RA 5D8SA 3QZ3A 3QHBA 3F38A 2VXXA 4RC7A 3EGMA 2CLBA 1LKPA 4IWKA 1JI5A 3O7RA 4TODA 2YW7A 2FG4A 5K52A 2V2SA 1ZUJA 4DZ0A 4TOHA 5GN8B 4II4B 1S30A 3IS8A 1R03A 2GYQA 2XKQA 3AF9X 5JACA 5I4JA 4LPMA 3QHCA 4REUA 1BG7A 4CVSA 1JKVA 2G4HA 2GYDA 3E2CA 3R2LA 4E6KA 2CF7A 1H96A 5K53A 4CYBA 1MOJA 1XZ3A 3OJ5A 3E1PA 2HTNA 2QF9A 2CLUA 3ISFA 4EVDA 5D8QA 3KA6A 3BVFA 5AXSA 5JKMA 5FFEA 3VNXA 4P18A 1ZS3A 2V2MA 4ZTTA 2ZA6A 1JIGA 3WVUA 4PG1A 4TOFA 4U3GA 4ISMA 3AF8X 3RAVA 2W0OA 4M33A 5E1UA 2CHPA 4CY9A 4PG0A 3ES3A 2ZG9X 2YJKA 1KRQA 3PW1B 1F30A 4TOEA 3FVBA 4ZKXA 4LQVA 5GN8A 5LG8A 4II4A 4DYZA 4R42A 1TKPA 1IESA 1JGCA 3BVLA 3IQ1A 2ZURX 3KA8A 4XGSA 4XKTA 2YW6A 1L8IA 2V2PA 1BFRA 3BT5A 4TO9A 2WLUA 5GOUA 3E1MA 5D8YA 4LPJA 3FSEA 1LKMA 4AM5A 1VEIA 3EZ0A 1LB3A 3GVYA 1QGHA 3WVVA 3KA9A 3KA4A 4M35A 5J93A 5C6FA 3RBCA 1DVBA 2C6RA 1VLGA 2BK6A 3AJOA 4Z3BA 3R2MA 4MKUA 5J9VA 1JI4A 5GU2X 4KVSA 5FEJA 5CMRA 1UVHA 3ERZA 4CVPA 5FFAA 2JD80 3KA3A 1L8HA 3PWFA 3OGHA 2ZA8A 3F39A 3RE7A 3SH6A 1DATA 2CN7A 3PW1A 4CVTA 3FI6A 1SOFA 4DASA 4XKSA 2Z5QA 3GHQA 2BJYA 4OYNA 3ISEA 3HL1A 5FFCA 2Z5RA 4TOAA 1BCFA 1N1QA 2GS4A 3KX9A 5FFDA 3EZUA 3E1OA 4TOGA 3A68A 3PVTB 4IXKA 3AK9A 1FHAA 2FHAA 3UOIA 4ETRA 2JD70 3Q4RA 4QUWA 5HQOA 5J8WA 1RCDA 3NOZX 5GU1X 2ZG7X 3F32A 4LQJA 2OC5A 3R2KA 3BVIA 1IERA 5IX6A 5D8OA 1AEWA 4EVCA 4DYUA 5E2DA 5D8XA 3SHXA 4ZLWA 1NF6A 3F36A 2C2FA 3Q4NA 1S3QA 2HR5A 1JREA 3E1JA 4RC6B 4MN9A 4TOBA 2XJOA 5HJFA 1GWGA 4ML5A 4KVRA 1JKUA 2V2JA 1RCGA 2C2UA 2V2IA 5D8PA 1RYTA 3AJQA 1F33A 3E1NA 2V2NA 3GE4A 2WLAA 2FJCA 4M32A 5CZUA 1J30A 3R2RA 3U90A 2Y3QA 4PGIA 4LQHA 3WVWA 4IWJA 4DE6A 1LKOA 4MUDA 5JKLA 2XJMA 4TW3A 2BKCA 3QB9A 4DYYA 3PVTA 1NNQA 4PGKA 2V15A 5FFBA 3H7GA 4ITWA 2CIHA 5J8SA 3WNWA 3Q4OA 4ISPA 5GU3X 2YJJA 1OTKA 5LBHA 3RD0A 4Y08A 1YV1A 1JTSA 4EVEA 1SQ3A 3A9QA 3RGDA 1RCCA 4RC6A 2FKZA 2V2OA 3F34A 3KWOA 1YUXA 2JD60 4ZKHA 2VXIA 3BVEA 4EVBA 3BVKA 2VZBA 3TA8A 3PWQC 1NF4A 4ZL6A 3PW8A 4AM2A 3QVDA 3PZAA 1HRSA 2QQYA 4ZMCA 4AM4A 1XZ1A 3SE1A 2BW1A 2XJNA 5GU0X 2CN6A 2FZFA 2D5KA 3BKNA 3R2HA 4MY7A 4RC8A 1RCEA 4CYAA 2UX1A 4RC5A 5ERKA 2Z5PA 3AF7X 3Q4QA 1S2ZA 5JKMG 4KVQA 3AJPA 4TOCA 3IS7A 2F7NA 2WTLA 1MFRA 5ERJA 3NP2X 1VELA 3PW8C 4ZKWA 4DYXA 2FL0A 1DPSA 1VEQA 4A25A 2ZA7A 1TKOA 1QYBA 3PVRB 1O9RA 3AK8A 1TK6A 2OH3A 2IB0A 1YUZA 5D8RA 2Z90A 3T9JA 2Z6MA 5JKLG 4CVRA 3QD8A 2ITBA 1NFVA 3PVYB 3E1LA 2C41A 2C2JA 3SIDA 4ERUA 2IY4A 3UOFA 4ZL5A 2PYBA 4RC7B 2FFXJ 3E1QA 1TJOA 4CMYA 5CMQA 4RC5B 2FG8A 3F37A 4CMYV 5LS9A 5LG2A 2V2LA 3MPSA 4LQNA 1Z6OM 3PWQA 2X170 1JYBA 2CEIA 1Z4AA 1UMNA 1O9IA 3NP0X 4ITTA 4MJYA 5HJHA 3E6RA 1B71A 4Z5SA 3UNOA 1VJXA 3R2OA 4LYXA 3O7SA 3PVRA 3HIUA 4YKHA 3F33A
chains in the Genus database with same CATH superfamily
4XKUA 2RBDA 1Z6OA 2CHIA 4ZJKA 1RCIA 4LYUA 1EUMA 2XGWA 3KXUA 3F35A 2IU2A 4X0JA 3E6SA 2ZG8X 3PVYA 4M34A 3R2SA 4LPNA 4DI0A 2V2RA 5D8SA 3QZ3A 3QHBA 3F38A 2VXXA 4RC7A 3EGMA 3C23A 2CLBA 1LKPA 4IWKA 1JI5A 3O7RA 4TODA 2YW7A 2FG4A 5K52A 2V2SA 4YXMA 1ZUJA 4DZ0A 4TOHA 5GN8B 4II4B 1S30A 2Y44A 3IS8A 1R03A 2GYQA 2XKQA 3AF9X 5JACA 5I4JA 4LPMA 3QHCA 4REUA 1BG7A 4CVSA 1JKVA 2G4HA 2GYDA 3E2CA 3R2LA 4W4LB 4E6KA 2CF7A 1H96A 4YXJA 5K53A 4CYBA 1MOJA 1XZ3A 3OJ5A 3E1PA 2HTNA 2QF9A 2CLUA 3C21A 3ISFA 4EVDA 5D8QA 3KA6A 3BVFA 5AXSA 2WWXB 5JKMA 5FFEA 3VNXA 1ZS3A 2V2MA 4P18A 4ZTTA 2ZA6A 3LKDA 1JIGA 3WVUA 4PG1A 4TOFA 4U3GA 4ISMA 3AF8X 3RAVA 2W0OA 4M33A 5E1UA 2CHPA 4CY9A 4PG0A 3ES3A 2ZG9X 2YJKA 1KRQA 3PW1B 1F30A 4TOEA 3DBYA 5JDOB 3FVBA 4ZKXA 4LQVA 5GN8A 5LG8A 4II4A 4DYZA 4R42A 1TKPA 1IESA 1JGCA 3BVLA 3IQ1A 3N6OA 2ZURX 3KA8A 4XGSA 4XKTA 2YW6A 1L8IA 4W4KB 2V2PA 1BFRA 2N02A 3BT5A 4TO9A 2WLUA 5GOUA 3E1MA 5D8YA 4LPJA 3FSEA 1LKMA 4AM5A 1VEIA 3EZ0A 1LB3A 3GVYA 1QGHA 3WVVA 3KDQA 3KA9A 3KA4A 5HU6D 4M35A 5J93A 5C6FA 3RBCA 1DVBA 2C6RA 1VLGA 2BK6A 3AJOA 4Z3BA 3R2MA 4MKUA 5J9VA 1JI4A 5GU2X 4KVSA 5FEJA 5CMRA 1UVHA 3ERZA 4CVPA 5FFAA 2JD80 3KA3A 1L8HA 3PWFA 3OGHA 2ZA8A 3F39A 3RE7A 3SH6A 1DATA 2CN7A 3PW1A 4CVTA 3FI6A 3M6JA 1SOFA 4DASA 4XKSA 2Z5QA 3GHQA 2BJYA 4OYNA 3ISEA 5JDOA 2V8TA 3HL1A 5FFCA 2Z5RA 4TOAA 1BCFA 1N1QA 2GS4A 2AR0A 3KX9A 5FFDA 3EZUA 3E1OA 4TOGA 3A68A 3PVTB 4IXKA 3AK9A 1FHAA 2FHAA 3UOIA 4ETRA 2JD70 3Q4RA 4QUWA 5HQOA 5J8WA 1RCDA 3NOZX 5GU1X 2ZG7X 3F32A 4LQJA 2OC5A 3R2KA 3BVIA 3FRRA 1IERA 5IX6A 5D8OA 1AEWA 4EVCA 4DYUA 5E2DA 5D8XA 3SHXA 4ZLWA 1NF6A 3F36A 2C2FA 3Q4NA 1S3QA 2HR5A 1JREA 3E1JA 2G38B 3D19A 4RC6B 4MN9A 4TOBA 2XJOA 5HJFA 1GWGA 4ML5A 4KVRA 1JKUA 2V2JA 1RCGA 2C2UA 2V2IA 5D8PA 1RYTA 3AJQA 1F33A 3E1NA 2V2NA 3GE4A 2WLAA 2FJCA 4M32A 5CZUA 1J30A 3R2RA 3U90A 2Y3QA 4PGIA 4LQHA 3WVWA 4IWJA 3UFBA 4DE6A 1LKOA 4MUDA 5JKLA 2XJMA 4TW3A 2BKCA 3V3KB 3QB9A 4DYYA 3PVTA 1NNQA 4PGKA 2V15A 5FFBA 3H7GA 4ITWA 2CIHA 3VVAA 5J8SA 3WNWA 3Q4OA 4KXRB 4ISPA 5GU3X 2YJJA 1OTKA 5LBHA 3RD0A 4Y08A 1YV1A 1JTSA 4EVEA 1SQ3A 3A9QA 3RGDA 1RCCA 4RC6A 2FKZA 2V2OA 3F34A 3KWOA 1YUXA 2JD60 3GGYA 4ZKHA 2VXIA 3BVEA 4EVBA 3BVKA 2VZBA 3TA8A 3PWQC 1NF4A 4ZL6A 3PW8A 4YVZA 4AM2A 3W54A 3QVDA 3PZAA 1HRSA 2QQYA 4ZMCA 3VV9A 4AM4A 1XZ1A 3SE1A 2V8UA 2BW1A 2XJNA 5GU0X 2CN6A 2FZFA 3JZAB 2D5KA 3BKNA 3R2HA 4MY7A 4RC8A 1RCEA 4CYAA 2UX1A 3KHKA 4RC5A 5ERKA 2Z5PA 3AF7X 3Q4QA 1S2ZA 5JKMG 4KVQA 3AJPA 4TOCA 3IS7A 2F7NA 2CWLA 2WTLA 1MFRA 5ERJA 3C1YA 3NP2X 1VELA 3PW8C 4ZKWA 4DYXA 2FL0A 1DPSA 1VEQA 4A25A 2MGYA 3L0MA 2ZA7A 1TKOA 1QYBA 3PVRB 1O9RA 3AK8A 3GGZA 1TK6A 2OH3A 2IB0A 1YUZA 5D8RA 2Z90A 3T9JA 2Z6MA 5JKLG 4CVRA 4WJG4 3QD8A 2ITBA 1NFVA 3PVYB 3E1LA 2C41A 2C2JA 3SIDA 4ERUA 2IY4A 3UOFA 4ZL5A 2PYBA 4RC7B 2FFXJ 3E1QA 1TJOA 4CMYA 5CMQA 4RC5B 2FG8A 3F37A 4CMYV 5LS9A 5LG2A 4E40A 2V2LA 3MPSA 4LQNA 4MXPA 3C1ZA 1Z6OM 3PWQA 3JZ9A 2X170 2OKCA 1JYBA 2CEIA 1Z4AA 1UMNA 1O9IA 3NP0X 4ITTA 4MJYA 3FRSA 5HJHA 3E6RA 1B71A 4Z5SA 3UNOA 1VJXA 3R2OA 4LYXA 3O7SA 3PVRA 3HIUA 4YKHA 3F33A
chains in the Genus database with same CATH topology
4XKUA 2RBDA 1Z6OA 2CHIA 4ZJKA 1RCIA 4LYUA 1EUMA 2XGWA 3KXUA 3F35A 2IU2A 4X0JA 3E6SA 2ZG8X 3PVYA 4M34A 3R2SA 4LPNA 4DI0A 2V2RA 5D8SA 3QZ3A 3QHBA 3F38A 2VXXA 4RC7A 3EGMA 3C23A 2CLBA 1LKPA 4IWKA 1JI5A 3O7RA 4TODA 2YW7A 2FG4A 5K52A 2V2SA 4YXMA 1ZUJA 4DZ0A 4TOHA 5GN8B 4II4B 1S30A 2Y44A 3IS8A 1R03A 2GYQA 2XKQA 3AF9X 5JACA 5I4JA 4LPMA 3QHCA 4REUA 1BG7A 4CVSA 1JKVA 2G4HA 2GYDA 3E2CA 3R2LA 4W4LB 4E6KA 2CF7A 1H96A 4YXJA 5K53A 4CYBA 1MOJA 1XZ3A 3OJ5A 3E1PA 2HTNA 2QF9A 2CLUA 3C21A 3ISFA 4EVDA 5D8QA 3KA6A 3BVFA 5AXSA 2WWXB 5JKMA 5FFEA 3VNXA 1ZS3A 2V2MA 4P18A 4ZTTA 2ZA6A 3LKDA 1JIGA 3WVUA 4PG1A 4TOFA 4U3GA 4ISMA 3AF8X 3RAVA 2W0OA 4M33A 5E1UA 2CHPA 4CY9A 4PG0A 3ES3A 2ZG9X 2YJKA 1KRQA 3PW1B 1F30A 4TOEA 3DBYA 5JDOB 3FVBA 4ZKXA 4LQVA 5GN8A 5LG8A 4II4A 4DYZA 4R42A 1TKPA 1IESA 1JGCA 3BVLA 3IQ1A 3N6OA 2ZURX 3KA8A 4XGSA 4XKTA 2YW6A 1L8IA 4W4KB 2V2PA 1BFRA 2N02A 3BT5A 4TO9A 2WLUA 5GOUA 3E1MA 5D8YA 4LPJA 3FSEA 1LKMA 4AM5A 1VEIA 3EZ0A 1LB3A 3GVYA 1QGHA 3WVVA 3KDQA 3KA9A 3KA4A 5HU6D 4M35A 5J93A 5C6FA 3RBCA 1DVBA 2C6RA 1VLGA 2BK6A 3AJOA 4Z3BA 3R2MA 4MKUA 5J9VA 1JI4A 5GU2X 4KVSA 5FEJA 5CMRA 1UVHA 3ERZA 4CVPA 5FFAA 2JD80 3KA3A 1L8HA 3PWFA 3OGHA 2ZA8A 3F39A 3RE7A 3SH6A 1DATA 2CN7A 3PW1A 4CVTA 3FI6A 3M6JA 1SOFA 4DASA 4XKSA 2Z5QA 3GHQA 2BJYA 4OYNA 3ISEA 5JDOA 2V8TA 3HL1A 5FFCA 2Z5RA 4TOAA 1BCFA 1N1QA 2GS4A 2AR0A 3KX9A 5FFDA 3EZUA 3E1OA 4TOGA 3A68A 3PVTB 4IXKA 3AK9A 1FHAA 2FHAA 3UOIA 4ETRA 2JD70 3Q4RA 4QUWA 5HQOA 5J8WA 1RCDA 3NOZX 5GU1X 2ZG7X 3F32A 4LQJA 2OC5A 3R2KA 3BVIA 3FRRA 1IERA 5IX6A 5D8OA 1AEWA 4EVCA 4DYUA 5E2DA 5D8XA 3SHXA 4ZLWA 1NF6A 3F36A 2C2FA 3Q4NA 1S3QA 2HR5A 1JREA 3E1JA 2G38B 3D19A 4RC6B 4MN9A 4TOBA 2XJOA 5HJFA 1GWGA 4ML5A 4KVRA 1JKUA 2V2JA 1RCGA 2C2UA 2V2IA 5D8PA 1RYTA 3AJQA 1F33A 3E1NA 2V2NA 3GE4A 2WLAA 2FJCA 4M32A 5CZUA 1J30A 3R2RA 3U90A 2Y3QA 4PGIA 4LQHA 3WVWA 4IWJA 3UFBA 4DE6A 1LKOA 4MUDA 5JKLA 2XJMA 4TW3A 2BKCA 3V3KB 3QB9A 4DYYA 3PVTA 1NNQA 4PGKA 2V15A 5FFBA 3H7GA 4ITWA 2CIHA 3VVAA 5J8SA 3WNWA 3Q4OA 4KXRB 4ISPA 5GU3X 2YJJA 1OTKA 5LBHA 3RD0A 4Y08A 1YV1A 1JTSA 4EVEA 1SQ3A 3A9QA 3RGDA 1RCCA 4RC6A 2FKZA 2V2OA 3F34A 3KWOA 1YUXA 2JD60 3GGYA 4ZKHA 2VXIA 3BVEA 4EVBA 3BVKA 2VZBA 3TA8A 3PWQC 1NF4A 4ZL6A 3PW8A 4YVZA 4AM2A 3W54A 3QVDA 3PZAA 1HRSA 2QQYA 4ZMCA 3VV9A 4AM4A 1XZ1A 3SE1A 2V8UA 2BW1A 2XJNA 5GU0X 2CN6A 2FZFA 3JZAB 2D5KA 3BKNA 3R2HA 4MY7A 4RC8A 1RCEA 4CYAA 2UX1A 3KHKA 4RC5A 5ERKA 2Z5PA 3AF7X 3Q4QA 1S2ZA 5JKMG 4KVQA 3AJPA 4TOCA 3IS7A 2F7NA 2CWLA 2WTLA 1MFRA 5ERJA 3C1YA 3NP2X 1VELA 3PW8C 4ZKWA 4DYXA 2FL0A 1DPSA 1VEQA 4A25A 2MGYA 3L0MA 2ZA7A 1TKOA 1QYBA 3PVRB 1O9RA 3AK8A 3GGZA 1TK6A 2OH3A 2IB0A 1YUZA 5D8RA 2Z90A 3T9JA 2Z6MA 5JKLG 4CVRA 4WJG4 3QD8A 2ITBA 1NFVA 3PVYB 3E1LA 2C41A 2C2JA 3SIDA 4ERUA 2IY4A 3UOFA 4ZL5A 2PYBA 4RC7B 2FFXJ 3E1QA 1TJOA 4CMYA 5CMQA 4RC5B 2FG8A 3F37A 4CMYV 5LS9A 5LG2A 4E40A 2V2LA 3MPSA 4LQNA 4MXPA 3C1ZA 1Z6OM 3PWQA 3JZ9A 2X170 2OKCA 1JYBA 2CEIA 1Z4AA 1UMNA 1O9IA 3NP0X 4ITTA 4MJYA 3FRSA 5HJHA 3E6RA 1B71A 4Z5SA 3UNOA 1VJXA 3R2OA 4LYXA 3O7SA 3PVRA 3HIUA 4YKHA 3F33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKU A;  2RBD A;  1Z6O A;  2CHI A;  4ZJK A;  1RCI A;  4LYU A;  1EUM A;  2XGW A;  3KXU A;  3F35 A;  2IU2 A;  3E6S A;  2ZG8 X;  3PVY A;  4M34 A;  3R2S A;  4LPN A;  4DI0 A;  2V2R A;  5D8S A;  3QZ3 A;  3QHB A;  3F38 A;  2VXX A;  4RC7 A;  3EGM A;  2CLB A;  1LKP A;  4IWK A;  1JI5 A;  3O7R A;  4TOD A;  2YW7 A;  2FG4 A;  5K52 A;  2V2S A;  1ZUJ A;  4DZ0 A;  4TOH A;  5GN8 B;  4II4 B;  1S30 A;  3IS8 A;  1R03 A;  2GYQ A;  2XKQ A;  3AF9 X;  5JAC A;  5I4J A;  4LPM A;  3QHC A;  4REU A;  1BG7 A;  4CVS A;  1JKV A;  2G4H A;  2GYD A;  3E2C A;  3R2L A;  4E6K A;  2CF7 A;  1H96 A;  5K53 A;  4CYB A;  1MOJ A;  1XZ3 A;  3OJ5 A;  3E1P A;  2HTN A;  2QF9 A;  2CLU A;  3ISF A;  4EVD A;  5D8Q A;  3KA6 A;  3BVF A;  5AXS A;  5JKM A;  5FFE A;  3VNX A;  4P18 A;  1ZS3 A;  2V2M A;  4ZTT A;  2ZA6 A;  1JIG A;  3WVU A;  4PG1 A;  4TOF A;  4U3G A;  4ISM A;  3AF8 X;  3RAV A;  2W0O A;  4M33 A;  5E1U A;  2CHP A;  4CY9 A;  4PG0 A;  3ES3 A;  2ZG9 X;  2YJK A;  1KRQ A;  3PW1 B;  1F30 A;  4TOE A;  3FVB A;  4ZKX A;  4LQV A;  5GN8 A;  5LG8 A;  4II4 A;  4DYZ A;  4R42 A;  1TKP A;  1IES A;  1JGC A;  3BVL A;  3IQ1 A;  2ZUR X;  3KA8 A;  4XGS A;  4XKT A;  2YW6 A;  1L8I A;  2V2P A;  1BFR A;  3BT5 A;  4TO9 A;  2WLU A;  5GOU A;  3E1M A;  5D8Y A;  4LPJ A;  3FSE A;  1LKM A;  4AM5 A;  1VEI A;  3EZ0 A;  1LB3 A;  3GVY A;  1QGH A;  3WVV A;  3KA9 A;  3KA4 A;  4M35 A;  5J93 A;  5C6F A;  3RBC A;  1DVB A;  2C6R A;  1VLG A;  2BK6 A;  3AJO A;  4Z3B A;  3R2M A;  4MKU A;  5J9V A;  1JI4 A;  5GU2 X;  4KVS A;  5FEJ A;  5CMR A;  1UVH A;  3ERZ A;  4CVP A;  5FFA A;  2JD8 0;  3KA3 A;  1L8H A;  3PWF A;  3OGH A;  2ZA8 A;  3F39 A;  3RE7 A;  3SH6 A;  1DAT A;  2CN7 A;  3PW1 A;  4CVT A;  3FI6 A;  1SOF A;  4DAS A;  4XKS A;  2Z5Q A;  3GHQ A;  2BJY A;  4OYN A;  3ISE A;  3HL1 A;  5FFC A;  2Z5R A;  4TOA A;  1BCF A;  1N1Q A;  2GS4 A;  3KX9 A;  5FFD A;  3EZU A;  3E1O A;  4TOG A;  3A68 A;  3PVT B;  4IXK A;  3AK9 A;  1FHA A;  2FHA A;  3UOI A;  4ETR A;  2JD7 0;  3Q4R A;  4QUW A;  5HQO A;  5J8W A;  1RCD A;  3NOZ X;  5GU1 X;  2ZG7 X;  3F32 A;  4LQJ A;  2OC5 A;  3R2K A;  3BVI A;  1IER A;  5IX6 A;  5D8O A;  1AEW A;  4EVC A;  4DYU A;  5E2D A;  5D8X A;  3SHX A;  4ZLW A;  1NF6 A;  3F36 A;  2C2F A;  3Q4N A;  1S3Q A;  2HR5 A;  1JRE A;  3E1J A;  4RC6 B;  4MN9 A;  4TOB A;  2XJO A;  5HJF A;  1GWG A;  4ML5 A;  4KVR A;  1JKU A;  2V2J A;  1RCG A;  2C2U A;  2V2I A;  5D8P A;  1RYT A;  3AJQ A;  1F33 A;  3E1N A;  2V2N A;  3GE4 A;  2WLA A;  2FJC A;  4M32 A;  5CZU A;  1J30 A;  3R2R A;  3U90 A;  2Y3Q A;  4PGI A;  4LQH A;  3WVW A;  4IWJ A;  4DE6 A;  1LKO A;  4MUD A;  5JKL A;  2XJM A;  4TW3 A;  2BKC A;  3QB9 A;  4DYY A;  3PVT A;  1NNQ A;  4PGK A;  2V15 A;  5FFB A;  3H7G A;  4ITW A;  2CIH A;  5J8S A;  3WNW A;  3Q4O A;  4ISP A;  5GU3 X;  2YJJ A;  1OTK A;  5LBH A;  3RD0 A;  4Y08 A;  1YV1 A;  1JTS A;  4EVE A;  1SQ3 A;  3A9Q A;  3RGD A;  1RCC A;  4RC6 A;  2FKZ A;  2V2O A;  3F34 A;  3KWO A;  1YUX A;  2JD6 0;  4ZKH A;  2VXI A;  3BVE A;  4EVB A;  3BVK A;  2VZB A;  3TA8 A;  3PWQ C;  1NF4 A;  4ZL6 A;  3PW8 A;  4AM2 A;  3QVD A;  3PZA A;  1HRS A;  2QQY A;  4ZMC A;  4AM4 A;  1XZ1 A;  3SE1 A;  2BW1 A;  2XJN A;  5GU0 X;  2CN6 A;  2FZF A;  2D5K A;  3BKN A;  3R2H A;  4MY7 A;  4RC8 A;  1RCE A;  4CYA A;  2UX1 A;  4RC5 A;  5ERK A;  2Z5P A;  3AF7 X;  3Q4Q A;  1S2Z A;  5JKM G;  4KVQ A;  3AJP A;  4TOC A;  3IS7 A;  2F7N A;  2WTL A;  1MFR A;  5ERJ A;  3NP2 X;  1VEL A;  3PW8 C;  4ZKW A;  4DYX A;  2FL0 A;  1DPS A;  1VEQ A;  4A25 A;  2ZA7 A;  1TKO A;  1QYB A;  3PVR B;  1O9R A;  3AK8 A;  1TK6 A;  2OH3 A;  2IB0 A;  1YUZ A;  5D8R A;  2Z90 A;  3T9J A;  2Z6M A;  5JKL G;  4CVR A;  3QD8 A;  2ITB A;  1NFV A;  3PVY B;  3E1L A;  2C41 A;  2C2J A;  3SID A;  4ERU A;  2IY4 A;  3UOF A;  4ZL5 A;  2PYB A;  4RC7 B;  2FFX J;  3E1Q A;  1TJO A;  4CMY A;  5CMQ A;  4RC5 B;  2FG8 A;  3F37 A;  4CMY V;  5LS9 A;  5LG2 A;  2V2L A;  3MPS A;  4LQN A;  1Z6O M;  3PWQ A;  2X17 0;  1JYB A;  2CEI A;  1Z4A A;  1UMN A;  1O9I A;  3NP0 X;  4ITT A;  4MJY A;  5HJH A;  3E6R A;  1B71 A;  4Z5S A;  3UNO A;  1VJX A;  3R2O A;  4LYX A;  3O7S A;  3PVR A;  3HIU A;  4YKH A;  3F33 A; 
#chains in the Genus database with same CATH topology
 4XKU A;  2RBD A;  1Z6O A;  2CHI A;  4ZJK A;  1RCI A;  4LYU A;  1EUM A;  2XGW A;  3KXU A;  3F35 A;  2IU2 A;  4X0J A;  3E6S A;  2ZG8 X;  3PVY A;  4M34 A;  3R2S A;  4LPN A;  4DI0 A;  2V2R A;  5D8S A;  3QZ3 A;  3QHB A;  3F38 A;  2VXX A;  4RC7 A;  3EGM A;  3C23 A;  2CLB A;  1LKP A;  4IWK A;  1JI5 A;  3O7R A;  4TOD A;  2YW7 A;  2FG4 A;  5K52 A;  2V2S A;  4YXM A;  1ZUJ A;  4DZ0 A;  4TOH A;  5GN8 B;  4II4 B;  1S30 A;  2Y44 A;  3IS8 A;  1R03 A;  2GYQ A;  2XKQ A;  3AF9 X;  5JAC A;  5I4J A;  4LPM A;  3QHC A;  4REU A;  1BG7 A;  4CVS A;  1JKV A;  2G4H A;  2GYD A;  3E2C A;  3R2L A;  4W4L B;  4E6K A;  2CF7 A;  1H96 A;  4YXJ A;  5K53 A;  4CYB A;  1MOJ A;  1XZ3 A;  3OJ5 A;  3E1P A;  2HTN A;  2QF9 A;  2CLU A;  3C21 A;  3ISF A;  4EVD A;  5D8Q A;  3KA6 A;  3BVF A;  5AXS A;  2WWX B;  5JKM A;  5FFE A;  3VNX A;  1ZS3 A;  2V2M A;  4P18 A;  4ZTT A;  2ZA6 A;  3LKD A;  1JIG A;  3WVU A;  4PG1 A;  4TOF A;  4U3G A;  4ISM A;  3AF8 X;  3RAV A;  2W0O A;  4M33 A;  5E1U A;  2CHP A;  4CY9 A;  4PG0 A;  3ES3 A;  2ZG9 X;  2YJK A;  1KRQ A;  3PW1 B;  1F30 A;  4TOE A;  3DBY A;  5JDO B;  3FVB A;  4ZKX A;  4LQV A;  5GN8 A;  5LG8 A;  4II4 A;  4DYZ A;  4R42 A;  1TKP A;  1IES A;  1JGC A;  3BVL A;  3IQ1 A;  3N6O A;  2ZUR X;  3KA8 A;  4XGS A;  4XKT A;  2YW6 A;  1L8I A;  4W4K B;  2V2P A;  1BFR A;  2N02 A;  3BT5 A;  4TO9 A;  2WLU A;  5GOU A;  3E1M A;  5D8Y A;  4LPJ A;  3FSE A;  1LKM A;  4AM5 A;  1VEI A;  3EZ0 A;  1LB3 A;  3GVY A;  1QGH A;  3WVV A;  3KDQ A;  3KA9 A;  3KA4 A;  5HU6 D;  4M35 A;  5J93 A;  5C6F A;  3RBC A;  1DVB A;  2C6R A;  1VLG A;  2BK6 A;  3AJO A;  4Z3B A;  3R2M A;  4MKU A;  5J9V A;  1JI4 A;  5GU2 X;  4KVS A;  5FEJ A;  5CMR A;  1UVH A;  3ERZ A;  4CVP A;  5FFA A;  2JD8 0;  3KA3 A;  1L8H A;  3PWF A;  3OGH A;  2ZA8 A;  3F39 A;  3RE7 A;  3SH6 A;  1DAT A;  2CN7 A;  3PW1 A;  4CVT A;  3FI6 A;  3M6J A;  1SOF A;  4DAS A;  4XKS A;  2Z5Q A;  3GHQ A;  2BJY A;  4OYN A;  3ISE A;  5JDO A;  2V8T A;  3HL1 A;  5FFC A;  2Z5R A;  4TOA A;  1BCF A;  1N1Q A;  2GS4 A;  2AR0 A;  3KX9 A;  5FFD A;  3EZU A;  3E1O A;  4TOG A;  3A68 A;  3PVT B;  4IXK A;  3AK9 A;  1FHA A;  2FHA A;  3UOI A;  4ETR A;  2JD7 0;  3Q4R A;  4QUW A;  5HQO A;  5J8W A;  1RCD A;  3NOZ X;  5GU1 X;  2ZG7 X;  3F32 A;  4LQJ A;  2OC5 A;  3R2K A;  3BVI A;  3FRR A;  1IER A;  5IX6 A;  5D8O A;  1AEW A;  4EVC A;  4DYU A;  5E2D A;  5D8X A;  3SHX A;  4ZLW A;  1NF6 A;  3F36 A;  2C2F A;  3Q4N A;  1S3Q A;  2HR5 A;  1JRE A;  3E1J A;  2G38 B;  3D19 A;  4RC6 B;  4MN9 A;  4TOB A;  2XJO A;  5HJF A;  1GWG A;  4ML5 A;  4KVR A;  1JKU A;  2V2J A;  1RCG A;  2C2U A;  2V2I A;  5D8P A;  1RYT A;  3AJQ A;  1F33 A;  3E1N A;  2V2N A;  3GE4 A;  2WLA A;  2FJC A;  4M32 A;  5CZU A;  1J30 A;  3R2R A;  3U90 A;  2Y3Q A;  4PGI A;  4LQH A;  3WVW A;  4IWJ A;  3UFB A;  4DE6 A;  1LKO A;  4MUD A;  5JKL A;  2XJM A;  4TW3 A;  2BKC A;  3V3K B;  3QB9 A;  4DYY A;  3PVT A;  1NNQ A;  4PGK A;  2V15 A;  5FFB A;  3H7G A;  4ITW A;  2CIH A;  3VVA A;  5J8S A;  3WNW A;  3Q4O A;  4KXR B;  4ISP A;  5GU3 X;  2YJJ A;  1OTK A;  5LBH A;  3RD0 A;  4Y08 A;  1YV1 A;  1JTS A;  4EVE A;  1SQ3 A;  3A9Q A;  3RGD A;  1RCC A;  4RC6 A;  2FKZ A;  2V2O A;  3F34 A;  3KWO A;  1YUX A;  2JD6 0;  3GGY A;  4ZKH A;  2VXI A;  3BVE A;  4EVB A;  3BVK A;  2VZB A;  3TA8 A;  3PWQ C;  1NF4 A;  4ZL6 A;  3PW8 A;  4YVZ A;  4AM2 A;  3W54 A;  3QVD A;  3PZA A;  1HRS A;  2QQY A;  4ZMC A;  3VV9 A;  4AM4 A;  1XZ1 A;  3SE1 A;  2V8U A;  2BW1 A;  2XJN A;  5GU0 X;  2CN6 A;  2FZF A;  3JZA B;  2D5K A;  3BKN A;  3R2H A;  4MY7 A;  4RC8 A;  1RCE A;  4CYA A;  2UX1 A;  3KHK A;  4RC5 A;  5ERK A;  2Z5P A;  3AF7 X;  3Q4Q A;  1S2Z A;  5JKM G;  4KVQ A;  3AJP A;  4TOC A;  3IS7 A;  2F7N A;  2CWL A;  2WTL A;  1MFR A;  5ERJ A;  3C1Y A;  3NP2 X;  1VEL A;  3PW8 C;  4ZKW A;  4DYX A;  2FL0 A;  1DPS A;  1VEQ A;  4A25 A;  2MGY A;  3L0M A;  2ZA7 A;  1TKO A;  1QYB A;  3PVR B;  1O9R A;  3AK8 A;  3GGZ A;  1TK6 A;  2OH3 A;  2IB0 A;  1YUZ A;  5D8R A;  2Z90 A;  3T9J A;  2Z6M A;  5JKL G;  4CVR A;  4WJG 4;  3QD8 A;  2ITB A;  1NFV A;  3PVY B;  3E1L A;  2C41 A;  2C2J A;  3SID A;  4ERU A;  2IY4 A;  3UOF A;  4ZL5 A;  2PYB A;  4RC7 B;  2FFX J;  3E1Q A;  1TJO A;  4CMY A;  5CMQ A;  4RC5 B;  2FG8 A;  3F37 A;  4CMY V;  5LS9 A;  5LG2 A;  4E40 A;  2V2L A;  3MPS A;  4LQN A;  4MXP A;  3C1Z A;  1Z6O M;  3PWQ A;  3JZ9 A;  2X17 0;  2OKC A;  1JYB A;  2CEI A;  1Z4A A;  1UMN A;  1O9I A;  3NP0 X;  4ITT A;  4MJY A;  3FRS A;  5HJH A;  3E6R A;  1B71 A;  4Z5S A;  3UNO A;  1VJX A;  3R2O A;  4LYX A;  3O7S A;  3PVR A;  3HIU A;  4YKH A;  3F33 A; 
#chains in the Genus database with same CATH homology
 4XKU A;  2RBD A;  1Z6O A;  2CHI A;  4ZJK A;  1RCI A;  4LYU A;  1EUM A;  2XGW A;  3KXU A;  3F35 A;  2IU2 A;  4X0J A;  3E6S A;  2ZG8 X;  3PVY A;  4M34 A;  3R2S A;  4LPN A;  4DI0 A;  2V2R A;  5D8S A;  3QZ3 A;  3QHB A;  3F38 A;  2VXX A;  4RC7 A;  3EGM A;  3C23 A;  2CLB A;  1LKP A;  4IWK A;  1JI5 A;  3O7R A;  4TOD A;  2YW7 A;  2FG4 A;  5K52 A;  2V2S A;  4YXM A;  1ZUJ A;  4DZ0 A;  4TOH A;  5GN8 B;  4II4 B;  1S30 A;  2Y44 A;  3IS8 A;  1R03 A;  2GYQ A;  2XKQ A;  3AF9 X;  5JAC A;  5I4J A;  4LPM A;  3QHC A;  4REU A;  1BG7 A;  4CVS A;  1JKV A;  2G4H A;  2GYD A;  3E2C A;  3R2L A;  4W4L B;  4E6K A;  2CF7 A;  1H96 A;  4YXJ A;  5K53 A;  4CYB A;  1MOJ A;  1XZ3 A;  3OJ5 A;  3E1P A;  2HTN A;  2QF9 A;  2CLU A;  3C21 A;  3ISF A;  4EVD A;  5D8Q A;  3KA6 A;  3BVF A;  5AXS A;  2WWX B;  5JKM A;  5FFE A;  3VNX A;  1ZS3 A;  2V2M A;  4P18 A;  4ZTT A;  2ZA6 A;  3LKD A;  1JIG A;  3WVU A;  4PG1 A;  4TOF A;  4U3G A;  4ISM A;  3AF8 X;  3RAV A;  2W0O A;  4M33 A;  5E1U A;  2CHP A;  4CY9 A;  4PG0 A;  3ES3 A;  2ZG9 X;  2YJK A;  1KRQ A;  3PW1 B;  1F30 A;  4TOE A;  3DBY A;  5JDO B;  3FVB A;  4ZKX A;  4LQV A;  5GN8 A;  5LG8 A;  4II4 A;  4DYZ A;  4R42 A;  1TKP A;  1IES A;  1JGC A;  3BVL A;  3IQ1 A;  3N6O A;  2ZUR X;  3KA8 A;  4XGS A;  4XKT A;  2YW6 A;  1L8I A;  4W4K B;  2V2P A;  1BFR A;  2N02 A;  3BT5 A;  4TO9 A;  2WLU A;  5GOU A;  3E1M A;  5D8Y A;  4LPJ A;  3FSE A;  1LKM A;  4AM5 A;  1VEI A;  3EZ0 A;  1LB3 A;  3GVY A;  1QGH A;  3WVV A;  3KDQ A;  3KA9 A;  3KA4 A;  5HU6 D;  4M35 A;  5J93 A;  5C6F A;  3RBC A;  1DVB A;  2C6R A;  1VLG A;  2BK6 A;  3AJO A;  4Z3B A;  3R2M A;  4MKU A;  5J9V A;  1JI4 A;  5GU2 X;  4KVS A;  5FEJ A;  5CMR A;  1UVH A;  3ERZ A;  4CVP A;  5FFA A;  2JD8 0;  3KA3 A;  1L8H A;  3PWF A;  3OGH A;  2ZA8 A;  3F39 A;  3RE7 A;  3SH6 A;  1DAT A;  2CN7 A;  3PW1 A;  4CVT A;  3FI6 A;  3M6J A;  1SOF A;  4DAS A;  4XKS A;  2Z5Q A;  3GHQ A;  2BJY A;  4OYN A;  3ISE A;  5JDO A;  2V8T A;  3HL1 A;  5FFC A;  2Z5R A;  4TOA A;  1BCF A;  1N1Q A;  2GS4 A;  2AR0 A;  3KX9 A;  5FFD A;  3EZU A;  3E1O A;  4TOG A;  3A68 A;  3PVT B;  4IXK A;  3AK9 A;  1FHA A;  2FHA A;  3UOI A;  4ETR A;  2JD7 0;  3Q4R A;  4QUW A;  5HQO A;  5J8W A;  1RCD A;  3NOZ X;  5GU1 X;  2ZG7 X;  3F32 A;  4LQJ A;  2OC5 A;  3R2K A;  3BVI A;  3FRR A;  1IER A;  5IX6 A;  5D8O A;  1AEW A;  4EVC A;  4DYU A;  5E2D A;  5D8X A;  3SHX A;  4ZLW A;  1NF6 A;  3F36 A;  2C2F A;  3Q4N A;  1S3Q A;  2HR5 A;  1JRE A;  3E1J A;  2G38 B;  3D19 A;  4RC6 B;  4MN9 A;  4TOB A;  2XJO A;  5HJF A;  1GWG A;  4ML5 A;  4KVR A;  1JKU A;  2V2J A;  1RCG A;  2C2U A;  2V2I A;  5D8P A;  1RYT A;  3AJQ A;  1F33 A;  3E1N A;  2V2N A;  3GE4 A;  2WLA A;  2FJC A;  4M32 A;  5CZU A;  1J30 A;  3R2R A;  3U90 A;  2Y3Q A;  4PGI A;  4LQH A;  3WVW A;  4IWJ A;  3UFB A;  4DE6 A;  1LKO A;  4MUD A;  5JKL A;  2XJM A;  4TW3 A;  2BKC A;  3V3K B;  3QB9 A;  4DYY A;  3PVT A;  1NNQ A;  4PGK A;  2V15 A;  5FFB A;  3H7G A;  4ITW A;  2CIH A;  3VVA A;  5J8S A;  3WNW A;  3Q4O A;  4KXR B;  4ISP A;  5GU3 X;  2YJJ A;  1OTK A;  5LBH A;  3RD0 A;  4Y08 A;  1YV1 A;  1JTS A;  4EVE A;  1SQ3 A;  3A9Q A;  3RGD A;  1RCC A;  4RC6 A;  2FKZ A;  2V2O A;  3F34 A;  3KWO A;  1YUX A;  2JD6 0;  3GGY A;  4ZKH A;  2VXI A;  3BVE A;  4EVB A;  3BVK A;  2VZB A;  3TA8 A;  3PWQ C;  1NF4 A;  4ZL6 A;  3PW8 A;  4YVZ A;  4AM2 A;  3W54 A;  3QVD A;  3PZA A;  1HRS A;  2QQY A;  4ZMC A;  3VV9 A;  4AM4 A;  1XZ1 A;  3SE1 A;  2V8U A;  2BW1 A;  2XJN A;  5GU0 X;  2CN6 A;  2FZF A;  3JZA B;  2D5K A;  3BKN A;  3R2H A;  4MY7 A;  4RC8 A;  1RCE A;  4CYA A;  2UX1 A;  3KHK A;  4RC5 A;  5ERK A;  2Z5P A;  3AF7 X;  3Q4Q A;  1S2Z A;  5JKM G;  4KVQ A;  3AJP A;  4TOC A;  3IS7 A;  2F7N A;  2CWL A;  2WTL A;  1MFR A;  5ERJ A;  3C1Y A;  3NP2 X;  1VEL A;  3PW8 C;  4ZKW A;  4DYX A;  2FL0 A;  1DPS A;  1VEQ A;  4A25 A;  2MGY A;  3L0M A;  2ZA7 A;  1TKO A;  1QYB A;  3PVR B;  1O9R A;  3AK8 A;  3GGZ A;  1TK6 A;  2OH3 A;  2IB0 A;  1YUZ A;  5D8R A;  2Z90 A;  3T9J A;  2Z6M A;  5JKL G;  4CVR A;  4WJG 4;  3QD8 A;  2ITB A;  1NFV A;  3PVY B;  3E1L A;  2C41 A;  2C2J A;  3SID A;  4ERU A;  2IY4 A;  3UOF A;  4ZL5 A;  2PYB A;  4RC7 B;  2FFX J;  3E1Q A;  1TJO A;  4CMY A;  5CMQ A;  4RC5 B;  2FG8 A;  3F37 A;  4CMY V;  5LS9 A;  5LG2 A;  4E40 A;  2V2L A;  3MPS A;  4LQN A;  4MXP A;  3C1Z A;  1Z6O M;  3PWQ A;  3JZ9 A;  2X17 0;  2OKC A;  1JYB A;  2CEI A;  1Z4A A;  1UMN A;  1O9I A;  3NP0 X;  4ITT A;  4MJY A;  3FRS A;  5HJH A;  3E6R A;  1B71 A;  4Z5S A;  3UNO A;  1VJX A;  3R2O A;  4LYX A;  3O7S A;  3PVR A;  3HIU A;  4YKH A;  3F33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...