2AR0A

Crystal structure of type i restriction enzyme ecoki m protein (ec 2.1.1.72) (m.ecoki)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
524
structure length
485
Chain Sequence
NDLVAKLWKLCDNLRDGGVSYQNYVNELASLLFLKMCKETGQEAEYLPEGYRWDDLKSRIGQEQLQFYRKMLVHLGEDDKKLVQAVFHNVSTTITEPKQITALVSNMDSLDWQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVKSQTNDLDDLDGDTQDFQIHRAFIGLELVPGTRRLALMNCLLHDIEGNLDHGGAIRLGNTLGSDGENLPKAHIVATNPPFGSAAGTNITRTFVHPTSNKQLCFMQHIIETLHPGGRAAVVVPDNVLFEGGKGTDIRRDLMDKCHLHTILRLPTGIFYAQGVKTNVLFFTKGTVANPNQDKNCTDDVWVYDLRTNMPSFGKRTPFTDEHLQPFERVYGEDPHGLSPRTEGEWSFNAEETEVADSEENKNTDQHLATSRWRKFSREWIRTAKSDSLDISWLKDKDPEPDVLAAEAMGELVQALSELDALMRELGASDEADLQRQLLEEAFGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type I restriction enzyme EcoKI M protein
publication title Crystal structure of Type I restriction enzyme EcoKI M protein (EC 2.1.1.72) (M.EcoKI).
rcsb
source organism Escherichia coli
molecule tags Transcription,transferase
total genus 148
structure length 485
sequence length 524
chains with identical sequence B
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
A PF12161 HsdM_N HsdM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.30 Mainly Alpha Up-down Bundle Ferritin Ferritin 2ar0A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ar0A02
3P2IA 3LL7A 4R8RA 5FQNA 4LG1A 5HILA 1MHTA 3HP7A 3PT9A 3NMUF 4YMGA 4KRGA 3A25A 4PYLA 4E31A 4OBXA 3P9NA 3E05A 1ZG3A 3KR2A 2PJDA 3HVIA 3REOA 4KVZA 5GP1A 4PYJA 4PONA 2BR4A 1NW6A 3P8ZA 5HIJA 1XVAA 2WK1A 2VP3A 3X0DA 4EMSA 5FTWA 3TKAA 3EMDA 4CTKA 3IV6A 2PV0A 1G8AA 1BC5A 2ONYA 3TRKA 4RTJA 2BH2A 1PRYA 3EVAA 3MCTA 5E9JA 2HNKA 3KQOA 1RJGA 1L9KA 2ZFUA 4CXMA 4HC4A 3UJ7A 3GRZA 3NWEA 1R74A 1WY7A 3NDJA 3C0KA 4AZTA 3BKXA 4CKEA 3HCEA 3MCZA 5DM4A 5K05A 3KU1A 1G8SA 2HMYB 3FRIA 1FBNA 4C4AA 3UFBA 3KQQA 1NE2A 3E7PA 3GRVA 4GQBA 3MHTA 5GOZA 3BGIA 3CJQA 2FCAA 5CIYA 2OB1A 5FHQA 2IIPA 3LSTA 5H02A 4YUXA 3GXOA 2PWYA 2JH8A 3HNRA 5EMMA 2CKDA 2P41A 2VS1A 2ZW9A 2PBFA 3HEMA 4AZSA 5F2NA 1VE3A 4U7PB 2P1DA 3C6MA 2CL5A 5EQJB 4PYIA 2VDUE 5DM0A 1RJEA 3SMQA 5CCXA 3A4TA 4RV9A 2YXDA 2G71A 2P3OA 5DPMA 1KPIA 3VYWA 3DUWA 3P9CA 5HOQA 3KPWA 4KIGA 3RODA 3MGGA 5G02A 2EX4A 4YUZA 2P7IA 5LQCA 3I5UA 1IXKA 2ZULA 2P40A 3EEYA 3NWBA 3LPMA 1M6EX 3CBGA 4BP1A 1XTPA 5C1IA 4WVLA 3TMAA 1R8XA 4PINA 3SM3A 2E5WA 2HR1A 4PCLA 1KIAA 5EKXA 3CC8A 4DKJA 1G60A 2O0LA 4XUCA 4IKPA 4Z2YA 1FJXA 4EKIA 5HZMA 1UIRA 1XXLA 4OX9Y 2C7PA 4QPPA 3LX6A 2KW5A 5B1SA 3OZSA 5FA8A 3FUWA 2WA2A 2XBMA 5EEGA 1HNNA 3DLIA 2JHPA 1WXXA 2ZSUA 4FGZA 1NV9A 1O9GA 1Z3CA 3M6XA 5DTMA 3THRA 1Y8CA 1ZGJA 1NBHA 2Z6QA 1IM8A 3EVZA 3R6TA 5K0NA 2Y1XA 3LKZA 2K4MA 2PXXA 3GU3A 3KQYA 4E32A 1RI2A 3AXTA 1WZNA 5FUBA 5BXYA 5LQJA 3GWZA 3G8AA 3PX3A 3GIWA 3GGDA 5EHGA 1QZZA 1U2ZA 2XYQA 3PX2A 3T7TA 2IFTA 3I53A 3ORHA 2ADMA 4C07A 2GA9A 3BT7A 2BM8A 1N2XA 1JQDA 4OA5A 1KYWA 2IDKA 4CKCA 1DCTA 2IBSA 3OZTA 5LQAA 3JWHA 5DXAA 5DTQA 4WXHA 5T67A 3V8VA 2QE6A 2XYRA 3B5IA 1L3IA 3GJYA 4OA8A 3HM2A 3TKYA 4R6XA 1N7IA 3BWCA 2A14A 3FRHA 3FPEA 4P58A 1VLMA 1SQFA 3UJDA 3AJDA 3FPHA 4GOOD 5K0CA 3OU7A 4YV0A 1EIZA 2ZBRA 3AY0A 4EVIA 3ER8A 3QOWA 4AZWA 2NYUA 5JR3A 2PT9A 2ZIFA 5HIMA 2Z6AA 3B3GA 3KQMA 3CVOA 2NXNA 5C9ZA 3SR4A 3C3YA 3KQWA 4H0NA 4PGHA 3G5TA 5CVUA 3P71T 3CJRA 3G88A 3MTIA 3NDIA 2HWKA 2OKCA 1DUSA 4UOEA 1PJZA 4RTPA 2OBFA 1NW3A 2CWWA 2GPYA 3LBFA 4HG2A 4C06A 4EQZA 5K0BA 2YXEA 2AOWA 3E23A 4K6MA 3B3FA 4QPNA 5F2OA 4GOLD 2JJQA 3BWBA 3LDGA 1L3CA 4XCXA 3DR5A 4PIPA 3UJCA 4E30A 4R05A 1RI3A 4R8SA 2DPMA 5EMJA 4CWAA 2N47A 3FPFA 1FPQA 5FQOA 4DQ0A 5KQSA 2ZWAA 3CGGA 2Q41A 1BOOA 3GDHA 3A27A 3K0BA 4GBED 1JQ3A 1JG1A 2AOVA 3LCVB 3BZBA 5E1DA 2GB4A 3TLJA 3UA4A 2QRVB 4X1OA 2O06A 3JWIA 5K0LA 3HVHA 3F4KA 1WXWA 4QVKA 4RX1A 3Q7EA 3ELYA 2PX2A 3R24A 1G6Q1 5E2BA 4BLVA 3HTXA 1G55A 4G56A 1SQGA 1SUSA 2G8NA 4HH4A 4AUKA 2P3QA 5E9WA 1TPYA 4FSXA 2OXTA 2YQZA 4KIFA 5K0EA 1KYZA 1Q0SA 3ME5A 4FR0A 2ZCJA 3KKZA 3EGIA 3SXJA 4ER0A 5GM1A 3G5LA 5BW4A 4E70A 2B78A 3G2MA 2C7QA 3QOXA 4QDKA 2PXAA 2G70A 4PGGA 3HCCA 4JXJA 3DP7A 3QV2A 5CVEA 1QAMA 4R6WA 4KDCA 1P39A 3OCJA 2ZBPA 4HGZA 2XYVA 2P8JA 1UFKA 3D2LA 3T7SA 2OYRA 1X1CA 4E2ZA 3THSA 2NXCA 2JHAA 3DTNA 4RVGA 3I58A 2AN5A 4RTNA 3IYLW 5LR6A 5GINE 2CMGA 3DULA 3HVJA 3GNLA 5EVJA 3IEIA 3UJBA 4POOA 1O54A 3L8DA 4P7KA 3OPNA 3C6KA 4HSGA 3V97A 4DA4A 3TR6A 3OU6A 3NTVA 5EGSA 2H1RA 2PLWA 1TW3A 3DXZA 4KWCA 5BP7A 5EIWA 1YZHA 2C7OA 1Q0TA 2PGXA 5HIKA 1G38A 5EMLA 3ELUA 2G1PA 5EEHA 3G2QA 5KYGA 2NXJA 1AV6A 3A26A 3TM5A 4YV2A 2P7HA 4RTOA 3ERCA 2AVDA 5EZSA 4F84A 2ZZMA 3UJ6A 4MQ4A 3JWJA 4Y30A 3KR1A 4YMHA 1QANA 3ELWA 5T6BA 2EJUA 4X61A 3MB5A 2QY6A 2G72A 5FULA 1O9HA 3UWPA 3KHKA 5MHTA 4AZVA 2PSSA 4BLWA 3ANXA 2AS0A 4F85A 1I4WA 4RTLA 1X1AA 1YUBA 4IV0A 4PCAA 3FYDA 5HEKA 1ORHA 1JQEA 4AX8A 3VSEA 3MQ2A 4L7VA 4QQNA 1P1BA 3KQVA 4RVDA 3DLCA 4HGYA 3M6UA 1AF7A 4QQKA 3AWIA 5FHRA 5GWXA 2B25A 5E9QA 5DT2A 3IHTA 3HCDA 1BHJA 4RTQA 1XDUA 3LCCA 3G2OA 1VL5A 3FUVA 2F8LA 1EJ0A 3BWYA 1JTEA 4M38A 3S68A 1SG9A 4GC5A 2V7EA 2PX4A 3HCFA 2JHCA 2YR0A 4FP9A 4GOMD 4FSDA 3UJ8A 4ATNA 5CCBA 4YUWA 2HV9A 5LQNA 2IGTA 3HCAA 2AZTA 3G89A 5KQRA 2WA1A 3LECA 1XDSA 4A6EA 4E2XA 2NXEA 5ICFA 3FTFA 2FPOA 2I6GA 2YVLA 3M70A 1DL5A 4V0RA 2GH1A 5EOVA 2IBTA 3P2KA 2EFJA 3M6VA 4F86A 5DSTA 1JR4A 2NP7A 2O57A 3HA5A 1KXZA 4RYLA 4ISCA 4CKBA 1KHHA 1SUIA 4ER5A 2FRXA 4DF3A 3BKWA 2VZ9A 1R00A 3A7DA 5ICGA 5LQUA 2V74B 2AN3A 1L1EA 1MJFA 3EPPA 1X1BA 1INLA 2OZVA 2ZIGA 3PTAA 1R8YA 2VDVE 2ZIEA 5EC8A 5C0OE 4PWYA 2C7RA 2BZGA 3EVCA 5K8VA 2B9EA 3ID6C 3E8SA 3GRRA 3C3PA 4GC9A 5GM2A 4BLUA 4LWOA 2CMHA 2O07A 3LCUA 3B89A 1YF3A 3M4XA 5EKUA 3M33A 1X1DA 2YXLA 3RW9A 4C08A 2PVCA 3EVBA 3R0QA 2H11A 1HMYA 2QRVA 4QVGA 1AQJA 3NW9A 1SVUA 5DLYA 5K01A 3R9XB 1XCLA 4PYQA 2P3LA 3KPYA 5DXJA 5HFJA 2IH4A 2EG5A 3HA7A 2AOUA 1D2CA 3KR9A 1N7JA 4GUAA 3KPJA 3EGEA 3M6WA 4LWPA 2ZVJA 3BXOA 4MWZA 4PYMA 1V39A 3DMGA 2PX8A 2AR0A 3G8BA 9MHTA 1JG3A 1YB2A 4DCMA 1EJ6A 5KVAA 1KPGA 3FUUA 4MIKA 4OBWA 3OE5A 2AN4A 1VIDA 3BWMA 2NNWB 1ZKDA 1RJFA 4RTSA 2ORED 4QTTB 3P97A 1NV8A 3TM4A 3MTEA 3KQSA 2JH9A 3KPUA 4M37A 4C04A 3OFJA 4P7FA 1ZGAA 5D1NA 2AOUB 3EVFA 5E2AA 3OU2A 1R18A 5DSXA 4RVFA 5FADA 5IH3A 1H1DA 2YUIA 7MHTA 4E33A 1IY9A 3I9FA 2QM3A 3NJRA 5FCDA 1RI4A 3VC1A 2ZBQA 3H2BA 3PLAE 3B3JA 4X41A 3TFWA 3BGVA 3OZRA 4QTUB 2UZ4A 3FTDA 4V0QA 1XJ5A 4PIMA 2NP6A 4FS8A 1VPTA 3B7PA 4LECA 2IDJA 3EMBA 5LQRA 4DZRA 4MHTA 1KPHA 3DMHA 3EGVA 5FWAA 3O4FA 5DM1A 5DRTA 3EVDA 5EIFA 1XDZA 2VDWA 5EZQA 5K0JA 1KR5A 4PYKA 2FK7A 1JSXA 4PYNA 4RSRA 3PB3A 4BY9E 1BKYA 3HVKA 3P9KA 4YUVA 1YFJA 4HTFA 2FK8A 4E2YA 1AQIA 2IH5A 2AOXA 3DXYA 3GRUA 5FA5A 2ZLBA 2P35A 5T64A 4P7JA 1T43A 5CUQA 4PNEA 3MAGA 5EHIA 5K0FA 4PYOA 2I62A 5P8WA 1I9GA 5E1BA 2PWPA 3OFKA 3SSMA 3T0IA 4DMGA 5ICCA 5KS2A 1UWVA 4RTRA 2HTEA 4RTMA 2AOTA 5CM2Z 2B3TA 5DWQA 2OB2A 3DH0A 5EG5A 4IV8A 3P2EA 1KP9A 2XVAA 4EK9A 3UJ9A 1VP3A 3KR0A 2I7CA 1NT2A 4OQEA 3UA3A 5K09A 4NECA 3VC2A 2PY6A 3LGAA 1I1NA 1YZ3A 2LD4A 4HTFB 3KQPA 5EPEA 1EG2A 1X19A 4CTJA 3DXXA 1EAMA 5E8RA 3O31A 3KQTA 3EEOA 4ER6A 5E1OA 3UZUA 2R6ZA 3PFGA 5EMKA 3CKKA 4MTLA 4E2WA 3FTEA 1FP2A 1D2HA 3LDUA 3OE4A 5F2KA 4BP3A 2I9KA 1RJDA 2AOTB 3BGDA 4Y2HA 5M5BA 3LHDA 4FT2A 5ERGB 2PX5A 4O29A 3WSTA 1EQAA 5DX0A 5HIIA 3ER9A 3LBYA 4FZVA 2FYTA 1L3BA 5K0GA 1ORIA 1TW2A 2GLUA 3NVMB 1ZHFA 4KDRA 3HCBA 2BR3A 3O7WA 3SX0A 3CCFA 4IWNA 4C05A 1P91A 2DULA 3FPJA 3P9IA 2Y1WA 3I64A 4YV1A 2IH2A 3FZGA 4KW7A 2ZWVA 3DMFA 1RI1A 1P1CA 2UYOA 1SKMA 3T7RA 4YUYA 2ZZNA 3CJTA 3LKDA 1B42A 4QDJA 2IP2A 4XUEA 5E8JA 3GRYA 3SSOA 1JG2A 2UYCA 3FTCA 3FUTA 2ZTHA 2OY0A 4P7GA 4GOND 3FYCA 4ZTBA 1FP1D 4RTKA 5CVVA 3PS9A 3U81A 5DRYA 5DX8A 5DTRA 4GF5A 3DOUA 1R6AA 5U4XA 4RVHA 4U7TB 5JUWA 2H00A 2PT6A 2ESRA 3NVKI 4ER3A 3TPZA 5BW5A 5LSAA 2IPXA 3GO4A 1WS6A 2BR5A 1QAQA 4OQDA 5E1MA 8MHTA 3UBTA 4B17A 1WG8A 2AVNA 3BUSA 5D1HA 3SVZA 1QAOA 1JSZA 5IKMA 4M36A 2JG3A 3K6RA 2BM9A 2QYOA 2YTZA 4ER7A 5FWDA 1VBFA 1NW8A 2Z6UA 5CVDA 4X63A 2PKWA 3PFHA 1D2GA 2UYQA 2ZZKA 5GIOE 2ONZA 1NW5A 3LDFA 4FT4A 5CVJA 2O05A 3PVCA 3UJAA 3JWGA 2GS9A 4X60A 3SSNA 3Q87B 2ERCA 5ICEA 4EKGA 5GIPE 3FPGA 4M7RA 2R3SA 4DM3A 1YFLA 3SGLA 2YX1A 4DCGA 1F3LA 3G2PA 3GCZA 1M6YA 1QYRA 2GAFA 3AXSA 5DX1A 3R3HA 4XUDA 1NKVA 10MHA 5CD1A 1JTFA 2FHPA 1RI5A 3TOSA 1F38A 5DM2A 2UYHA 3EVGA 3EVEA 3A7EA 3HA3A 1ZQ9A 3FUXA 2EJTA 3G7UA 4A6DA 5K03A 1VQ1A 3RIEA 4C03A 4GEKA 3ELDA 2PXCA 5LQKA 1M0EA 1OR8A 1VP9A 3MERA 2OPBA 2OO3A 3KPVA 4RWZA 1JG4A 2XVMA 1NW7A 1XCJA 1NBIA 3TQSA 2B2CA 4HRAA
chains in the Genus database with same CATH superfamily
3R0JA 4Q1EA 4ARZB 1REQA 3E7WA 3ENZA 5FQNA 2CVFA 1G5FA 4RPCA 5JBNA 3FFWA 2A1UB 1F30A 2XWBF 2CIHA 1C9JA 2C2WA 3AM5A 4O59O 3RVJA 2JCGA 1C50A 5PGMA 2G88A 1KVRA 4HRYA 4CYMA 2YQ4A 2FR1A 5ELLA 2NU8A 3VR6A 1YAJA 1IOVA 2IL1A 1JPUA 2UXBB 4XD7A 3UMFA 3TK1A 5FFFA 2GETA 2GAJA 1KEWA 3P9RA 1G8AA 1G20A 3ESYA 4GLFA 5LDDC 1UH5A 1E6LA 3IP8A 2X2PA 2X76A 3CXUA 3K0CA 4TS1A 4Z7QB 2HLPA 2TECE 2CT8A 4CQLB 4NAHA 4HC4A 1UKVY 3ROQA 3BREA 1I4DD 4EHJA 4HDNB 4ZL5A 2H92A 1KO8A 2ZJ2A 4BTVA 2I5PO 1QXSA 2G67A 4F6RB 4EYOA 2UYYA 2FPPB 2WTXA 2FRDC 3D64A 4M9XA 1W1WA 2Y9MB 4AZ0B 1FP6A 2NTVA 2ZYIA 1WVIA 2YFQA 2Y68A 2C77A 3DLPX 4H6XA 4NJOA 5H02A 3CLHA 4OMCA 3OIDA 4OV6B 4D3DA 4EELA 5LMCA 1NN3A 2ZW9A 1VE3A 3MT9A 3RSCA 1J99A 2ZIUB 3RRFA 1KI9A 2FEOA 2VRWA 2ZBGA 3F5MA 1P8JA 2BAGA 3KZ1E 3BD6A 4WNAA 2J5QA 1ZUD1 3P9CA 2VDMB 5JMPA 4RZUA 4U00A 1TYBE 2RBGA 3LPAA 3KEFA 1S2LA 5JH7B 2UZIR 5KVSA 1RPAA 1W19A 1KEZA 3AM3A 3I5UA 5LYJB 5IEJA 2H7YA 2JH3A 5IZCA 1KDTA 1X0XA 4KFSA 4DR5B 1PS0A 4L4SA 4WEQA 1A2OA 3QU2A 5A5GA 4EF5A 5F35A 3IUYA 1GUAA 1MIOB 3R7LA 5B5SA 2B61A 4YT5A 2HR1A 1QGOA 3DC2A 2VPQA 1C0IA 1NSTA 2NVOA 3ZBTA 1NQOA 2YHIA 4HLCA 2GK7A 4EKIA 2F4VB 2NZXA 5HJFA 5KREA 4MYUA 5H80A 1WBBA 3CH4B 1JFFA 4KI7A 1QFZA 2BFBB 3K1ZA 1Q7TA 4GI5A 5JHGB 4BTLA 3FR7A 4EJ2A 4K40A 3U3RA 3IR6A 4B4KA 2RGBA 2YY7A 3ITDA 1OX5A 3AEKA 1WXXA 5TNXA 4BPRA 4BV3A 4KREA 1K7FB 1FMJA 1K8RA 1T91A 4ZPJA 4DV4B 1XKTA 2OBLA 2QG4A 1TD9A 3K31A 5C3UA 5A4IS 3GLUA 4WLEA 3BEOA 3ASYA 4QUDA 4XLLA 5FBKA 3RJMA 2ZDHA 1JWLA 4QFDA 1DX6A 4PZYA 5GZ6A 4F4CA 3NHPA 4MLZA 3DMDA 4IICA 3H7AA 3HRKA 5AJTA 5HG0A 1NVKA 1Y6FA 3PQDA 2C31A 3K94A 3VR5A 3B7GA 3HB0A 1Z5NA 1VG1A 3P45A 4RVUA 3IDSA 1V8DA 2ZKIA 4H6VA 3ORHA 1C8KA 4U4AA 1JVBA 1N2XA 4INPA 2LIVA 2V4MA 4B7CA 3MEQA 3D19A 1CS0A 2IDKA 1KNQA 3R3VA 2YJZA 3F3YA 2NW6A 2FW9A 3T5MA 1V8OA 4AJ1A 4B43A 3R3JA 5JRDS 1L8XA 2QE6A 1KXJA 3PNPA 1EIWA 1IE3A 1H5QA 4EIWA 3U60B 3BMNA 4NG4A 4XDGA 4ZMRA 2ZRQA 1BRTA 1MX1A 3CW2A 3C8ZA 2NV6A 2QR3A 3FPEA 5DYTA 2VJMA 3G7NA 1SQFA 4C0HA 4JOSA 2FWPA 3FE2A 3QVGA 5EA2A 3C48A 4D8TA 4ZU6X 4DRXB 3MWDB 5U9CA 3AGQA 4C76A 3ZHZA 2Q6TA 3GLQA 4JBWA 3P96A 5JSYA 2C3UA 3HIUA 3MUNA 4BBZA 1COWD 4PBSA 3DL2A 3LOPA 1CEYA 3BIXA 3SYKA 1WEKA 2A33A 4LBWA 1IVNA 4PE5B 3HZOA 1M1YA 3P71T 2HREA 1HFKA 2V2IA 3EA4A 1F51E 2ZOSA 3Q9LA 1ZYUA 4MVJI 1QHEA 4M1SA 4FFBA 4QPZA 2PL3A 4JEUA 2QUAA 3IOCA 3M4NA 2G63A 2ZJOA 5L7YA 1JKMA 4CLRA 2ZPUA 5E95A 3BK1A 3B3FA 2XHEA 2FUG6 2Q7OE 3CLRC 1U98A 2EC5A 3BE8A 3L0YA 5K8IA 3EISA 3UJCA 4A25A 5KWEA 3PNSA 3FCAA 3VOBA 1BX0A 2C59A 3SDZA 3BXFA 5T4FA 1DKPA 4J4BA 1RRMA 4P7BA 3QKRA 1UK9A 2AOVA 2F43B 4DMUB 3V4ZA 5SZHB 2OD9A 1ORTA 2WU1A 4C4YA 1TE2A 5K0LA 4IQGA 3VZRA 1YZYA 1SUPA 1B3RA 1E3TA 2EKQA 1WXWA 4I8DA 2QVLA 2DAPA 3R2JA 3QUSA 5DIFA 5FBRB 3LFHA 4BLVA 3HM9A 2G38B 4XKUA 3CINA 2PD4A 3DD1A 1PYGA 5E6RA 3Q8KA 4PPFA 1UT6A 2BY4A 4NENB 5E9WA 5JWHA 3E1JA 1P2GA 3NONA 1A8HA 4IINA 3ZD9A 4AF7A 3PXCX 4OD0A 1XU9A 3N2IA 5I9SA 4HXGA 1X0VA 3G1UA 5M7EA 4YIKA 1S3SA 2WHEA 3GELA 3GPIA 4G1FA 1JHMA 3N70A 3LPLA 3W0LB 1H05A 2J45A 2BBTA 4V0SA 1IMJA 1EFKA 1OC4A 3DP7A 3PPYA 5M29A 4KIUA 2VO1A 2XT9A 2RHCA 3EZGA 3D2LA 4KLCA 2HF8A 1AY0A 1A97A 1S3IA 2D54A 4M76B 1YONA 4ZO6A 3H05A 3BQNB 2E5LB 5KX5F 1KK1A 1HQCA 1PS9A 3M0EA 3QE4A 4G5XA 3CLKA 3R2MA 1JBEA 1Y7HA 1ZI6A 2AN5A 4YJGA 1ZZGA 5J9FA 1U7DA 3RV3A 3VDMA 4F9FA 1SBZA 4ZKDA 3OPVA 5LR6A 2GYYA 5L3ZA 1HFJA 1KZ4A 4ZV9A 1EWKA 1YS9A 3FOZA 1T3HA 3NTLA 3ZGNA 1PK8A 3JQ9A 1A9SA 4IDPA 2YMLA 2YN0A 1ZISA 3BTUA 3K30A 3DBHA 5AR1A 4PBTA 4BX3A 1JH8A 4KVRA 4FE3A 4LC0A 3U3JA 1J97A 3RS3A 5I7EA 4MW0A 1FUUA 1N5KA 1O95C 4ON9A 1JHXA 1IOZA 2VHXA 3AEQB 1X7DA 3G8YA 4GOJA 2MYPA 2AR7A 4Y30A 5HMLA 3DA8A 2D1SA 1LGYA 3BA1A 3LA6A 2JZCA 2OUIA 4N7MA 5T6BA 5FUMA 2V97A 2G72A 2PU7A 2R66A 3C24A 1GSIA 2GEBA 1BFKA 3SR3A 2W2LD 1O3YA 4NAUA 3V3KA 4BB6A 4RTLA 3PUJA 3OP1A 1TYAE 5E3JA 3GEGA 4TZTA 5F77A 2ZPTX 4EPTA 2EERA 2X1MA 2IP4A 3G0BA 1N6RA 2BBSA 5GWXA 3V1NA 2XY4A 2ODAA 2ACWA 3ENKA 4A8JB 3WIDA 5E9QA 5AVXA 4GGPA 5ERXA 1H0KA 2J3EA 3F49S 2OHXA 3UMBA 3EDYA 3QHCA 1JQ5A 4P86A 2IGBA 1B0UA 5JXGA 1K7EB 3BT5A 1JTEA 3EQ6A 4HH0A 1SG9A 4I9GA 4BMSA 4KTTE 1N0IA 2JHCA 1ECFA 2V2NA 2M98A 1U2DA 4FOOA 1HDXA 3RUAA 3SZUA 4ATNA 2V0GA 2HV9A 2GYQA 1K2VN 4GR4A 1S2OA 3WYNA 4YRCA 2ZUVA 2VQSA 4S1OA 3TLKA 3VH1A 4TLEA 1QVWA 1UMCB 3EIFA 4V0RA 3ZDCA 2GH1A 1V48A 3M6VA 3ABZA 3R44A 4JBXA 1QV6A 4HT3B 2DGDA 5TC4A 3RD5A 4ZK6A 3N0TA 3W05A 2B21A 4RWEA 3R9XA 4I9UA 3K0FB 4G4SO 4P4NA 4LF8B 2J0QA 2XJ4A 4X65B 1T8YA 1RZUA 4WH0A 4KPYA 2OZVA 3ZHSA 1IYZA 1D0SA 2QRGA 4IIYA 2PYBA 4LYDA 1GQFA 2ZBVA 4IVQA 3AKEA 2QBYA 1FJGB 1TZJA 2IXEA 3TQOA 4YRSA 1Z6AA 4GC9A 2IVFA 4HAIA 2CNWD 1RCTE 5BQPA 1B8UA 4RIFA 1E1LA 1E1RA 1C4KA 1X1DA 4RW0A 4KLZA 2VJDA 1U81A 2H11A 2X9NA 3EVBA 3IESA 4H16A 4QVGA 3LT1A 5CFMA 4PC7A 5FA6A 4AWBA 2IYWA 4BYGA 2WJVA 3OKCA 3BJZA 4Z9FA 1OI2A 1J6UA 4I4TA 5KYKA 1FU4A 2CLSA 2UUPA 2AKYA 5AI8A 3SBDA 3H7GA 1FMTA 3T3OA 2ATXA 2NNLD 2ORYA 4MYDA 2WE7A 1Q95A 3EOAI 4Y1GA 1ZOIA 4EG1A 3QD8A 3QI7A 4X20B 1E64A 2WJZB 1A7UA 3SE0A 1X8XA 4AD8A 4JNCA 4WZAA 4DG5A 1G4UR 2Q3HA 2YVQA 4QU5A 4X91A 3G9UA 9MHTA 5FOTA 3VOTA 4ID3A 4LJAA 5AW6A 2X8AA 3SBOA 3TTTA 5IHXA 4CKYA 2FB9A 1DB3A 4QHTA 3RK0A 1IRXA 2ABWA 5ALPA 1GFSA 4YRMA 3EUEA 1YS6A 1Z2CA 2OCGA 3HKEA 2JH9A 3MTEA 4FOTA 3RU2A 1J2UA 1C1DA 1YI1A 3KYBA 4OXIA 5D1NA 3HKBA 4DHWA 3WZ2A 1V7CA 2OHVA 1UOPA 2VEOA 5ALFA 1N77A 3GI1A 4ND4A 5IH3A 2ODQA 4TN5A 2PH3A 1H42A 2WU0A 3HYLA 3WC4A 4BZXA 3EHEA 4RHCA 1X15A 5KEIA 4KV7A 1CZUA 4EFLA 1T34A 3UATA 2DERA 1MOJA 2P68A 2MMGA 4TT3D 4D0NA 4Q6BA 2QRHA 1X1SA 4ND6A 2OGWA 421PA 1TL7C 5LQRA 3M34A 4QBKA 4TTSA 2H52A 2ECPA 4GE3A 4G24A 1OTYA 5J2UF 5CRIA 3QE3A 2FK7A 3SOZA 5BVGA 6NULA 3I2HA 1E79D 2YNMA 4XDZA 5C1DA 1BKYA 1SZJG 3J7TA 4GSYA 4BY9E 1QHIA 3AU8A 1SXJA 1F0KA 2Q2VA 3ZCVA 1VFNA 4E2YA 4FYHA 4DYDA 1GV1A 2P35A 3SXUA 3HA2A 3UQYS 3I05A 4M1ZA 3MAGA 4YRJA 3KKNA 2GN4A 4YJKA 4EHBA 4TQAA 3KOOA 4GLBA 5EHNA 3OIWA 1Z08A 4HR7A 4U9UA 2X3FA 4OHOA 1UWVA 2NPIA 4HEJA 2H57A 2AD1A 1GTL1 5KS2A 3GFSA 2JA1A 4G65A 4N5NA 1XELA 5K3FB 3QTLA 1OZGA 4IFTA 4P93A 1TECE 4NECA 3HYTA 5GJCA 3FWZA 1ZW6A 3JD4A 4AW9A 3KQPA 3AG6A 5DO9A 1PG5A 3FI9A 1R4MB 5DGIA 3EULA 5EPEA 5FTNA 5ADUS 4Z4FA 1OB2A 1RAFA 4YKHA 5J5AA 2H4YA 3HFGA 5HZHA 1U6JA 3F47A 1V16A 2Q3EA 1P3DA 1PR4A 3L4BA 5CG2A 1OIWA 3KTAA 1S3GA 1X3LA 5F2KA 4LPKA 2PZFA 1PL6A 4OXRA 5IWCA 3HADA 1RJ9B 3RKRA 5BSHA 2YC4C 1GD1O 3JCZA 5H7XA 3EQ9A 4JBIA 2M2IA 4R31A 4AC9A 4CM6A 5IYZB 1R6BX 5AOCA 1RJWA 2Z6QA 4WKOA 3AK4A 2CE2X 4R9NA 1U5BA 2O2DA 1L7XA 2E1PA 3BMCB 2QJFA 3VTAA 3RFFA 4R68A 3QELA 2EWMA 2JIDA 3GUZA 1Q2UA 5BNWA 4YJHA 5K4HA 5EPOA 4BASA 2WYIA 2XIJA 1JLKA 1GN9A 3NAQA 2D2IA 4JJEA 3MAJA 1BS1A 2HN9A 3DZJA 3N6RA 1M8GA 6AT1A 2O50A 5LU9A 4HZUA 4NCXA 5I7HA 1TAGA 4D82A 4B6GA 2DLDA 3HDHA 1FP1D 3SIDA 2AMFA 2ODTX 4MR7A 5C7LO 1LDEA 1JS1X 1R6AA 3TIVA 4C01A 1PSDA 3A1FA 2JAXA 1EBUA 3ZWMA 1P0FA 4LKRA 1WX1A 3A58B 1QC5B 4M0CA 1UQRA 2VYVD 4ZYWA 3JSAA 5CNKA 2Q1TA 5EJ5A 3I39X 4G0OA 3RV4A 4Z0TA 3AMVA 3SVZA 1QG4A 1TAUA 3T7AA 2WT9A 1ISMA 1MAAA 4O2BA 3TZQA 3OKPA 2ZJ8A 1VLLA 1Z6YA 4XOIA 4QOGA 1YQQA 4JYCA 1DBIA 4DM4A 3NHYA 5CPFA 1PLJA 4QO8A 4F3TA 1CTQA 1LD3A 4DFDA 5KTKA 4URVR 3PA6A 4CLOA 1L6IA 4Y6LA 2F1KA 1Y1TA 3BRQA 1FNCA 5F3WB 3CY6A 3QVUA 2LGJA 3B1ZA 2FWIA 4DBZA 3I23A 4BB5A 4DCGA 2VHZA 1YE3A 3IAFA 3BGSA 4AECA 2BW1A 3PPIA 5AKLA 2WICA 3UAVA 5JDIA 2HL6A 4O4IA 3RRJA 1PX0A 2JBWA 2AMYA 1Q1BA 1SKUA 1T1GA 5DM2A 2HUPA 1AQUA 4S1TA 1PG0A 3M5DA 4DLRA 2Z3VA 4NAVA 3DUFB 1CE8A 2ECOA 1EP3B 1VQ1A 1KJIA 2WTMA 2YHSA 4MV7A 2H1LA 2PXCA 4YPFA 1N1MA 3Q6MA 4DE5A 4I3HA 3UT5B 3MJFA 2C9MA 1W8DA 3OJEA 3PXUA 3EODA 3G2OA 3F35A 2TYSB 4TRJA 3WGUA 4O0MA 1JLLB 1XTIA 1KJJA 5JJCA 1E2PA 4RGVA 4ZK2A 1ZCAA 4R8RA 2J0UA 2RGEA 4B0PA 1T9DA 2R62A 2O8FB 3PT9A 1GUZA 3MMPA 1D8TA 2GUGA 3UKJA 3C5VA 5FPPA 3ZXXA 4B48A 4MKHA 3GVHA 1XVVA 2WABA 2JD60 4OSPA 4ZVVA 1M2NA 4PYJA 3C6BA 3HBNA 2ILVA 2ZRIA 2HU5A 2WK1A 2XD9A 3B38A 2FMTA 2PMKA 3KDPA 1CIVA 3ST7A 1XF9A 5F2EA 1KK2A 1GRCA 4RC8A 2A7XA 1FUIA 2JIZD 3TIXB 1UBTS 1C1XA 2PV0A 3CLUC 2NU7B 4CMEA 2FPKA 3SQOA 3G0HA 4B8WA 4BFTA 4DMKA 1GXSA 1HK7A 2GEKA 3UJ7A 3P2JA 3LL4A 1CY1A 3L7AA 3Q98A 4FMPA 4FYXA 4KWHA 5A5FA 3T5AA 1YFZA 3BKXA 4YT4A 1VJXA 1DWQA 1W4LA 4R9VA 2QGFA 3MCZA 4JLKA 3RGDA 1Q15A 2EJBA 1NE2A 1V1RA 2ZEJA 3ABQB 3GRVA 5D01A 3KDQA 4P4SB 3FRSA 3QBEA 1O08A 1W85A 2IOHA 2OSBA 4TSFA 3V8MA 3W6OA 5C8XA 5KYWB 2AG1A 2XB4A 3U61B 4WUVA 3F1LA 5EMMA 4ECEA 4AJOA 1QTNA 1QB8A 1U8EA 4MR9A 1HDGO 3DE1X 3UOGA 2I67A 4LPSA 1A5AB 3V48A 2UXCB 4AY5A 1E98A 1L2TA 3LY9A 3A4TA 1CZKA 2Q4TA 3ESCA 4MHSA 1EGMB 4P5DA 1VGVA 4OHRA 1Z63A 3RC9A 1XMPA 3VYWA 2WFLB 4D57A 3IKLA 4Q9HA 5G4KB 4JBLA 3BSFA 4MV6A 2P79A 1IXKA 3C1AA 3NC1C 5LQCA 5CLJA 4RA6B 3ICEA 4UKDA 3N8DA 1YUMA 4Q00A 4M22A 4BB9A 2VDLB 3TMAA 4KSYA 4PINA 3EEQA 3ZGZA 2NACA 3K8ZA 3DOFA 3T95A 3WO1A 4AG3A 3RVRA 1W1IA 4MW1A 5EJ8A 5EWLA 2WKRA 3S81A 3UMYA 1FFCA 4HDMA 3AHFA 3BHNA 3HUDA 3CWQA 3T7IA 5F7OA 1XXLA 4MJXA 4AMBA 3V7WA 3O4GA 2Z1DA 1A5BB 3DCJA 5BSUA 3GLGA 4MS3A 221PA 5JC1A 4KN5A 5LL6P 1R6XA 4EB6B 4Y0AA 1TVMA 3S29A 1ATIA 1NI5A 1KH3A 4S0XA 5JPCA 3E22B 1OXTA 1A72A 4O4LB 1XZDA 1BMTA 1SQ6A 3QPBA 1RWVA 3RR2A 4P0QB 4MEAA 1Q0QA 2JFVA 1EX7A 1VYTA 2OV3A 4AXXA 1SHJA 3WK8A 5FX2A 1E7MA 4FYKA 3AXTA 3NDBB 4OGGA 4TUYA 3NJ4A 4KFTA 4CEJA 2FLWA 1KY2A 4DDVA 2OPHA 3PJRA 1QZZA 3DDOA 4IJQA 3WWPA 1VL2A 1X1QA 3DP9A 2PG3A 2GA9A 3QE2A 3WDMA 4C07A 5FOUA 3NOZX 1E6KA 3JYQA 4ZARA 1QCYA 5T67A 3RVSA 3IQ1A 3K8OE 1Y4ZA 5EUQB 2IXAA 1DAFA 5T3YA 5LZ8A 3TKYA 4ZJKA 1Q3TA 3NYQA 3RBVA 5C46F 3SD7A 3F6BX 5DKFA 2PMWB 2WR8A 3TNDA 1YR1A 3OAAA 3FM9A 1SA0A 3PD1A 4M8SA 3WSVA 4CDNA 1F20A 2ZT6A 1SCKA 3OIGA 3NB0A 3PD7A 3A06A 4QG3A 3NDRA 2HYIC 3DPSA 2WVGA 4ALMA 1EQ2A 4NJMA 3V2GA 1AUOA 5J58A 3DLBA 4MRVA 3AUFA 1T0UA 3H1BA 3AF9X 2QLLA 2J46A 4F4DA 3KQMA 1G6OA 2LRHA 5AW0A 3ETHA 1FSZA 4ZKWA 1XD2A 2HRCA 2Q99A 3O38A 5FB3A 5F1OA 2I22A 4C2TA 4RC5A 3BE4A 4RMHA 1MTZA 5IVHA 4RA9A 4RTPA 3G5UA 2AI3A 3RAEC 2AI1A 3IS3A 2GPTA 1MPXA 2XMQA 2IZ5A 1OJLA 4R1UA 2DQZA 2IXFA 2JKYA 4MQEA 4WLVA 5H9VA 5MFPA 2JJQA 3IOYA 4FE7A 1GPAA 5CM8B 3IDAA 5FFMA 2PPLA 3IDQA 3JQDA 5IC4A 1BCSB 2H1FA 4HZGA 4RXUA 4Y6RA 2I2BA 2QPOA 3N7AA 3T06B 3U0BA 1JDJA 1SRQA 3ETDA 3GG9A 4URZR 1JG1A 4B73A 1L7BA 2OFXA 2B8NA 3KU4A 3T5BA 3IT0A 4BLTA 3D7NA 2VH5R 3U6KA 4FGKA 1GSHA 3LX4A 1MQ8B 4EG5A 3G2LA 1NY5A 4RS3A 1L7AA 1SQ3A 1HPLA 3WZMA 4KN6A 4DS3A 4OLHA 4YIHA 3EGXB 2E4UA 1D9XA 3ILYA 3P5BA 3JZAB 2GZMA 1G8HA 1XJQA 2Q28A 2QOEA 3WL8A 5L3SA 1JJ7A 3L0BA 5AVOA 2BTQA 4Y6QA 3SXJA 1RKUA 4LS3A 3RYCA 5LG8A 5AJUA 2C9ZA 3RAPR 4FKZA 5B1DA 5KCMA 4C2BA 4RH1A 4AUEA 4CL2A 2HHHB 1RXYA 3MD9A 1SU8A 3KC2A 4MLDA 4QNMA 2C92A 3JXEA 4ZVUA 3SDBA 3BSSA 1LSJA 1TTHA 5D3ZA 2C5GA 3SKYA 3OPQA 3VYRB 4DN6A 1RW4A 2ZBPA 5KPDA 1OWNA 5CK5A 1N6LA 4YQFA 1YTUA 3LF1A 3UH1A 3BCRA 1ISFA 1FJ2A 1M72A 4BNDA 3H11B 3L4EA 1SUCA 3O92A 3JQQA 4I4CA 4S1NA 1USGA 3DTNA 5EJGA 3ZDDA 2VN8A 2BTEA 3I58A 1MUUA 4AY6A 3HSSA 2A5GA 1P5RA 4J7CA 1KZ9A 4JSYA 1TLLA 1ZOOA 2W0SA 1RXVA 1JG7A 4NXNB 3AVQA 3LVFO 1J2YA 4EMUA 3ICQB 1SHZA 4IDEA 1Q7RA 3T4UA 3L7DA 4U2BA 3NTVA 2JEYA 3SZGA 5BUZA 3O1HB 3JZ9A 2DKNA 3DDHA 3QPUA 4G4JA 3LYHA 4QD3A 1Q0TA 1NOJA 3VPGA 4EEXA 4MW6A 4KRXA 3VAYA 1RZVA 2XWJI 1V8FA 1P5ZB 3CSDA 2CC2A 2HJVA 5DHAA 4BVBA 1MIHA 1T2DA 4FUTA 5CX1B 1RRCA 3UJ6A 4PWZA 3LZCA 3SF8B 1G21A 1NQTA 3F37A 4AM8A 3MB5A 1TD1A 3ZEAA 1PGNA 2KBEA 3G85A 4Z5SA 3ANYB 3ESDA 3FYDA 4UBMA 2BL4A 1FBTA 4TSKA 3FLEA 3ZN2A 4CIDA 1DBRA 3DLCA 4CCWA 1Q83A 2C7VA 5BWOA 1LJLA 3AOEC 4ZOQI 5AQEA 3UWOA 1BW9A 1DO8A 4Q7MB 4L51A 4ROTA 4EJSB 3FUVA 4BVLA 2QNBA 3CB2A 3L93A 3KS9A 4L4XA 2YV5A 3OTHA 4PHTA 4PTYA 4GC5A 3PQ2A 2IYZA 4FP9A 1LBEA 4DSZA 1SCQA 4DREA 1GGNA 1R0YA 3CR7A 1EK0A 1WIWA 3LLSA 2C4VA 3SZOA 1QIHA 1UAYA 1PTJC 3DL4A 5DI3A 2YWXA 3W3AD 2CW5A 1KYQA 5ICFA 1FQKA 1OAOA 2Z58A 3IKMB 3P2KA 4FD2A 2BUAA 1PE0A 3F67A 1S6YA 2BYTA 1RRKA 3N74A 3KLNA 2UUOA 1Y1LA 3IFSA 2P62A 4FXOA 1KZ1A 1H66A 4Q3AA 4X1IB 3RT7A 3L8GA 3PV0A 3PC2A 5FWYA 2PUDA 1OPXA 4JV5B 4JC0A 1C5KA 4M55A 3SIPA 1D0IA 1HRKA 2FU5C 4PR3A 1CYEA 1G7RA 1WHTA 4O1MA 3PITA 4ZEVA 1VSQA 4NABA 2JD70 4F2HA 4ZVMA 2ZE5A 1VLQA 4RIIA 4YQEA 5BOVA 2H16A 2GNAA 3CZCA 2B6NA 1W76A 2GPNA 4MKXA 1L5LA 2CMHA 2XZLA 1EK2A 3BVFA 2GKOA 3MNFA 1VGQA 4CQMB 1CT9A 1B16A 2W70A 1YFKA 3VR4A 3GWGA 2BMVA 1D4OA 2O2ZA 3RS2A 5BWBA 3PNYA 5D00A 3IPRA 5HKOA 3EEFA 3PIRA 4IH4A 1UCFA 4MYRA 1NL3A 2P3LA 4JOBA 3Q4OA 4RPKA 2NTJA 1ZVVA 5BVHA 3ES3A 3JVVA 1YK0A 3F9RA 4RORA 2RK6A 3VPHA 4TYPA 4GMGA 1FP4A 2VAVA 5EI5A 5FBHA 3GBPA 1X9GA 1BKDR 3L0OA 4ZKHA 3O3CA 5MN6A 2CL0X 1YUNA 2ACEA 3IOMA 3A6DA 4FHGA 4ZZ0A 3OEHA 3V7FA 3ASUA 3Q3IA 3A9VA 5BSEA 3JVEA 4N76A 3K4PA 3SEQA 3DEIA 4R8LA 5KYUB 3OBIA 2G07A 3NHLA 1BMDA 2Q21A 2V3WA 3AYZB 4H3HB 4JJIA 4MYCA 1LZKA 1N8KA 2ZJAA 4OFZA 3V9PA 4BO0A 3DWFA 1NV8A 1MHPA 2G08A 2ID8A 1PL8A 3FHCB 4Y2UA 4C04A 2RGYA 2XWPA 2GDJA 2AHOA 5M34A 4ZI7B 5GVRA 1NBME 1R9JA 1SEPA 4LW8A 5JZBA 3EFOA 4X6UA 4BQQA 5LYJF 5A6SB 3SQMA 1CQXA 2ZE7A 3L5OA 3TR0A 4LF6B 3CE6A 1L7MA 2BFFA 1XIVA 3H2BA 2E4ZA 4BVAA 1JDTA 4CUKA 3EA5A 4BB0A 2UZ4A 4J91A 2OV4A 3B36A 4GVXA 1VM6A 1CFZA 2A59A 1OC2A 3LX5A 4ND1A 4NZMA 4QEZA 5IP5A 3K32A 4UFPA 1RAEA 2Q50A 2PJRA 1OD6A 2W90A 2IZ1A 3O4FA 4UCWA 5AI0A 2WJJA 3OZDA 5LUBA 1VXRA 1E99A 1RM4A 1NQAO 2REBA 3MRSA 3KJHA 2IZOA 1CDDA 4M1KA 4RSRA 5JEDA 4MDEA 3HUTA 2O2JA 4BBAA 2I33A 4NH0A 4TOIA 2OGSA 2ZR0A 1YR8A 3LTEA 1K66A 1L4MA 1TK6A 3CLSC 5HW0A 3LHIA 3PE4A 2EP8A 4P7JA 4EUEA 1QIEA 2I2FA 2PWAA 3EASA 4P4UA 4TTIA 3RC3A 3R6GA 3ND7A 1O2DA 3L7LA 4DMGA 5BYKA 3ZWOA 2HPAA 2BFDA 1MT3A 2PQ0A 1KEVA 4MVYA 4Y9SA 5JG7A 4UATA 1AHHA 3I9MA 1J49A 4H1TA 5JSHA 1GHTA 2GHTA 2Q2NA 4UHKA 4YDSA 5A6VA 5LJLA 2I7CA 1G59A 1BDHA 2HW8A 1ZMBA 2VXCA 5KMGA 4C4SA 1RCCA 3ICWA 4LPNA 2GBPA 3IODA 3Q7RA 1DOAA 1HT0A 1WU8A 3DFFA 5LJIA 4F8YA 2P2CA 4HVLA 3I28A 3ROTA 5IM5A 3WKDA 4NS1A 4EPWA 1QJCA 1T5OA 2C1XA 2BIFA 2I2XB 3GIDA 4P2GA 3QMPA 1O5IA 1FEZA 3GYBA 3Q7PA 1D1TA 3USES 3RTDA 1K7YA 1HDYA 5TGTA 3TYXA 1F12A 5E3HA 3LDUA 4BP3A 1PV2A 3STVA 5IXJA 3EE6A 2F2TA 4JVMA 2A9RA 4L22A 4CV2A 3RSGA 3V4SA 4Q34A 3ER9A 2KLBA 4FZVA 5B2ZA 3AIMA 2PZMA 1TAHA 4N82A 1LPNA 3ZD7A 1STOA 1ZMXA 3JVUA 3PC3A 4AS2A 1ILEA 2C0CA 4L8GA 2I6FA 3LO5A 3MUEA 2IH2A 4II4B 2X1VA 3CTPA 3FUCA 4GGMX 3KKLA 5LMUB 3ODPA 3KA9A 1GNPA 1MJGA 3CUSA 4D99A 3KJEA 1N9GB 2YASA 2YJTD 3NBKA 5AO9A 2H1HA 2BLNA 1VBMA 4FQ8A 1YJAA 4HAWA 1XLUA 1WPQA 1Z8HA 3HV2A 2OQRA 1GGVA 1RHKA 2VP9A 2VPIA 4DIFA 1LCIA 1PLKA 2WHQA 1RPZA 4RDXA 1JIQA 2D0IA 4JY7A 3GJQA 1IHDA 4DR7B 4PX3A 1RD4A 3OJ0A 1B6GA 3I4LA 1XGKA 2ZBDA 3WYBA 4ER3A 4EGSA 2JAQA 4B17A 2PJUA 2XDYA 4QYIB 2MSLA 2JDID 2YJ6A 4RJKA 5AM0A 3JARA 5BORA 2GO1A 3WX0A 3NXSA 3TDKA 4TYWA 3IVRA 1AUPA 1GL6A 3M9XA 5CBKA 1NNEA 2VSOA 2CV1A 3A4IA 4L3OA 1HKHA 4NJEB 4QM7A 1DJPA 3DE7X 1XJWA 1ADJA 1SCDA 1V71A 2V7QD 3AEZA 2WJAA 4L16A 1JAYA 1UBUS 4YAFA 3WTBA 4ZVTA 1XMQB 4CEIB 3FCEA 4PTZA 3V1KA 2CXUA 2LCFA 2O8CA 1EX1A 3Q8LA 4M0PA 1FVXA 4GZ5A 4RY9A 1WW3A 2LBPA 3BXZA 1GR0A 4L0CA 1AQLA 3AETA 1U3VA 3S2GA 3ISJA 2IPLA 4JC5A 4AY3A 2ONKA 2WNHA 2IRWA 2IPAB 2V7VA 3LLCA 4V03A 2QLNA 3IV7A 3ZHVA 1V5FA 4UASA 2GTIA 3DMYA 4OXYA 1LI4A 4DCVA 3KAKA 5A06A 2M1ZA 4A0FA 1ITZA 1LBHA 3LGXA 3TQTA 3H5OA 1C0KA 5ARDA 2QRNA 1Z6OM 4OKSA 4OXQA 1J2RA 1KI2A 3H83A 4HN9A 2W6OA 4L85A 4YECA 4PVDA 1ONBA 1SIUA 3A1UA 5I7AA 4E5YA 5C51B 3ONFA 2NV2B 4J0CA 5DCLA 3ESRA 1Z4LA 2IUYA 4EF6A 1WUKS 2OOSA 4TYYA 4PW0A 1NBIA 5LNK1 2B2CA 4ISCA 1Z8FA 1LW6E 2W6MA 3PFCA 3CG4A 5CH8A 4DWOA 3D4NA 2AFHE 5FUQA 2C8LA 1GA4A 1T2CA 3NMUF 2R8PA 3RRNA 2VXIA 3OM1A 2DPHA 3BRWA 2QY9A 2DH6A 3KJNA 2PO7A 2PJDA 4ABYA 1VB5A 3E53A 4JZKA 5BSMA 3DGFC 5GP1A 5JJ5A 3GMIA 2ZCUA 4A5SA 1XVAA 4RJLA 4UEQA 4BQSA 1JT9A 4EZEA 4NIMA 2XECA 3TKAA 1GDTA 4YMLA 1PNQA 4ILKA 2PM8A 1DJMA 3RRZA 5KTSA 3VM6A 4RENA 2LZ0A 2IE0A 1KJ9A 2ZFUA 1TM5E 2ZJYA 4TTTS 1U1EA 2VHTA 1LDYA 3GGGA 4MAMA 2Q62A 3STTA 4CKEA 2D5IA 3DMPA 3LUGA 5EJIA 3DBLA 3KEMA 2AF4C 1J1ZA 1G42A 4RJ2A 3UT6A 1ZGCA 3L05A 2XKKA 4Q12A 3WLMA 2X6QA 1W35A 2CK3A 2Y1LA 2BHRA 3G49A 2QW0X 1RXIA 2ZAOA 3OECA 1N3YA 4MVWA 4JIGA 5JNWA 1FFWA 5COAA 2CXQA 5J5VA 4JLSA 1K8ZB 3UFXB 3D31A 5IMBA 3TJMA 4D4MA 1ZGGA 4OUDA 5AKEA 3TZLA 3KUDA 3COZA 4L9WA 1J9EA 3PRKE 4AJ9A 1UZMA 1P1KA 1KBQA 2G71A 1H6CA 4BNXA 1KPIA 2XA9A 3IO5A 3DUWA 3ZWBA 4Q03A 4FQ7A 2WSSA 3RE7A 5ALLA 3PNMA 4DBLC 3O3NB 2F17A 1ADBA 1Y1SA 5ESWA 3THOA 2XYGA 2ZULA 3MCAA 4DKXA 4J16A 3N53A 2MSDB 4Z4EA 1CUXA 1P9OA 1RVDA 3GLRA 4RSGA 1M10A 4ZCTA 3JASA 1L4EA 2B8JA 1UBMS 1QPBA 1EHIA 1KIAA 4DGSA 5B4VA 2H7XA 1XXHA 4CMAA 4ME6A 3UK6A 1Z36A 1NLYA 2ID4A 4MTCA 1TRKA 1LPAB 2FQXA 1E2DA 4ZP1A 1SOUA 3TA8A 2LTAA 4GKAA 1LV8A 4S0ZA 4QFBA 3LX6A 3TLBA 4EQ6A 2I2CA 1L7DA 4W4TA 2J07A 5CPBA 3FUWA 2YV1A 4GUDA 2CWDA 3BF7A 3RAGA 1NAIA 2F9LA 2GGSA 3C97A 4FDTA 1WXGA 4KDFA 1KO4A 3EF1A 2EWVA 4AZ3B 3KL4A 2QI9C 4IDQA 1RWPA 2EOAA 4PAWA 5DV9A 5F3RA 3W5JA 4N6GA 3EVNA 3L3BA 3FKSD 5BXYA 1NAHA 3FKJA 4RC6B 3TJZA 4BQFA 4WL0A 3ZZTA 3I1IA 4E88A 2BFAA 1Y3BE 4PPQA 4N48A 4QC2A 4H3VA 4RHYA 3EIOA 4KTVE 5IASA 1AV7A 1J2JA 1NTOA 3H75A 1WO8A 3D6HA 3OZTA 4RQAA 2R6AA 3SN6A 3T61A 2W6ZA 3FOWA 2PS1A 2WHPB 3PD0A 5FNVA 2X2FA 3I9OA 2JIMA 3HFRA 4IG9A 1R03A 1N7IA 4CE6A 2B7CA 5CB8A 4U9IS 1JDPA 4KE9A 1YIOA 5C8YB 3VBCA 2J31A 4U7GA 5GZ3A 3S8EA 3PWQC 1OREA 3ZE6A 1PL7A 4ZIRB 3K4QA 2WB2A 4HUQA 1FYFA 4YMUA 3KV3O 5EWJB 4BFXA 1UEXC 2BELA 3FGOA 5HF9A 1U9JA 1QE0A 3KEOA 2VDOB 1GNLA 3HLKA 4LYEA 4BN4A 4ENWA 4Q9KA 5JSUA 1NJ8A 1MGOA 2HHLA 2ZYTX 4D9KA 3Q1LA 3VDNB 1C3LA 3W90A 3L77A 5IF9A 4REMA 3KLBA 4IOKA 2E4VA 4X94A 2OBFA 4F11A 1QQAA 3NASA 2R6FA 1UXGA 1FTGA 2TRSB 3AP1A 5KOHA 4DADA 2QMZA 4TTVA 3AY7A 3H17A 4I9NA 3FB4A 2VXOA 1JLRA 1II8B 4J1QA 2N9UA 2QNRA 1VE9A 3QXJA 1A9YA 1N2IA 3NI2A 3SG0A 1LTQA 4CQLA 3K0BA 3PHIA 3VTKA 3W8RA 1Z3IX 2GSWA 2WDPA 3F6RA 1RR6A 2AX4A 2QRVB 3OY2A 1CUDA 4TROA 4CTOA 2Q2WA 4E5SA 1GZVA 5F21A 3N3BC 3F4KA 5BUCA 1SR8A 3DEKA 4LXHA 4QVKA 2P1ZA 2PX2A 1G6Q1 1RRVA 1Z4OA 4G4SP 3N6VA 4IXMA 2FPPA 1SELA 1X6VA 4CLXA 4D4JA 4N0MA 2SKDA 1E0SA 2G40A 3PCRB 3PI6A 3NHMA 1S1MA 2OXTA 4YUAA 4Q1FA 3GFRA 1CDOA 1M2GA 1J21A 2E37A 4PICA 4RH0A 2P5UA 2FUCA 2ZCJA 3CWCA 1N2OA 4ALLA 3GFQA 3U7IA 2JJ2A 3ZD6A 3GUYA 4HJXA 2G7MC 5A2QA 2B78A 1PD1A 4CG3A 2PNJA 2C7QA 4K6HA 3RG8A 4NZYA 2Y27A 3U1TA 4BVHA 3LYLA 3B12A 4GG1A 3HSYA 3NFYA 4DLZA 1XZGA 3L7KA 1U0SY 3MGAA 1S9DA 3LT2A 1JDBB 3QH4A 4YS6A 3ZXUB 2C58A 2OYRA 1TJ5A 1L5WA 1X1CA 1XKXA 4PS1A 3BHJA 3CNNA 1TQ4A 4N65A 4OGLA 4M9CA 3UIEA 1DU4A 5JWOA 3K0SA 4RYDA 1WCWA 2F48A 3JS5A 4AY2A 4YJFB 3F9CA 2DZDA 1CRZA 4KB5A 3W4JA 3DOHA 1MJHA 4B3DA 5SY6A 2OM2A 3DULA 2CNDA 1QHNA 1NZFA 1T10A 1G8GA 1XALA 2BFBA 2HRQA 3QVKA 4O02B 4FB5A 1M2WA 1N5MA 2G4LA 4F71A 3LOUA 3KUXA 1UWCA 1DX9A 2VBIA 3L7OA 3NYIA 3BXHA 4UVHA 2BMFA 3CX3A 1U2QA 4KWCA 1E3DA 1YR3A 4C6SA 5K20A 2HT6A 3PF9A 2F1IA 2FA9A 3C1OA 2NVBA 2OXCA 3ELUA 3PFBA 4H7KA 4JLAA 3A9UA 5EEHA 3TGLA 2GWHA 1NM5A 2QM0A 3I52A 2GPWA 1J30A 1NFVA 2PZKA 2NXJA 1AV6A 5EJ9A 2PL5A 4YDHB 1IUOA 1ZX1A 1AXRA 2HLNA 2QXYA 4K05A 1U1IA 4KQ2A 4OQYA 3DQZA 4R84A 3JWJA 4BNIA 4C89A 4CJXA 3N2EA 1A98A 3KIPA 4IX1A 2IYXA 4TLLB 2I6QA 1M7HA 3SFZA 2V6MA 4BJ3A 1QH1B 2D5AA 2PSSA 2R86A 3G9XA 4WA8A 4AZVA 4F85A 3BRCA 3A31A 3KTOA 1PEYA 1ID1A 2QRKA 2XQJA 3L40A 4QGHA 4U6NA 4U3JB 3V80A 4HN4B 2WC1A 4RZ2A 5P21A 3RWBA 2CHIA 4AX8A 1KMIY 4UUAA 4ZYUA 1AF7A 3ZLUA 4TZKA 1COWA 3P4UA 2VKQA 2A84A 1PVOA 4RZSA 3DZDA 2QA5A 3F8SA 4RD2A 3WFIA 4HQNA 4CN8A 1SG0A 3BX1A 4IVPA 3E03A 1Y9AA 3ZWQA 4QU8A 1QZ3A 1YHNA 1XK7A 2QUKA 3MQFA 3OJLA 4M1EA 4P9NA 1UK6A 4JQZA 4WZZA 1U2GC 3TQFA 4EBFA 4MWEA 1BJRE 2HQRA 3OX1A 4BQOA 1HR0B 1L8AA 2O8BB 4TOHA 3IMFA 1N4DA 5GMOA 2YN4A 2IUSA 3OICA 4GVLA 4MQ5A 1MXFA 2FPOA 4GP9A 1P7WA 4LQNA 4CKZA 5J47A 4F86A 3Q0IA 2UVDA 1B2LA 1IVYA 3QIAA 2Z9BA 3OUTA 1BD4A 3DKIA 4ZEWA 4BNZA 4DMLA 4OQPA 3X2EA 2ZB7A 3EXG2 5ITVA 3DBRB 1PZFA 5D7NA 2ZP1A 4LC1A 4OB7A 3QSYA 1WR8A 3QEBZ 4TV8A 3LGSA 3STWA 5BRAA 1SVNA 2FF5A 3KA4A 3ZQ6A 3ZTWA 2C8VA 2QJOA 1QKJA 2QSJA 2ZJBA 3LKBA 2ZIEA 3W2IA 2QMHA 1VMAA 2C2XA 4KQCA 5T3UA 5LB4A 1L0BA 2H0AA 3R41A 3O6VA 2P2ZA 4LQHA 4JJKA 1OX4A 3GP3A 4S35A 3R4CA 3AEUA 1UDAA 3LCUA 5BMOA 2XE4A 4P54A 1J8VA 4KC0A 4DZZA 1B0PA 3FBGA 1DOHA 1U2PA 2PVCA 1VC2A 3MJVA 1ZD4A 3L46A 5A3VA 1XL0A 3K20A 4KIJA 4PTLA 3JQPA 3UAXA 2QUZA 4HVTA 1KSHA 3DDUA 2YWRA 4NS4A 4Q1VA 3S5JA 2DKOA 4JHLA 4K6OA 3SXPA 4OG2A 1DKOA 1DC5A 2AOUA 1THTA 1OZAA 2JK0A 1W87A 2E4YA 4BFZA 4LOIA 4C7VA 2NYVA 3FYHA 3C8MA 3BXOA 3GLIE 5ALSA 3CGWA 4BXOB 3OFSA 5KHOC 1HOXA 4KACA 3PPWA 4TWRA 3ROEA 3U26A 1YB2A 1Z0ZA 3DB2A 5I4KA 2AZ4A 4H7FA 1N6HA 1L5ZA 5JMOA 3MCUA 3UOWA 2FUNB 5K4GA 2JHGA 2VJLA 3FY4A 3AJAA 3P97A 3QVMA 4GI2A 4QTTB 1IY2A 1TUGA 2CFRA 1VJRA 3LY8A 3BXPA 2PMEA 3VPFA 1ZGAA 5ITZB 3T9BA 3NP9A 2G6BA 3TL6A 1T36B 3ZCTA 1RNLA 2FSFA 3SMVA 1P18A 4OAPA 2D5KA 1H5NA 3HE3A 5EIHA 3I9FA 1GYQA 1IBSA 2QM3A 4IIEA 4UVGA 3T4XA 2ZVQX 1GOTA 4HB4A 1W49A 2Y3QA 1B4DA 1NE7A 1UWKA 2PBZA 1JG6A 2IW3A 1KZYC 4NK4A 1UXIA 3W34A 2AG6A 4ACBA 4PFQA 3RS7A 4JKYA 1BDMA 1LVGA 1JILA 3HFJA 2I1WA 1NNUA 3EGDA 3QKSA 1ZR2A 2NP6A 3AQIA 4AUMA 4MS1B 2ZROA 3G68A 5K0TA 1HDZA 2V7GA 2I4MA 3THXA 3D7RA 2A7QA 5DM1A 4W1RA 2WD7A 3R2KA 5DRTA 2NMVA 2E7ZA 3PCTA 4K3VA 3R5SA 4B4UA 1I7LA 3R23A 5FEMA 1KAEA 3AEQA 1QB7A 2VHCA 3B48A 3O8DA 4W6ZA 3PB3A 5LXTB 3F97A 1XKLA 1WV1A 4DTIA 3FG9A 4KGXA 1L1FA 3ZE9A 1N5OX 3TAUA 1M8FA 4EY6A 3OCYA 4OB8A 2AOXA 1K4YA 3FYSA 4IJKA 1Z56C 4O4LF 4TMTA 1U90A 1FU8A 3FSGA 2PVSA 3DKPA 5T5QA 5K6AC 2XEXA 4PX2A 4V0MA 1G3UA 1NUQA 3THWA 1JHUA 5TE9A 4D98A 2PMDA 1E6EA 1J20A 3HG7A 4DSNA 3WJ7A 1FSFA 4OAOA 1QQTA 2VDWB 4K9OA 4ZOAA 3H1AA 4JXKA 7ABPA 3UJ9A 2WUGA 1XN1A 1EVEA 2Z3WA 4Z3OA 4JSTA 1PUXA 5TPWB 1UBEA 1Y6GA 2JAWA 1P8AA 5F5NA 1NC1A 2XDAA 4II7A 3S8MA 1SURA 3G2IA 4X45A 2Y2UA 3O31A 3P9XA 2YDYA 3WIUA 4DQKA 4REQA 1WXEA 1XMSA 2PFGA 3BGWA 3ROPA 4DLBA 4QZVA 4NV3A 3LHFA 1UMCA 4IX9A 3VTZA 3URMA 4ZO7A 1QDEA 1A7JA 5CMLA 2AOTB 2IKSA 5M5BA 1C7QA 1H4VB 1DEXA 1QKKA 4DYZA 1TMKA 2CNWA 2PX5A 2XIQA 2ZB4A 4LUCA 2P5TB 2MINB 4N1AA 2ZE6A 4UHDA 3TXXA 5KU7A 5L3QB 1IN1A 3K0FA 1KH2A 2N75A 3AUAA 1A7AA 3OZVA 2DPYA 2WF5A 4PY2A 2ZTVA 1CNEA 1JLMA 1T4DA 1W44A 2WAXA 4URHA 1N5IA 2HHCA 5CK4A 4ALNA 2IEBA 4DR4B 1D4AA 1LS1A 4MKGA 1BGWA 4JROA 2Q1UA 1GLVA 3H2YA 3NKLA 3GRFA 3T12A 4BO2A 4E13A 1CRPA 3PQ6A 2WSIA 3RHZA 1DQSA 3HGMA 1P2UA 4FCTA 3VGJA 2D74A 1JG2A 4K2HA 2A86A 4E5UA 2VAXA 3FUTA 1VPVA 4X1KA 4Q7KA 2NIPA 1LJ8A 3HU5A 3NT5A 3W5CA 5LBIA 4W82A 4NH4A 4GWKA 4KE7A 2HJ9A 3GUUA 1CETA 3QVVA 4I1SA 1SHKA 3CX8A 3U6BA 4RPGA 4LCEA 4C87A 2EBUA 5LP6F 2R5WA 1YVRA 1N1EA 5D1HA 1UQTA 5LP6A 1SCBA 4A3SA 3SAJA 3H9EO 4N8DA 4TRMA 3GUVA 3LJKA 1VI2A 1WF3A 1X94A 1O94D 2Y9PB 2GM5A 4RXMA 5LCXA 3ND8A 4GDFA 3OD5A 3QYPA 1UBOS 4DZ0A 2ID9A 1IPFA 3GEBA 4W5RA 5CVJA 4OQNA 1XD8A 2FMHA 2O05A 1Y5NA 3FTPA 4HGNA 4PG6A 4DLLA 5IFLA 3AF0A 5GONA 3SSNA 1MN6A 2LP4Y 4AJKA 3KNZA 1WP9A 4DDHA 3IAS6 3FPAA 5JQGB 4BTEA 2N3ZA 3VV3A 4EKGA 4ESHA 4K5QA 1PTKA 3K0EA 4TT3A 1UOOA 2VEDA 3GHYA 4WKPA 5ESDA 5JXWA 2JATA 3M3DA 3OX2A 4WHMA 3GCZA 4W7HA 1LDGA 1F2DA 2O2YA 1HLPA 1SXHA 2H31A 1M8JA 2FXIA 2WTNA 4RCYA 4B3RB 1UKAA 1R0SA 3UAZA 3KAPA 1J1UA 1PFUA 1KJYA 4PHGA 3BILA 3JD0A 5F5XA 1BX3A 1P4AA 3ZWDA 2QQ5A 5DYGA 1FZTA 1SOMA 5AVWA 4OQXA 1SKQA 3EWNA 3IMKA 4NOLA 1PK7A 3RYHB 4DGQA 4PNZA 4KQIA 2XCTB 3LWBA 4NY1A 4C03A 3Q3EA 2QVXX 5TV2A 4P3PA 5EZ6B 4B3SB 1JG4A 3NT2A 2VSFA 2XTMA 2ZSFA 4LRUA 4DA6A 1Z5VA 1YQWA 4C0XA 3E7PA 2V03A 2QIPA 5FPTA 5C7IO 5LOVB 5AXSA 2WJ6A 4X0EA 3K6SB 1B23P 3REQB 1GQ2A 4MXDA 2OC9A 1KP3A 1RHMA 1RYHA 3GAMA 7REQA 4D9FA 3L8ZA 2VJQA 2RI6A 4NCNA 1ZH6A 2O3TA 3T7EA 4CG0A 3QRWA 5L6LB 1OVMA 3HVIA 4MV4A 3IOBA 4X85A 1IXRC 1WUYA 2XZPA 1M3SA 4OM8A 2RGRA 2LCQA 2GT1A 1W0CA 2P69A 2RCNA 4AKSA 2C4WA 4MJLA 2K87A 3RVKA 1G18A 1GQSA 3NEJA 4B46A 3N2KB 3AZQA 1JHAA 1BC5A 1FUEA 2ONYA 4INOA 4EY4A 4GYWA 1BE1A 5JS7A 2ZIXA 3WB2A 4IKOA 4WZBE 3L0PA 4I66A 3QXSA 4HEA1 3F78A 1XTUA 3C0KA 4E1AA 3IUNA 1GSOA 3NUGA 1SNYA 3NBFA 3ZC3A 521PA 2GK6A 1SPBS 2OK8A 2Q1WA 1ACMA 5I7SA 4ND8B 2E6UX 2ECFA 4ZU3A 4DLAA 3UUGA 1QSGA 4UOZA 1B2RA 2A5LA 2AJCA 4H7DA 4RHTA 4YH1A 1E5QA 2OBMA 1E5TA 2H59A 3L8FA 4DDMA 2Z2JA 2CKDA 2FZ5A 2WSBA 2GYDA 2JCSA 4KBYA 4R2LA 1UT5A 4ZT5A 1MDFA 2VDUE 2XA2A 4RV9A 2ZI6A 3BMCA 5FFBA 4EPVA 4W7IA 4QXRA 3D1VA 4KIGA 4IWKA 3IPLA 5HK8A 2A5FA 3S2IA 3R2SA 3IHKA 4QASA 4AX4A 3BEDA 3DOOA 1CZOA 1CQZA 3P26A 3NOXA 3GJRA 4OB6A 3TN7A 2VPWA 3D6MA 3HGQA 3ICOA 1MAWA 1KFKB 2BGKA 3MCVA 5FT9A 3GPCA 3ZNNA 3R7AA 4ICIA 2QTFA 4CF4A 5DM70 4WVLA 1QIGA 2AUMA 3AF5A 5DGCA 1JYSA 3UMMA 2XB9A 1KFCB 5EESA 1U0FA 2WEKA 4HDRB 4OREX 1OA0A 4YAUA 3U4QA 3GGPA 5HZMA 2BONA 4KH0A 2A1TR 4A8JC 2WJIA 3LFTA 4IDCA 4OX9Y 2C7PA 1Q17A 2C04A 1QHXA 3C5CA 4QPPA 2QD1A 5J4YA 3KKKA 1QG6A 1ZN2A 1R3UA 4BYMA 4NXMB 1F9AA 4NLLA 4M21A 3MFYA 4WKGA 4JFAA 3E8MA 2O2HA 1M0WA 3BYZA 3JYOA 3AF3A 5I48A 4ZL6A 4C6RA 3LFUA 2YBDA 1ULBA 4FDUA 1CWUA 4CVPA 1N8TA 4WN9B 3DZKA 5AKGA 1U5CA 2PWBA 3KUKA 1JI3A 3O7SA 4WW0A 3UQZA 3U7HB 5FL3A 3VAZA 2ZJ0A 3CH5A 3JQAA 5ECDA 5JJBA 3GWZA 1GQYA 3ZGYA 4FKMA 2ZYWX 5EHGA 1YQUA 3KLOA 5AH0A 3OT5A 5KDOA 3EUWA 2GCOA 3AERB 3HZHA 3WK7A 1JQDA 1YVUA 1KYWA 2RB4A 2QDXA 4JUDX 2YS7A 2YIJA 4CKCA 1DCTA 4WCVA 5BXQC 3H8VA 5IFKA 1TB4A 2HK7A 2FEMA 5KNCD 3GJYA 4ZI7F 4NCAA 1FVHA 2FXVA 4L15A 4F21A 2NYAA 3QEOA 3BWCA 4LIPD 2A14A 1LKMA 3F5DA 3FRHA 2PDAA 4E21A 2HJRA 4ZJUA 2VXXA 1JU4A 3ENVA 4EVIA 4LXIA 3ER8A 3DEHA 1HT3A 1O96A 3GRPA 5C6FA 2I2DA 4LMPA 4OHCA 4A2PA 3I4CA 3L6DA 1E4EA 1P0PA 4QL3A 3FSRA 3C3DA 3IQFA 3QNWA 2JCVA 2ZTUA 1KMCA 4G81A 4F5YA 1JJVA 1US8B 3N59A 1FFAA 3NS7A 1RMTA 1JLLA 2JC3A 4R9UC 4C1NA 2OKGA 3VPBA 3G5TA 2RG7A 4K9PA 4IWYA 3N0WA 2DMRA 4FU0A 5FL7D 4UOEA 1HT2E 1Q7EA 1R88A 4BUJA 3ZR4B 3LG2A 1QO9A 1Q0UA 1W0KD 3OP4A 4WCFB 5HMMA 3ZCXA 1GZ4A 1NGSA 3PDWA 2ZYUX 1XVTA 5K8JB 3ZWXA 3MELA 1D0VA 3ADBA 2RH4A 3VDXA 2CFIA 1MW9X 5E7QA 4R05A 1CS4C 4EBBA 3A8TA 3SVLA 1E0KA 2Z5GA 1I13A 1Z6QA 4OJYA 1TF5A 3L6EA 4KX3A 4LJ6A 4CUZA 1RCUA 1PBTA 4X1OA 4EF4A 5DLEA 1OFGA 4D4IA 1Q1EA 3JWIA 2FX3A 2XNCA 4HYQA 1SCIA 1QDUA 1AT1A 4YYEA 1ICEA 1TPZA 2QYTA 4WESB 4TL7A 1ZMOA 4F2WA 1GPNA 2JIBA 4GKBA 1SUSA 4HADA 1LDNA 4Q82A 4P4SA 2JVIA 4MW9A 1MD9A 5KYWA 4KIFA 3K0HA 5DEOA 2GEVA 1ZD2P 4GYKA 3IQIX 1B76A 1DINA 2FZCA 4ANFA 1QIFA 2FW0A 3C8HA 1VECA 3KKZA 3T7KA 5JJKA 3QVOA 3V55A 1A1SA 1D2AA 3FF1A 3JSXA 3PRYA 3VYTB 1V9SA 2IEDA 2C2MA 2PXAA 5HJEA 2CHQA 4GI3A 3MWLA 4L7QA 3FLAA 2AFIE 4R6WA 5IKPA 4DV6B 2QP3A 4BGIA 2ZWPA 3DVLA 3TSWA 4HGZA 1G291 5BMVA 2HT1A 1DKMA 2UZAA 2OQVA 2GKGA 2XZOA 3H4MA 1MG5A 4OHKA 2ZURX 3GV0A 2J6HA 2V5UA 4JR0A 4P5EA 1VLJA 3AJEA 2EFDB 2X9GA 3OSUA 4XQEA 5K8UA 2RC5A 3B5JA 1KZ6A 3IEIA 4NWIA 1RBZA 1AVTA 4JU8A 4J0KA 2Q0XA 4UBOA 3ZY3A 2GXQA 1N2CB 1ZM7A 1QM5A 3Q9UA 1L5KA 3VYVA 3IUQA 1RAAA 3M82A 3S2UA 4A0HA 4FI3F 1JKJB 2QV0A 3G2QA 5EXEA 5FUVA 1YDEA 4OP2A 4X54A 4EJ0A 4NCBA 1OB5A 1XTTA 1ZRNA 4RTOA 4EO4A 3TLZA 1A7KA 2R8OA 4PGIA 1Z73A 2QSUA 2WM9B 4YP0A 3F7TA 4RBNA 2QMEA 1B1AA 5COBA 4EAAA 3NIFB 7REQB 4MGZR 2AZDA 3KHKA 1U9IC 4IBOA 2FSHA 3I0NA 1XPUA 3L0CA 2Y44A 3B53X 1I4WA 2L17A 4IGAA 5CDFA 1QGED 2PRSA 4CVRA 1RYFA 3O75A 4HB2A 1Q6YA 1VDMA 4IVRA 4XFDA 4Y1RA 3EDCA 4DQDA 1FDOA 4WKBA 4R0MA 2FPGA 4KE6A 1W36D 1XEXA 1ADYA 4QDTA 2HIMA 4E03A 4YP1A 1SUDA 3BG5A 2VHUA 5KTOA 2GD6A 1Y1PA 3HACA 3P2MA 4ZN6A 3G7SA 3GGJA 3GZJA 4WKNA 4QJ3A 3DEJA 1BU5A 1CF9A 5DBOA 3KFLA 1EGAA 2A9VA 2W2KA 2NLOA 2YW2A 4AJJA 3OWHA 4W9NA 1SKBA 2GN2A 4GZMA 5EJ7A 4WBNB 4I5GA 3ZWVA 2EIHA 1XZMA 1BD3A 5FI0B 4C5AA 3M6MD 3O94A 2YYSA 4I81A 1U2DC 4GPIB 3C3XA 2X23A 2CJPA 4PXSA 1ENOA 2IOFK 1KXZA 4UD2A 4LVOA 1FNSA 3OEEA 1WF6A 5AW5A 4DF3A 2EKLA 2DCMA 1R4NB 4NR0A 1XAGA 4RK0A 4IMRA 1RAGA 1TVKA 2WU8A 2O7SA 1Z5OA 4PLHA 3M1LA 5FI3A 4E5NA 3S8YA 2EG9A 3VZBA 2R5FA 4D8YA 4PWYA 4F38A 4D4GA 5AVQA 4JI0B 1JA0A 2CD9A 3TW0A 1AQNA 1T2VA 2PL9A 1RKQA 4ARVA 5BNZA 5ILOA 2Q5OA 2NXWA 3T52A 2V59A 4PFJA 4PAGA 3V5NA 1A1VA 4QOSA 3RW9A 3Q2OA 3E7DA 4D9GA 4MYTA 4NYMR 5HQJA 3RBZA 1ZNXA 2J59A 3SX4A 3EZ0A 1BHSA 3M83A 4Q02A 4W5TA 4NBLA 2RGNC 4QTXA 4KSBA 3C21A 1QHGA 2R6GA 3VKGA 2FAXA 3A3NA 5AUPB 3C85A 4M87A 1HF3A 3EGXA 1U99A 2OGUA 1KORA 5A4DA 2GYVA 2X58A 4LHEA 2I1LA 3MMSA 1TA4A 3MD0A 4RPIA 4Q9LA 2FRVA 1X7YB 1P4SA 2UVPA 2VNHA 5FOQA 1DPSA 2IHKA 5C52B 3OWOA 2WQZA 2JI8A 1A8QA 2O6HA 1S8OA 4XXHA 5ADVA 1BSVA 1YRWA 1VMDA 5IJWA 1KAOA 4B6FA 1NUPA 3EXHA 4QXAA 5HFNA 2B0CA 3C45A 2OHOA 4M37A 4GXNA 1H2ZA 1MXHA 3HXOA 2GJAA 2A5DA 2JGDA 5F5LA 1R18A 2WLUA 4MDYA 3K09A 2HDWA 3MC1A 3TGPA 4NKRA 3FVTA 4FC7A 2BGGA 1KARA 3P7MA 2MU1A 2DFVA 4HNAA 1S2MA 2CXHA 4UZSA 3SF0A 1DRVA 1KWKA 2G5CA 3LP5A 2GM4A 4Q4AA 2VT6A 5I9MA 3RWMB 5FBLB 3GK3A 3BGVA 5JVDA 4KWIA 4QTUB 4KXFB 5KWIA 2NVUA 2Q4OA 1QCZA 4QXPA 3DTVB 1MU0A 5J93A 1DHTA 1KY4A 4LECA 1HXHA 1HLDA 1PIWA 1W46A 3ZVLA 1KPHA 1O0CA 3EVDA 3JAKB 2Z0MA 1VKOA 1YBHA 2WMOB 3BAFA 3Q12A 4TL8A 4X7MA 5JD5A 4U7FA 5IXSA 2QD4A 3ZDAA 3ZK8A 2HLHA 2NZYA 2WIJA 1L7PA 1WSWA 3SF8A 2IE8A 3QQ5A 5CA0B 2FK8A 5ALVA 2XUKA 2FPUA 2WZBA 3DXYA 1IH8A 3GLHE 1T6BY 3HBMA 4JL8A 4YAOA 2WQ7A 4MV5A 4N3CA 3WLAA 3JQCA 3Q2IA 4D3ZA 1E18A 1SXJC 3GJ4A 4R40A 1I9GA 4E4YA 1E3SA 4BRSA 4IM7A 1VDZA 1ZL2A 3TAHA 5I9IA 3FX2A 4TMXA 3ZI4A 4CMJA 3W3AA 1GFWA 3ORRA 1QPZA 1C0EA 2AG8A 3WLHA 1BFDA 1KI1A 4HEHA 4EHHA 3I5AA 3W2HA 3FXAA 3AZOA 1E3IA 2GEUA 3QHQA 4HQFA 3PUIA 5H16A 1SC1A 1DIRA 3VH3A 3CUTA 3AQ4A 3FF4A 5KQLA 3TQCA 5HF6A 1EAMA 3HSKA 1XRSB 1B8PA 3EEOA 2YWCA 3UZUA 2VDKB 1IZ7A 2ATVA 4L3WA 3RUEA 1KC1A 3TZCA 3O8OB 7ADHA 3FTEA 2WUWE 4ZV7A 1FP2A 2VWPA 3IT1A 3MG9A 4KQ6A 3SHFA 5C8YF 2C99A 4Y2HA 2L2QA 2FSIA 1CQWA 2FZEA 2H2IA 5AD1A 2OEPA 2Y2VA 1EQAA 2C61A 1WPGA 3PQFA 1U8TA 1W88A 4EY7A 4R2KA 3L4BC 1ORIA 4G86A 4IIUA 1WD5A 3T5CA 2VUIB 3WGKA 2WAMA 1ZHFA 1NXXA 3CKMA 1OLUA 2OOKA 3JQ8A 4NFLA 1QVRA 3EXFB 3JYHA 3Q85A 4XM0A 5IBQA 4F5WA 1N5JA 3L6RA 1C7JA 3TJRA 4G1CA 4KVQA 2LNDA 1J8MF 3DMFA 2BGRA 4INZA 1Z2NX 3BJEA 2IB0A 1SKMA 2FOXA 4DJAA 3H3FA 2XGOA 3R2OA 4R2JA 4RZQA 5AK4A 5LBTA 5HPYB 2KX7A 5I9LA 2FJCA 3F4BA 3SSOA 1E4VA 1U28A 1B71A 2B5VA 4Q66C 2Q6IA 2Q1SA 3PLAE 2E4WA 3JQBC 4JC4A 3FYCA 4Z2AA 1XZ1A 5D7BA 5HOEA 1PR5A 1C30B 4GF5A 2HMVA 2X13A 4B7AA 3QPVA 2PT6A 4PN3A 4C7KA 3RUIA 4Z53A 4ERUA 1SOAA 4KXQA 3RVMA 4HRXA 2XUDA 4DRYA 4F1WA 2F8TA 3OZWA 3VX3A 4MUNA 3KAJA 3DS8A 2WJ3A 3QFCA 1N9ZA 3WO0A 3UOFA 2P0AA 4OFWA 1YV1A 3EG9A 3E5MA 3C6QA 4KPUA 2BM9A 2P27A 1KAQA 2QYOA 4HLUC 4J4HA 5FWDA 1LTHR 2ZRLA 1L5HB 1JPNA 7AT1A 3BTOA 3GVYA 6ADHA 4B3JA 1NN5A 2B30A 3O4VA 1HZZA 1G66A 5GIOE 3P1JA 2XX3A 2C54A 4YP7A 3L1IA 4FT4A 4IYJA 2QXUA 4FHZA 4PF1A 3O21A 5C3MA 2VJNA 5AHWA 5KWJA 4KCGA 1G6HA 3MJRA 1U2SA 3QUCA 4GI7A 3UGQA 1J7KA 4RQTA 2DXIA 1F2UA 1T3SA 1SCNE 1Z88A 3N8HA 4O4JB 5CHEA 4AYXA 1CIJA 3NP7A 2PS0A 2A1IA 5TQ0B 4RGQA 3O9VA 5ETJA 3WWOA 4FW9A 2O5CA 2QG6A 3RYIB 2OBXA 3FMPB 4N7BA 1NKVA 2G1JA 1I4EB 3VI4B 1JTFA 1AGNA 3MWKA 4TKVB 2JD0A 1WKBA 2ZRFA 4RL4A 3GX1A 2XYHA 3EVGA 4L76A 3HKDB 1UBRS 2P9TA 2PKYX 3P94A 5CX4A 2GZ2A 5CYFA 2J30A 1QU2A 1UDWA 3RB8A 3DFKA 3OQIB 3BF8A 4PPNA 1M0EA 2HSDA 4JODA 2IYOA 2XVMA 4LMAA 1G63A 1Z0UA 4GPBA 4KUGA 4UHHA 3P2IA 4JLOA 4FWBA 5HILA 3OVMA 3DAPA 1NKSA 3HP7A 3DONA 2G28A 3GT0A 3IALA 3UV7A 1TADA 4PG4A 1U8ZA 4XTRA 5ABPA 3TMKA 4CDGA 3CR8A 4GLJA 4LV6A 1WAMA 1IHXA 1EUCB 2QX4A 2W8BB 3QWHA 3HJAA 2RHDA 1D6NA 3KLPX 3KB8A 2AYYA 3PTZA 1W2GA 2IVZA 3NIBA 4R2MA 1VHJA 5LC1A 4B6QA 4DIUA 5TMPA 4JI5B 4UU0A 3GT3A 1KTIA 5CB4A 1VHLA 4PM4A 1YCGA 4RTJA 3T7JA 2FZWA 1PQWA 3EUFA 4CKWB 4U2DA 2B7LA 1NZDA 3O91A 3MGKA 4KI0A 4ZTZB 2JIRA 2ZJ7A 1SUEA 1C3OB 3L4SO 1LK0A 1WY7A 1J1IA 1UMDA 2R7KA 4RFVA 4Q3BA 4OHFA 1P5JA 4ZT7A 2YINC 1G8SA 3NBAA 2X1LA 2GWRA 3IEMA 1D5CA 4C7XA 2D7CA 1WMAA 3UHOA 2UUCB 4V02A 1Y34E 4GYYA 4IUCS 4YJDA 1FX0A 1HORA 4K0RA 1ZFNA 3IUEA 3ZQKA 4LK3A 3TG8A 2AEFA 4ZT6A 1GR1A 2DWCA 2P6OA 2PMFA 2OLJA 4CU2A 2M6SA 4OM7A 3KP1A 1Y6ZA 3AK8A 2CVHA 2ASVA 3MIZA 3K6KA 4EYKA 4LQ4A 5G02A 1B73A 2Z90A 3QE0A 4MUKA 1N9GA 5KYXB 2ISCA 4UNIA 4XA8A 4HQ0A 4PLGA 2J1LA 1X8KA 4WFQA 3I09A 4YJ2A 4L0DA 3D0QA 1KR2A 1EBBA 3OOSA 1QX4A 7YASA 5HYVA 2XOXA 3OHPA 4TMYA 1X92A 1TU4A 5EKXA 3ESBA 1OYOA 4ZJYA 4GXTA 1LFAA 4BV2A 1C7ZA 1MEEA 4MLCA 2WJ4A 1Z35A 1EI9A 4RMJA 2BM1A 1CUAA 4OHVA 1ESCA 3ZDQA 1ODIA 3I5XA 1KHTA 3AHCA 4Q0MA 5CB6A 4XVHA 1TLFA 3UV6A 5DBFA 2VBGA 5FA8A 2I6TA 3FMOB 4DCCA 2ATEA 1QWSA 1E94E 2Z9DA 2AD5A 2PSDA 3VR1A 4QEDA 1OXBB 1J9GA 1NX9A 4LZWA 3AF8X 4GMKA 5HSGA 4K9LA 3HKCB 1IM8A 2ZUFA 1U4OA 4CFYA 2K4MA 2AUTA 5HZGA 3VTFA 4MQFB 1J06A 1D3AA 3ROMA 2V2SA 3TZEA 5CH3A 1RI2A 3IA2A 5AXBA 3W6UA 1HE5A 1HDRA 1SJ9A 1ULZA 2DWPA 2JGFA 3H99A 2Q4BA 4Y6GB 4NP6A 5HJHA 3PX3A 3QA3E 1O0SA 3D5EA 4WXRA 1V1MB 4DLUA 3T7TA 4L07A 1YQEA 1BCFA 4OJTA 2J9FB 4P81A 1Z0SA 4RXTA 1QH0A 2FEWB 3Q15C 1LWNA 1VFPA 1LDBA 1PWHA 3NIDB 1A2QA 5HVNA 1W5AA 4G0NA 3L04A 4ZYVA 2V15A 3KX9A 5LLTA 3NOQA 3O9MA 1DO2A 4D9EA 2OZPA 5EJ4A 3LQKA 3Q3VA 4NATA 3E4CA 1M34B 4YRLA 2IF0A 2XD4A 4YV0A 5HK9A 2GA8A 3LLUA 2ZRMA 4IRMA 1DTWB 1C81A 1NI3A 4RDHA 3RABA 1NJSA 4QBHA 3VKFA 4CM8B 5ARBA 2JGAA 1CY0A 3VVAA 1GA1A 1MFPA 1N25A 2PT9A 3EB9A 4ZYLA 3A28A 4V1CA 3A6FA 3AKDA 3MYYA 2CL6X 2WJHA 3FDXA 3PBKA 3UF0A 4ENPA 5KO2A 1TYEB 1NBMD 1Z5GA 2I55A 1M5RA 2DUUA 3SY8A 1CYDA 1Z0JA 3QOYA