2CHPA

Crystal structure of the dodecameric ferritin mrga from b. subtilis 168
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
148
structure length
148
Chain Sequence
AKTNQTLVENSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAERLLAIGGQPVATVKEYTEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEENQDNATADLFVGLIEEVEKQVWMLSSYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords METALLOREGULATION DNA-BINDING STRESS PROTEIN
publication title Morphology of Dry Solid-Supported Protein Monolayers Dependent on the Substrate and Protein Surface Properties.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 66
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2chpA00
2YW6A 3WVWA 5GU2X 3AF7X 4ML5A 1Z6OA 4TW3A 3QD8A 3UNOA 5JKLA 3R2KA 4CYBA 4ISPA 3TA8A 2UX1A 2X170 3PVRB 2WLUA 1O9RA 3OJ5A 2V2LA 1GWGA 1B71A 3MPSA 1JIGA 2FJCA 2G4HA 1MFRA 5D8QA 3GVYA 3QZ3A 4XKSA 3Q4RA 4ZLWA 4AM2A 5E2DA 4R42A 5GN8B 2IU2A 1AEWA 2ITBA 4XGSA 1HRSA 3PWFA 2BW1A 3BVKA 4IWKA 1QYBA 4ZTTA 1L8HA 1YV1A 4CY9A 2ZA7A 3E1PA 4LPMA 2W0OA 5FFCA 4QUWA 1SOFA 3NP0X 4ZJKA 2YJJA 5D8YA 3KA4A 2V2SA 3PVRA 4KVSA 4LPNA 3F32A 4CVTA 1RCCA 1QGHA 3T9JA 1TK6A 1KRQA 3R2MA 2C6RA 2ZG8X 2CF7A 3QHBA 1RCEA 4Z3BA 1BCFA 4TOAA 1RCIA 3Q4QA 3EZ0A 5CMRA 4DYXA 2ZG7X 3AF8X 3A68A 4LPJA 4LQHA 1F30A 5ERKA 3PW8A 5K53A 4II4B 5GU1X 3F37A 3E1MA 4EVEA 5FFDA 1J30A 1VEQA 3E1LA 2V2JA 3WNWA 4ERUA 5D8SA 3E1NA 4ZL5A 1JKVA 3FVBA 3PW8C 4EVCA 3ISFA 1UMNA 3F33A 4AM4A 2YW7A 3F39A 5FFEA 2XJOA 4MKUA 1YUZA 3KA3A 2Z5PA 2BKCA 2FG8A 1JTSA 4DZ0A 5JACA 3R2OA 5AXSA 4RC7B 4M34A 2CHIA 2OC5A 4TODA 4U3GA 5ERJA 3IQ1A 3PZAA 2CIHA 3PW1B 3FSEA 4OYNA 2V2PA 3E1QA 1VLGA 2XJNA 4LYUA 4Y08A 3RD0A 2JD80 4REUA 1VJXA 2ZA6A 1ZUJA 4M33A 5D8PA 3KX9A 3O7RA 3F35A 4M35A 3IS7A 3PVYB 4CVPA 1YUXA 1JYBA 3F36A 1DATA 3BVLA 3UOFA 2V2IA 5LBHA 3AK9A 1F33A 3PVTB 2V2OA 2XJMA 4TOFA 4RC7A 2Y3QA 2IY4A 1TJOA 4MJYA 5LG8A 1N1QA 5D8OA 2VXXA 1S3QA 3PWQA 5CZUA 2Z6MA 2V15A 3GE4A 2GYQA 1DVBA 3Q4OA 5FFAA 2BK6A 4RC5B 2CLUA 3IS8A 3R2SA 5K52A 5GN8A 2CN6A 3BT5A 5GU3X 4DYZA 1BG7A 2OH3A 4ITWA 4CMYV 5JKLG 3KA8A 2ZA8A 4DI0A 2C2FA 1LB3A 2VZBA 4Z5SA 3A9QA 1LKOA 3PWQC 4MUDA 4PGIA 1NFVA 3EZUA 2F7NA 5C6FA 2V2NA 4RC6B 1L8IA 1IERA 1R03A 3R2LA 5E1UA 5LS9A 4KVQA 2V2RA 5JKMA 1LKPA 4KVRA 5HJHA 3SIDA 4LYXA 4LQNA 4ZKWA 3SHXA 4IXKA 1LKMA 4ETRA 4RC5A 2XGWA 3RBCA 3Q4NA 4MY7A 1RCDA 3NP2X 5HQOA 3AF9X 5IX6A 2Z5RA 5D8RA 4CMYA 4ZMCA 3E6SA 3UOIA 5LG2A 1NF6A 1ZS3A 4P18A 3F34A 5I4JA 2FHAA 4II4A 4PG1A 3NOZX 5D8XA 4LQJA 3E2CA 2ZURX 5GOUA 3KXUA 1NF4A 4IWJA 3KA6A 4ZKXA 2CN7A 2HTNA 2VXIA 4DASA 3HL1A 4TOCA 2WTLA 1JREA 5CMQA 4DYYA 4EVBA 3BKNA 2GS4A 3QB9A 2C2JA 1TKOA 4RC8A 4CVSA 3ES3A 3O7SA 2QF9A 3R2HA 4DYUA 2GYDA 4LQVA 3QVDA 2CHPA 1RYTA 3WVVA 4M32A 3RE7A 2FZFA 3F38A 1XZ1A 5J9VA 1OTKA 2IB0A 4ZKHA 3OGHA 2BJYA 4XKUA 4ZL6A 5JKMG 1MOJA 1BFRA 3E1JA 3BVFA 2CLBA 2FL0A 3R2RA 4EVDA 5J93A 2RBDA 3PW1A 4CYAA 3SE1A 2QQYA 3E1OA 4PG0A 1S2ZA 4CVRA 1VEIA 4TO9A 3AJQA 4TOGA 3KWOA 3ISEA 3BVEA 4ITTA 4MN9A 5GU0X 1FHAA 3HIUA 4ISMA 2Z90A 1IESA 3PVYA 3RAVA 4AM5A 3BVIA 3H7GA 3SH6A 2XKQA 2C2UA 2JD60 2FKZA 2Z5QA 3AJOA 3WVUA 1S30A 2FG4A 4A25A 2D5KA 3PVTA 4XKTA 4E6KA 1JKUA 3RGDA 2HR5A 3EGMA 1Z4AA 3AJPA 3GHQA 3QHCA 2FFXJ 1NNQA 1DPSA 2V2MA 4YKHA 1Z6OM 3KA9A 3FI6A 4TOHA 3VNXA 1UVHA 4TOEA 3ERZA 3AK8A 1EUMA 1JGCA 2JD70 2PYBA 4TOBA 1TKPA 2ZG9X 3U90A 1H96A 2C41A 2CEIA 5HJFA 5J8WA 1RCGA 1VELA 4DE6A 4PGKA 1XZ3A 3E6RA 1JI4A 2WLAA 5J8SA 1JI5A 4RC6A 2YJKA 1O9IA 5FEJA 5FFBA 1SQ3A
chains in the Genus database with same CATH superfamily
2YW6A 3WVWA 5GU2X 2AR0A 3AF7X 4ML5A 1Z6OA 4TW3A 3QD8A 3UNOA 5JKLA 3R2KA 4CYBA 4ISPA 4YVZA 3TA8A 2UX1A 2X170 3PVRB 2WLUA 2WWXB 1O9RA 3OJ5A 2V2LA 1GWGA 1B71A 3MPSA 1JIGA 2FJCA 2G4HA 1MFRA 5D8QA 3GVYA 3QZ3A 3VVAA 4XKSA 3Q4RA 4ZLWA 4AM2A 5E2DA 4R42A 5GN8B 2IU2A 1AEWA 2ITBA 4XGSA 1HRSA 3VV9A 3PWFA 2BW1A 3BVKA 4IWKA 1QYBA 4ZTTA 1L8HA 1YV1A 4CY9A 2ZA7A 3E1PA 4LPMA 2W0OA 5FFCA 4QUWA 1SOFA 3NP0X 4ZJKA 2YJJA 5D8YA 3KA4A 4E40A 2V2SA 3PVRA 4KVSA 4LPNA 3F32A 4CVTA 1RCCA 1QGHA 3T9JA 1TK6A 1KRQA 3R2MA 2N02A 2C6RA 2ZG8X 2CF7A 3QHBA 1RCEA 4Z3BA 1BCFA 4TOAA 1RCIA 3Q4QA 3L0MA 3EZ0A 3D19A 5CMRA 4DYXA 2ZG7X 3AF8X 3A68A 4LPJA 4LQHA 1F30A 5ERKA 3PW8A 3C1YA 5K53A 4II4B 5GU1X 3F37A 3E1MA 4EVEA 5FFDA 5JDOA 1J30A 1VEQA 3E1LA 2V2JA 3WNWA 4ERUA 5D8SA 3E1NA 4ZL5A 1JKVA 3FVBA 3PW8C 4EVCA 3ISFA 1UMNA 3F33A 4AM4A 2YW7A 3F39A 4WJG4 5FFEA 2XJOA 4MKUA 1YUZA 2V8UA 3KA3A 2Z5PA 2BKCA 2FG8A 1JTSA 4DZ0A 5JACA 3R2OA 5AXSA 4RC7B 4M34A 2CHIA 2OC5A 4TODA 4U3GA 5ERJA 3IQ1A 3DBYA 3PZAA 2CIHA 3PW1B 3FSEA 4OYNA 2V2PA 3E1QA 1VLGA 2XJNA 4LYUA 4Y08A 3RD0A 2JD80 4REUA 1VJXA 2ZA6A 1ZUJA 4M33A 5D8PA 3KX9A 3M6JA 3O7RA 4W4KB 3F35A 4M35A 3IS7A 3PVYB 4CVPA 1YUXA 1JYBA 3F36A 1DATA 3BVLA 3UOFA 2V2IA 5LBHA 3AK9A 1F33A 3PVTB 3V3KB 2V2OA 2XJMA 4TOFA 4RC7A 2Y3QA 2IY4A 1TJOA 4MJYA 5LG8A 1N1QA 5D8OA 2VXXA 1S3QA 3PWQA 5CZUA 2Z6MA 2V15A 3GE4A 2GYQA 2V8TA 1DVBA 3Q4OA 5FFAA 2BK6A 4RC5B 2CLUA 3IS8A 3R2SA 5K52A 5GN8A 2CN6A 3BT5A 5GU3X 4DYZA 1BG7A 2OH3A 4ITWA 4CMYV 5JKLG 3N6OA 3KA8A 2ZA8A 4DI0A 2C2FA 1LB3A 2VZBA 4Z5SA 3A9QA 1LKOA 3PWQC 4MUDA 4PGIA 1NFVA 3EZUA 2F7NA 5C6FA 4W4LB 2V2NA 4RC6B 1L8IA 1IERA 1R03A 3R2LA 5E1UA 2CWLA 4YXJA 5LS9A 4KVQA 2V2RA 3FRSA 5JKMA 1LKPA 4KVRA 3JZ9A 5HJHA 3SIDA 4LYXA 2Y44A 4LQNA 4ZKWA 3SHXA 4IXKA 1LKMA 4ETRA 3GGYA 1SQ3A 4RC5A 4KXRB 2XGWA 3RBCA 3Q4NA 4MY7A 1RCDA 3NP2X 5HQOA 3AF9X 3FRRA 3LKDA 5IX6A 2Z5RA 5D8RA 4CMYA 4ZMCA 3E6SA 3UOIA 5LG2A 1NF6A 1ZS3A 4P18A 3F34A 5I4JA 2FHAA 4II4A 2MGYA 3NOZX 4PG1A 5D8XA 4LQJA 3E2CA 2ZURX 5GOUA 3KXUA 1NF4A 4IWJA 3KA6A 4ZKXA 2CN7A 2HTNA 2VXIA 4DASA 3HL1A 4TOCA 2WTLA 1JREA 5CMQA 4DYYA 4EVBA 3BKNA 2GS4A 4X0JA 3QB9A 2C2JA 1TKOA 4RC8A 4CVSA 3ES3A 3O7SA 2QF9A 3R2HA 4DYUA 2GYDA 4LQVA 3QVDA 2CHPA 1RYTA 3WVVA 2G38B 4M32A 3RE7A 3C1ZA 2FZFA 3F38A 5HU6D 1XZ1A 5J9VA 1OTKA 2IB0A 4ZKHA 3OGHA 3KDQA 2BJYA 4XKUA 4ZL6A 5JKMG 1MOJA 1BFRA 3E1JA 3BVFA 2CLBA 2FL0A 3R2RA 4EVDA 5J93A 2RBDA 3PW1A 5JDOB 4CYAA 3SE1A 2QQYA 3E1OA 4PG0A 3C21A 1S2ZA 4CVRA 1VEIA 4TO9A 3AJQA 4TOGA 3GGZA 3KWOA 3ISEA 3BVEA 4ITTA 4MN9A 5GU0X 1FHAA 3HIUA 3C23A 4ISMA 2Z90A 1IESA 3PVYA 3RAVA 4AM5A 3BVIA 3H7GA 3SH6A 2XKQA 3KHKA 2C2UA 2JD60 2FKZA 2Z5QA 3AJOA 3WVUA 1S30A 2FG4A 4A25A 2D5KA 3PVTA 4XKTA 4E6KA 1JKUA 3RGDA 2HR5A 3EGMA 1Z4AA 3AJPA 3GHQA 3QHCA 2FFXJ 1NNQA 1DPSA 2V2MA 4YKHA 1Z6OM 3KA9A 3FI6A 4TOHA 3VNXA 1UVHA 4TOEA 3ERZA 3AK8A 1EUMA 1JGCA 2JD70 2PYBA 4TOBA 1TKPA 2ZG9X 3U90A 1H96A 2C41A 2CEIA 5HJFA 5J8WA 1RCGA 2OKCA 1VELA 4DE6A 1XZ3A 4PGKA 4YXMA 3E6RA 1JI4A 4MXPA 2WLAA 5J8SA 1JI5A 4RC6A 2YJKA 1O9IA 3W54A 3UFBA 5FEJA 5FFBA 3JZAB
chains in the Genus database with same CATH topology
2YW6A 3WVWA 5GU2X 2AR0A 3AF7X 4ML5A 1Z6OA 4TW3A 3QD8A 3UNOA 5JKLA 3R2KA 4CYBA 4ISPA 4YVZA 3TA8A 2UX1A 2X170 3PVRB 2WLUA 2WWXB 1O9RA 3OJ5A 2V2LA 1GWGA 1B71A 3MPSA 1JIGA 2FJCA 2G4HA 1MFRA 5D8QA 3GVYA 3QZ3A 3VVAA 4XKSA 3Q4RA 4ZLWA 4AM2A 5E2DA 4R42A 5GN8B 2IU2A 1AEWA 2ITBA 4XGSA 1HRSA 3VV9A 3PWFA 2BW1A 3BVKA 4IWKA 1QYBA 4ZTTA 1L8HA 1YV1A 4CY9A 2ZA7A 3E1PA 4LPMA 2W0OA 5FFCA 4QUWA 1SOFA 3NP0X 4ZJKA 2YJJA 5D8YA 3KA4A 4E40A 2V2SA 3PVRA 4KVSA 4LPNA 3F32A 4CVTA 1RCCA 1QGHA 3T9JA 1TK6A 1KRQA 3R2MA 2N02A 2C6RA 2ZG8X 2CF7A 3QHBA 1RCEA 4Z3BA 1BCFA 4TOAA 1RCIA 3Q4QA 3L0MA 3EZ0A 3D19A 5CMRA 4DYXA 2ZG7X 3AF8X 3A68A 4LPJA 4LQHA 1F30A 5ERKA 3PW8A 3C1YA 5K53A 4II4B 5GU1X 3F37A 3E1MA 4EVEA 5FFDA 5JDOA 1J30A 1VEQA 3E1LA 2V2JA 3WNWA 4ERUA 5D8SA 3E1NA 4ZL5A 1JKVA 3FVBA 3PW8C 4EVCA 3ISFA 1UMNA 3F33A 4AM4A 2YW7A 3F39A 4WJG4 5FFEA 2XJOA 4MKUA 1YUZA 2V8UA 3KA3A 2Z5PA 2BKCA 2FG8A 1JTSA 4DZ0A 5JACA 3R2OA 5AXSA 4RC7B 4M34A 2CHIA 2OC5A 4TODA 4U3GA 5ERJA 3IQ1A 3DBYA 3PZAA 2CIHA 3PW1B 3FSEA 4OYNA 2V2PA 3E1QA 1VLGA 2XJNA 4LYUA 4Y08A 3RD0A 2JD80 4REUA 1VJXA 2ZA6A 1ZUJA 4M33A 5D8PA 3KX9A 3M6JA 3O7RA 4W4KB 3F35A 4M35A 3IS7A 3PVYB 4CVPA 1YUXA 1JYBA 3F36A 1DATA 3BVLA 3UOFA 2V2IA 5LBHA 3AK9A 1F33A 3PVTB 3V3KB 2V2OA 2XJMA 4TOFA 4RC7A 2Y3QA 2IY4A 1TJOA 4MJYA 5LG8A 1N1QA 5D8OA 2VXXA 1S3QA 3PWQA 5CZUA 2Z6MA 2V15A 3GE4A 2GYQA 2V8TA 1DVBA 3Q4OA 5FFAA 2BK6A 4RC5B 2CLUA 3IS8A 3R2SA 5K52A 5GN8A 2CN6A 3BT5A 5GU3X 4DYZA 1BG7A 2OH3A 4ITWA 4CMYV 5JKLG 3N6OA 3KA8A 2ZA8A 4DI0A 2C2FA 1LB3A 2VZBA 4Z5SA 3A9QA 1LKOA 3PWQC 4MUDA 4PGIA 1NFVA 3EZUA 2F7NA 5C6FA 4W4LB 2V2NA 4RC6B 1L8IA 1IERA 1R03A 3R2LA 5E1UA 2CWLA 4YXJA 5LS9A 4KVQA 2V2RA 3FRSA 5JKMA 1LKPA 4KVRA 3JZ9A 5HJHA 3SIDA 4LYXA 2Y44A 4LQNA 4ZKWA 3SHXA 4IXKA 1LKMA 4ETRA 3GGYA 1SQ3A 4RC5A 4KXRB 2XGWA 3RBCA 3Q4NA 4MY7A 1RCDA 3NP2X 5HQOA 3AF9X 3FRRA 3LKDA 5IX6A 2Z5RA 5D8RA 4CMYA 4ZMCA 3E6SA 3UOIA 5LG2A 1NF6A 1ZS3A 4P18A 3F34A 5I4JA 2FHAA 4II4A 2MGYA 3NOZX 4PG1A 5D8XA 4LQJA 3E2CA 2ZURX 5GOUA 3KXUA 1NF4A 4IWJA 3KA6A 4ZKXA 2CN7A 2HTNA 2VXIA 4DASA 3HL1A 4TOCA 2WTLA 1JREA 5CMQA 4DYYA 4EVBA 3BKNA 2GS4A 4X0JA 3QB9A 2C2JA 1TKOA 4RC8A 4CVSA 3ES3A 3O7SA 2QF9A 3R2HA 4DYUA 2GYDA 4LQVA 3QVDA 2CHPA 1RYTA 3WVVA 2G38B 4M32A 3RE7A 3C1ZA 2FZFA 3F38A 5HU6D 1XZ1A 5J9VA 1OTKA 2IB0A 4ZKHA 3OGHA 3KDQA 2BJYA 4XKUA 4ZL6A 5JKMG 1MOJA 1BFRA 3E1JA 3BVFA 2CLBA 2FL0A 3R2RA 4EVDA 5J93A 2RBDA 3PW1A 5JDOB 4CYAA 3SE1A 2QQYA 3E1OA 4PG0A 3C21A 1S2ZA 4CVRA 1VEIA 4TO9A 3AJQA 4TOGA 3GGZA 3KWOA 3ISEA 3BVEA 4ITTA 4MN9A 5GU0X 1FHAA 3HIUA 3C23A 4ISMA 2Z90A 1IESA 3PVYA 3RAVA 4AM5A 3BVIA 3H7GA 3SH6A 2XKQA 3KHKA 2C2UA 2JD60 2FKZA 2Z5QA 3AJOA 3WVUA 1S30A 2FG4A 4A25A 2D5KA 3PVTA 4XKTA 4E6KA 1JKUA 3RGDA 2HR5A 3EGMA 1Z4AA 3AJPA 3GHQA 3QHCA 2FFXJ 1NNQA 1DPSA 2V2MA 4YKHA 1Z6OM 3KA9A 3FI6A 4TOHA 3VNXA 1UVHA 4TOEA 3ERZA 3AK8A 1EUMA 1JGCA 2JD70 2PYBA 4TOBA 1TKPA 2ZG9X 3U90A 1H96A 2C41A 2CEIA 5HJFA 5J8WA 1RCGA 2OKCA 1VELA 4DE6A 1XZ3A 4PGKA 4YXMA 3E6RA 1JI4A 4MXPA 2WLAA 5J8SA 1JI5A 4RC6A 2YJKA 1O9IA 3W54A 3UFBA 5FEJA 5FFBA 3JZAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YW6 A;  3WVW A;  5GU2 X;  3AF7 X;  4ML5 A;  1Z6O A;  4TW3 A;  3QD8 A;  3UNO A;  5JKL A;  3R2K A;  4CYB A;  4ISP A;  3TA8 A;  2UX1 A;  2X17 0;  3PVR B;  2WLU A;  1O9R A;  3OJ5 A;  2V2L A;  1GWG A;  1B71 A;  3MPS A;  1JIG A;  2FJC A;  2G4H A;  1MFR A;  5D8Q A;  3GVY A;  3QZ3 A;  4XKS A;  3Q4R A;  4ZLW A;  4AM2 A;  5E2D A;  4R42 A;  5GN8 B;  2IU2 A;  1AEW A;  2ITB A;  4XGS A;  1HRS A;  3PWF A;  2BW1 A;  3BVK A;  4IWK A;  1QYB A;  4ZTT A;  1L8H A;  1YV1 A;  4CY9 A;  2ZA7 A;  3E1P A;  4LPM A;  2W0O A;  5FFC A;  4QUW A;  1SOF A;  3NP0 X;  4ZJK A;  2YJJ A;  5D8Y A;  3KA4 A;  2V2S A;  3PVR A;  4KVS A;  4LPN A;  3F32 A;  4CVT A;  1RCC A;  1QGH A;  3T9J A;  1TK6 A;  1KRQ A;  3R2M A;  2C6R A;  2ZG8 X;  2CF7 A;  3QHB A;  1RCE A;  4Z3B A;  1BCF A;  4TOA A;  1RCI A;  3Q4Q A;  3EZ0 A;  5CMR A;  4DYX A;  2ZG7 X;  3AF8 X;  3A68 A;  4LPJ A;  4LQH A;  1F30 A;  5ERK A;  3PW8 A;  5K53 A;  4II4 B;  5GU1 X;  3F37 A;  3E1M A;  4EVE A;  5FFD A;  1J30 A;  1VEQ A;  3E1L A;  2V2J A;  3WNW A;  4ERU A;  5D8S A;  3E1N A;  4ZL5 A;  1JKV A;  3FVB A;  3PW8 C;  4EVC A;  3ISF A;  1UMN A;  3F33 A;  4AM4 A;  2YW7 A;  3F39 A;  5FFE A;  2XJO A;  4MKU A;  1YUZ A;  3KA3 A;  2Z5P A;  2BKC A;  2FG8 A;  1JTS A;  4DZ0 A;  5JAC A;  3R2O A;  5AXS A;  4RC7 B;  4M34 A;  2CHI A;  2OC5 A;  4TOD A;  4U3G A;  5ERJ A;  3IQ1 A;  3PZA A;  2CIH A;  3PW1 B;  3FSE A;  4OYN A;  2V2P A;  3E1Q A;  1VLG A;  2XJN A;  4LYU A;  4Y08 A;  3RD0 A;  2JD8 0;  4REU A;  1VJX A;  2ZA6 A;  1ZUJ A;  4M33 A;  5D8P A;  3KX9 A;  3O7R A;  3F35 A;  4M35 A;  3IS7 A;  3PVY B;  4CVP A;  1YUX A;  1JYB A;  3F36 A;  1DAT A;  3BVL A;  3UOF A;  2V2I A;  5LBH A;  3AK9 A;  1F33 A;  3PVT B;  2V2O A;  2XJM A;  4TOF A;  4RC7 A;  2Y3Q A;  2IY4 A;  1TJO A;  4MJY A;  5LG8 A;  1N1Q A;  5D8O A;  2VXX A;  1S3Q A;  3PWQ A;  5CZU A;  2Z6M A;  2V15 A;  3GE4 A;  2GYQ A;  1DVB A;  3Q4O A;  5FFA A;  2BK6 A;  4RC5 B;  2CLU A;  3IS8 A;  3R2S A;  5K52 A;  5GN8 A;  2CN6 A;  3BT5 A;  5GU3 X;  4DYZ A;  1BG7 A;  2OH3 A;  4ITW A;  4CMY V;  5JKL G;  3KA8 A;  2ZA8 A;  4DI0 A;  2C2F A;  1LB3 A;  2VZB A;  4Z5S A;  3A9Q A;  1LKO A;  3PWQ C;  4MUD A;  4PGI A;  1NFV A;  3EZU A;  2F7N A;  5C6F A;  2V2N A;  4RC6 B;  1L8I A;  1IER A;  1R03 A;  3R2L A;  5E1U A;  5LS9 A;  4KVQ A;  2V2R A;  5JKM A;  1LKP A;  4KVR A;  5HJH A;  3SID A;  4LYX A;  4LQN A;  4ZKW A;  3SHX A;  4IXK A;  1LKM A;  4ETR A;  4RC5 A;  2XGW A;  3RBC A;  3Q4N A;  4MY7 A;  1RCD A;  3NP2 X;  5HQO A;  3AF9 X;  5IX6 A;  2Z5R A;  5D8R A;  4CMY A;  4ZMC A;  3E6S A;  3UOI A;  5LG2 A;  1NF6 A;  1ZS3 A;  4P18 A;  3F34 A;  5I4J A;  2FHA A;  4II4 A;  4PG1 A;  3NOZ X;  5D8X A;  4LQJ A;  3E2C A;  2ZUR X;  5GOU A;  3KXU A;  1NF4 A;  4IWJ A;  3KA6 A;  4ZKX A;  2CN7 A;  2HTN A;  2VXI A;  4DAS A;  3HL1 A;  4TOC A;  2WTL A;  1JRE A;  5CMQ A;  4DYY A;  4EVB A;  3BKN A;  2GS4 A;  3QB9 A;  2C2J A;  1TKO A;  4RC8 A;  4CVS A;  3ES3 A;  3O7S A;  2QF9 A;  3R2H A;  4DYU A;  2GYD A;  4LQV A;  3QVD A;  2CHP A;  1RYT A;  3WVV A;  4M32 A;  3RE7 A;  2FZF A;  3F38 A;  1XZ1 A;  5J9V A;  1OTK A;  2IB0 A;  4ZKH A;  3OGH A;  2BJY A;  4XKU A;  4ZL6 A;  5JKM G;  1MOJ A;  1BFR A;  3E1J A;  3BVF A;  2CLB A;  2FL0 A;  3R2R A;  4EVD A;  5J93 A;  2RBD A;  3PW1 A;  4CYA A;  3SE1 A;  2QQY A;  3E1O A;  4PG0 A;  1S2Z A;  4CVR A;  1VEI A;  4TO9 A;  3AJQ A;  4TOG A;  3KWO A;  3ISE A;  3BVE A;  4ITT A;  4MN9 A;  5GU0 X;  1FHA A;  3HIU A;  4ISM A;  2Z90 A;  1IES A;  3PVY A;  3RAV A;  4AM5 A;  3BVI A;  3H7G A;  3SH6 A;  2XKQ A;  2C2U A;  2JD6 0;  2FKZ A;  2Z5Q A;  3AJO A;  3WVU A;  1S30 A;  2FG4 A;  4A25 A;  2D5K A;  3PVT A;  4XKT A;  4E6K A;  1JKU A;  3RGD A;  2HR5 A;  3EGM A;  1Z4A A;  3AJP A;  3GHQ A;  3QHC A;  2FFX J;  1NNQ A;  1DPS A;  2V2M A;  4YKH A;  1Z6O M;  3KA9 A;  3FI6 A;  4TOH A;  3VNX A;  1UVH A;  4TOE A;  3ERZ A;  3AK8 A;  1EUM A;  1JGC A;  2JD7 0;  2PYB A;  4TOB A;  1TKP A;  2ZG9 X;  3U90 A;  1H96 A;  2C41 A;  2CEI A;  5HJF A;  5J8W A;  1RCG A;  1VEL A;  4DE6 A;  4PGK A;  1XZ3 A;  3E6R A;  1JI4 A;  2WLA A;  5J8S A;  1JI5 A;  4RC6 A;  2YJK A;  1O9I A;  5FEJ A;  5FFB A;  1SQ3 A; 
#chains in the Genus database with same CATH topology
 2YW6 A;  3WVW A;  5GU2 X;  2AR0 A;  3AF7 X;  4ML5 A;  1Z6O A;  4TW3 A;  3QD8 A;  3UNO A;  5JKL A;  3R2K A;  4CYB A;  4ISP A;  4YVZ A;  3TA8 A;  2UX1 A;  2X17 0;  3PVR B;  2WLU A;  2WWX B;  1O9R A;  3OJ5 A;  2V2L A;  1GWG A;  1B71 A;  3MPS A;  1JIG A;  2FJC A;  2G4H A;  1MFR A;  5D8Q A;  3GVY A;  3QZ3 A;  3VVA A;  4XKS A;  3Q4R A;  4ZLW A;  4AM2 A;  5E2D A;  4R42 A;  5GN8 B;  2IU2 A;  1AEW A;  2ITB A;  4XGS A;  1HRS A;  3VV9 A;  3PWF A;  2BW1 A;  3BVK A;  4IWK A;  1QYB A;  4ZTT A;  1L8H A;  1YV1 A;  4CY9 A;  2ZA7 A;  3E1P A;  4LPM A;  2W0O A;  5FFC A;  4QUW A;  1SOF A;  3NP0 X;  4ZJK A;  2YJJ A;  5D8Y A;  3KA4 A;  4E40 A;  2V2S A;  3PVR A;  4KVS A;  4LPN A;  3F32 A;  4CVT A;  1RCC A;  1QGH A;  3T9J A;  1TK6 A;  1KRQ A;  3R2M A;  2N02 A;  2C6R A;  2ZG8 X;  2CF7 A;  3QHB A;  1RCE A;  4Z3B A;  1BCF A;  4TOA A;  1RCI A;  3Q4Q A;  3L0M A;  3EZ0 A;  3D19 A;  5CMR A;  4DYX A;  2ZG7 X;  3AF8 X;  3A68 A;  4LPJ A;  4LQH A;  1F30 A;  5ERK A;  3PW8 A;  3C1Y A;  5K53 A;  4II4 B;  5GU1 X;  3F37 A;  3E1M A;  4EVE A;  5FFD A;  5JDO A;  1J30 A;  1VEQ A;  3E1L A;  2V2J A;  3WNW A;  4ERU A;  5D8S A;  3E1N A;  4ZL5 A;  1JKV A;  3FVB A;  3PW8 C;  4EVC A;  3ISF A;  1UMN A;  3F33 A;  4AM4 A;  2YW7 A;  3F39 A;  4WJG 4;  5FFE A;  2XJO A;  4MKU A;  1YUZ A;  2V8U A;  3KA3 A;  2Z5P A;  2BKC A;  2FG8 A;  1JTS A;  4DZ0 A;  5JAC A;  3R2O A;  5AXS A;  4RC7 B;  4M34 A;  2CHI A;  2OC5 A;  4TOD A;  4U3G A;  5ERJ A;  3IQ1 A;  3DBY A;  3PZA A;  2CIH A;  3PW1 B;  3FSE A;  4OYN A;  2V2P A;  3E1Q A;  1VLG A;  2XJN A;  4LYU A;  4Y08 A;  3RD0 A;  2JD8 0;  4REU A;  1VJX A;  2ZA6 A;  1ZUJ A;  4M33 A;  5D8P A;  3KX9 A;  3M6J A;  3O7R A;  4W4K B;  3F35 A;  4M35 A;  3IS7 A;  3PVY B;  4CVP A;  1YUX A;  1JYB A;  3F36 A;  1DAT A;  3BVL A;  3UOF A;  2V2I A;  5LBH A;  3AK9 A;  1F33 A;  3PVT B;  3V3K B;  2V2O A;  2XJM A;  4TOF A;  4RC7 A;  2Y3Q A;  2IY4 A;  1TJO A;  4MJY A;  5LG8 A;  1N1Q A;  5D8O A;  2VXX A;  1S3Q A;  3PWQ A;  5CZU A;  2Z6M A;  2V15 A;  3GE4 A;  2GYQ A;  2V8T A;  1DVB A;  3Q4O A;  5FFA A;  2BK6 A;  4RC5 B;  2CLU A;  3IS8 A;  3R2S A;  5K52 A;  5GN8 A;  2CN6 A;  3BT5 A;  5GU3 X;  4DYZ A;  1BG7 A;  2OH3 A;  4ITW A;  4CMY V;  5JKL G;  3N6O A;  3KA8 A;  2ZA8 A;  4DI0 A;  2C2F A;  1LB3 A;  2VZB A;  4Z5S A;  3A9Q A;  1LKO A;  3PWQ C;  4MUD A;  4PGI A;  1NFV A;  3EZU A;  2F7N A;  5C6F A;  4W4L B;  2V2N A;  4RC6 B;  1L8I A;  1IER A;  1R03 A;  3R2L A;  5E1U A;  2CWL A;  4YXJ A;  5LS9 A;  4KVQ A;  2V2R A;  3FRS A;  5JKM A;  1LKP A;  4KVR A;  3JZ9 A;  5HJH A;  3SID A;  4LYX A;  2Y44 A;  4LQN A;  4ZKW A;  3SHX A;  4IXK A;  1LKM A;  4ETR A;  3GGY A;  1SQ3 A;  4RC5 A;  4KXR B;  2XGW A;  3RBC A;  3Q4N A;  4MY7 A;  1RCD A;  3NP2 X;  5HQO A;  3AF9 X;  3FRR A;  3LKD A;  5IX6 A;  2Z5R A;  5D8R A;  4CMY A;  4ZMC A;  3E6S A;  3UOI A;  5LG2 A;  1NF6 A;  1ZS3 A;  4P18 A;  3F34 A;  5I4J A;  2FHA A;  4II4 A;  2MGY A;  3NOZ X;  4PG1 A;  5D8X A;  4LQJ A;  3E2C A;  2ZUR X;  5GOU A;  3KXU A;  1NF4 A;  4IWJ A;  3KA6 A;  4ZKX A;  2CN7 A;  2HTN A;  2VXI A;  4DAS A;  3HL1 A;  4TOC A;  2WTL A;  1JRE A;  5CMQ A;  4DYY A;  4EVB A;  3BKN A;  2GS4 A;  4X0J A;  3QB9 A;  2C2J A;  1TKO A;  4RC8 A;  4CVS A;  3ES3 A;  3O7S A;  2QF9 A;  3R2H A;  4DYU A;  2GYD A;  4LQV A;  3QVD A;  2CHP A;  1RYT A;  3WVV A;  2G38 B;  4M32 A;  3RE7 A;  3C1Z A;  2FZF A;  3F38 A;  5HU6 D;  1XZ1 A;  5J9V A;  1OTK A;  2IB0 A;  4ZKH A;  3OGH A;  3KDQ A;  2BJY A;  4XKU A;  4ZL6 A;  5JKM G;  1MOJ A;  1BFR A;  3E1J A;  3BVF A;  2CLB A;  2FL0 A;  3R2R A;  4EVD A;  5J93 A;  2RBD A;  3PW1 A;  5JDO B;  4CYA A;  3SE1 A;  2QQY A;  3E1O A;  4PG0 A;  3C21 A;  1S2Z A;  4CVR A;  1VEI A;  4TO9 A;  3AJQ A;  4TOG A;  3GGZ A;  3KWO A;  3ISE A;  3BVE A;  4ITT A;  4MN9 A;  5GU0 X;  1FHA A;  3HIU A;  3C23 A;  4ISM A;  2Z90 A;  1IES A;  3PVY A;  3RAV A;  4AM5 A;  3BVI A;  3H7G A;  3SH6 A;  2XKQ A;  3KHK A;  2C2U A;  2JD6 0;  2FKZ A;  2Z5Q A;  3AJO A;  3WVU A;  1S30 A;  2FG4 A;  4A25 A;  2D5K A;  3PVT A;  4XKT A;  4E6K A;  1JKU A;  3RGD A;  2HR5 A;  3EGM A;  1Z4A A;  3AJP A;  3GHQ A;  3QHC A;  2FFX J;  1NNQ A;  1DPS A;  2V2M A;  4YKH A;  1Z6O M;  3KA9 A;  3FI6 A;  4TOH A;  3VNX A;  1UVH A;  4TOE A;  3ERZ A;  3AK8 A;  1EUM A;  1JGC A;  2JD7 0;  2PYB A;  4TOB A;  1TKP A;  2ZG9 X;  3U90 A;  1H96 A;  2C41 A;  2CEI A;  5HJF A;  5J8W A;  1RCG A;  2OKC A;  1VEL A;  4DE6 A;  1XZ3 A;  4PGK A;  4YXM A;  3E6R A;  1JI4 A;  4MXP A;  2WLA A;  5J8S A;  1JI5 A;  4RC6 A;  2YJK A;  1O9I A;  3W54 A;  3UFB A;  5FEJ A;  5FFB A;  3JZA B; 
#chains in the Genus database with same CATH homology
 2YW6 A;  3WVW A;  5GU2 X;  2AR0 A;  3AF7 X;  4ML5 A;  1Z6O A;  4TW3 A;  3QD8 A;  3UNO A;  5JKL A;  3R2K A;  4CYB A;  4ISP A;  4YVZ A;  3TA8 A;  2UX1 A;  2X17 0;  3PVR B;  2WLU A;  2WWX B;  1O9R A;  3OJ5 A;  2V2L A;  1GWG A;  1B71 A;  3MPS A;  1JIG A;  2FJC A;  2G4H A;  1MFR A;  5D8Q A;  3GVY A;  3QZ3 A;  3VVA A;  4XKS A;  3Q4R A;  4ZLW A;  4AM2 A;  5E2D A;  4R42 A;  5GN8 B;  2IU2 A;  1AEW A;  2ITB A;  4XGS A;  1HRS A;  3VV9 A;  3PWF A;  2BW1 A;  3BVK A;  4IWK A;  1QYB A;  4ZTT A;  1L8H A;  1YV1 A;  4CY9 A;  2ZA7 A;  3E1P A;  4LPM A;  2W0O A;  5FFC A;  4QUW A;  1SOF A;  3NP0 X;  4ZJK A;  2YJJ A;  5D8Y A;  3KA4 A;  4E40 A;  2V2S A;  3PVR A;  4KVS A;  4LPN A;  3F32 A;  4CVT A;  1RCC A;  1QGH A;  3T9J A;  1TK6 A;  1KRQ A;  3R2M A;  2N02 A;  2C6R A;  2ZG8 X;  2CF7 A;  3QHB A;  1RCE A;  4Z3B A;  1BCF A;  4TOA A;  1RCI A;  3Q4Q A;  3L0M A;  3EZ0 A;  3D19 A;  5CMR A;  4DYX A;  2ZG7 X;  3AF8 X;  3A68 A;  4LPJ A;  4LQH A;  1F30 A;  5ERK A;  3PW8 A;  3C1Y A;  5K53 A;  4II4 B;  5GU1 X;  3F37 A;  3E1M A;  4EVE A;  5FFD A;  5JDO A;  1J30 A;  1VEQ A;  3E1L A;  2V2J A;  3WNW A;  4ERU A;  5D8S A;  3E1N A;  4ZL5 A;  1JKV A;  3FVB A;  3PW8 C;  4EVC A;  3ISF A;  1UMN A;  3F33 A;  4AM4 A;  2YW7 A;  3F39 A;  4WJG 4;  5FFE A;  2XJO A;  4MKU A;  1YUZ A;  2V8U A;  3KA3 A;  2Z5P A;  2BKC A;  2FG8 A;  1JTS A;  4DZ0 A;  5JAC A;  3R2O A;  5AXS A;  4RC7 B;  4M34 A;  2CHI A;  2OC5 A;  4TOD A;  4U3G A;  5ERJ A;  3IQ1 A;  3DBY A;  3PZA A;  2CIH A;  3PW1 B;  3FSE A;  4OYN A;  2V2P A;  3E1Q A;  1VLG A;  2XJN A;  4LYU A;  4Y08 A;  3RD0 A;  2JD8 0;  4REU A;  1VJX A;  2ZA6 A;  1ZUJ A;  4M33 A;  5D8P A;  3KX9 A;  3M6J A;  3O7R A;  4W4K B;  3F35 A;  4M35 A;  3IS7 A;  3PVY B;  4CVP A;  1YUX A;  1JYB A;  3F36 A;  1DAT A;  3BVL A;  3UOF A;  2V2I A;  5LBH A;  3AK9 A;  1F33 A;  3PVT B;  3V3K B;  2V2O A;  2XJM A;  4TOF A;  4RC7 A;  2Y3Q A;  2IY4 A;  1TJO A;  4MJY A;  5LG8 A;  1N1Q A;  5D8O A;  2VXX A;  1S3Q A;  3PWQ A;  5CZU A;  2Z6M A;  2V15 A;  3GE4 A;  2GYQ A;  2V8T A;  1DVB A;  3Q4O A;  5FFA A;  2BK6 A;  4RC5 B;  2CLU A;  3IS8 A;  3R2S A;  5K52 A;  5GN8 A;  2CN6 A;  3BT5 A;  5GU3 X;  4DYZ A;  1BG7 A;  2OH3 A;  4ITW A;  4CMY V;  5JKL G;  3N6O A;  3KA8 A;  2ZA8 A;  4DI0 A;  2C2F A;  1LB3 A;  2VZB A;  4Z5S A;  3A9Q A;  1LKO A;  3PWQ C;  4MUD A;  4PGI A;  1NFV A;  3EZU A;  2F7N A;  5C6F A;  4W4L B;  2V2N A;  4RC6 B;  1L8I A;  1IER A;  1R03 A;  3R2L A;  5E1U A;  2CWL A;  4YXJ A;  5LS9 A;  4KVQ A;  2V2R A;  3FRS A;  5JKM A;  1LKP A;  4KVR A;  3JZ9 A;  5HJH A;  3SID A;  4LYX A;  2Y44 A;  4LQN A;  4ZKW A;  3SHX A;  4IXK A;  1LKM A;  4ETR A;  3GGY A;  1SQ3 A;  4RC5 A;  4KXR B;  2XGW A;  3RBC A;  3Q4N A;  4MY7 A;  1RCD A;  3NP2 X;  5HQO A;  3AF9 X;  3FRR A;  3LKD A;  5IX6 A;  2Z5R A;  5D8R A;  4CMY A;  4ZMC A;  3E6S A;  3UOI A;  5LG2 A;  1NF6 A;  1ZS3 A;  4P18 A;  3F34 A;  5I4J A;  2FHA A;  4II4 A;  2MGY A;  3NOZ X;  4PG1 A;  5D8X A;  4LQJ A;  3E2C A;  2ZUR X;  5GOU A;  3KXU A;  1NF4 A;  4IWJ A;  3KA6 A;  4ZKX A;  2CN7 A;  2HTN A;  2VXI A;  4DAS A;  3HL1 A;  4TOC A;  2WTL A;  1JRE A;  5CMQ A;  4DYY A;  4EVB A;  3BKN A;  2GS4 A;  4X0J A;  3QB9 A;  2C2J A;  1TKO A;  4RC8 A;  4CVS A;  3ES3 A;  3O7S A;  2QF9 A;  3R2H A;  4DYU A;  2GYD A;  4LQV A;  3QVD A;  2CHP A;  1RYT A;  3WVV A;  2G38 B;  4M32 A;  3RE7 A;  3C1Z A;  2FZF A;  3F38 A;  5HU6 D;  1XZ1 A;  5J9V A;  1OTK A;  2IB0 A;  4ZKH A;  3OGH A;  3KDQ A;  2BJY A;  4XKU A;  4ZL6 A;  5JKM G;  1MOJ A;  1BFR A;  3E1J A;  3BVF A;  2CLB A;  2FL0 A;  3R2R A;  4EVD A;  5J93 A;  2RBD A;  3PW1 A;  5JDO B;  4CYA A;  3SE1 A;  2QQY A;  3E1O A;  4PG0 A;  3C21 A;  1S2Z A;  4CVR A;  1VEI A;  4TO9 A;  3AJQ A;  4TOG A;  3GGZ A;  3KWO A;  3ISE A;  3BVE A;  4ITT A;  4MN9 A;  5GU0 X;  1FHA A;  3HIU A;  3C23 A;  4ISM A;  2Z90 A;  1IES A;  3PVY A;  3RAV A;  4AM5 A;  3BVI A;  3H7G A;  3SH6 A;  2XKQ A;  3KHK A;  2C2U A;  2JD6 0;  2FKZ A;  2Z5Q A;  3AJO A;  3WVU A;  1S30 A;  2FG4 A;  4A25 A;  2D5K A;  3PVT A;  4XKT A;  4E6K A;  1JKU A;  3RGD A;  2HR5 A;  3EGM A;  1Z4A A;  3AJP A;  3GHQ A;  3QHC A;  2FFX J;  1NNQ A;  1DPS A;  2V2M A;  4YKH A;  1Z6O M;  3KA9 A;  3FI6 A;  4TOH A;  3VNX A;  1UVH A;  4TOE A;  3ERZ A;  3AK8 A;  1EUM A;  1JGC A;  2JD7 0;  2PYB A;  4TOB A;  1TKP A;  2ZG9 X;  3U90 A;  1H96 A;  2C41 A;  2CEI A;  5HJF A;  5J8W A;  1RCG A;  2OKC A;  1VEL A;  4DE6 A;  1XZ3 A;  4PGK A;  4YXM A;  3E6R A;  1JI4 A;  4MXP A;  2WLA A;  5J8S A;  1JI5 A;  4RC6 A;  2YJK A;  1O9I A;  3W54 A;  3UFB A;  5FEJ A;  5FFB A;  3JZA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...