2AR0A

Crystal structure of type i restriction enzyme ecoki m protein (ec 2.1.1.72) (m.ecoki)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
524
structure length
485
Chain Sequence
NDLVAKLWKLCDNLRDGGVSYQNYVNELASLLFLKMCKETGQEAEYLPEGYRWDDLKSRIGQEQLQFYRKMLVHLGEDDKKLVQAVFHNVSTTITEPKQITALVSNMDSLDWQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVKSQTNDLDDLDGDTQDFQIHRAFIGLELVPGTRRLALMNCLLHDIEGNLDHGGAIRLGNTLGSDGENLPKAHIVATNPPFGSAAGTNITRTFVHPTSNKQLCFMQHIIETLHPGGRAAVVVPDNVLFEGGKGTDIRRDLMDKCHLHTILRLPTGIFYAQGVKTNVLFFTKGTVANPNQDKNCTDDVWVYDLRTNMPSFGKRTPFTDEHLQPFERVYGEDPHGLSPRTEGEWSFNAEETEVADSEENKNTDQHLATSRWRKFSREWIRTAKSDSLDISWLKDKDPEPDVLAAEAMGELVQALSELDALMRELGASDEADLQRQLLEEAFGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase
molecule keywords Type I restriction enzyme EcoKI M protein
publication title Crystal structure of Type I restriction enzyme EcoKI M protein (EC 2.1.1.72) (M.EcoKI).
rcsb
source organism Escherichia coli
total genus 148
structure length 485
sequence length 524
chains with identical sequence B
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
A PF12161 HsdM_N HsdM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.30 Mainly Alpha Up-down Bundle Ferritin Ferritin 2ar0A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ar0A02
3KR0A 1JQEA 3LDFA 2P7IA 2BR3A 2ZFUA 2E5WA 4OBWA 3QOXA 3IEIA 5LQAA 2HTEA 4E31A 3FTFA 4LECA 5DTRA 3A27A 3P9NA 1INLA 3CVOA 3HCDA 3LECA 2WA1A 5EZSA 2QRVB 5DRTA 4RTMA 2OB1A 3NMUF 5FWAA 4E2XA 5LQJA 4GC9A 4OA8A 3WSTA 3EMDA 4P7FA 5E2BA 2GH1A 3SSMA 1BOOA 3TQSA 4YMHA 3BXOA 1XTPA 3G5TA 2FK8A 3PFHA 2GS9A 2PT6A 1L1EA 5KYGA 2XVAA 3G8BA 4NECA 2AS0A 4BLWA 4CTKA 2Q41A 2OO3A 3SM3A 3I64A 2C7QA 5K0LA 3LCUA 5ICGA 2UZ4A 3KR1A 1NBHA 3DH0A 4MWZA 1KHHA 2AN3A 1RJGA 3B7PA 1G8AA 2AOVA 3KPUA 2UYQA 4EK9A 2YTZA 2O05A 2ZCJA 2ZVJA 5ERGB 4HGYA 1QAOA 3DULA 3OFJA 5E9QA 2QRVA 5FADA 5DXAA 2QE6A 3TKAA 4BY9E 3SXJA 3U81A 1AQJA 4EVIA 1T43A 4QDJA 5GWXA 3NDIA 2ONZA 3FPGA 1P1CA 4H0NA 5FULA 3HCEA 5FHQA 1X1DA 2YQZA 1SG9A 3HVHA 4EMSA 5EMJA 1FJXA 3EGVA 1R8YA 5DSXA 4Y30A 1O9HA 5CVEA 3PS9A 5D1NA 2C7RA 5ICFA 5MHTA 4PYLA 3LKDA 4X63A 4AZVA 1MJFA 3PFGA 3CKKA 4QPPA 2PV0A 3V97A 5E8RA 4RYLA 4RTNA 2GLUA 2IDJA 2NYUA 3G2PA 3M6XA 4F85A 4HH4A 3UJDA 1RI3A 3AY0A 2YX1A 4RSRA 2R6ZA 2G8NA 2IIPA 4PYOA 3SSNA 2O57A 2LD4A 1UIRA 3SSOA 3LBFA 3EVEA 4YMGA 5LSAA 4QQKA 5DPMA 1NW3A 4CKBA 2CKDA 3MB5A 4DCMA 4YUXA 3HA3A 2OPBA 3CJQA 3UJ8A 3CBGA 5HIKA 2CMGA 1Z3CA 3A26A 3B3FA 5T64A 3MAGA 4R6XA 5EVJA 2HNKA 4RTPA 4PGHA 4PINA 3P9KA 1TW2A 1ZG3A 4PYQA 3LX6A 4QVGA 2BR4A 3AJDA 1YFJA 5BXYA 4QPNA 3UWPA 2Y1WA 5FWDA 5C0OE 2PY6A 4HRAA 1NKVA 4V0RA 5C1IA 5G02A 4YUYA 2JJQA 2I9KA 1KYWA 3A4TA 3BKWA 5HIIA 3BGVA 3DMFA 4R6WA 1X19A 3FRHA 3KQSA 2ERCA 5F2KA 4E2ZA 3HCFA 2AOWA 4UOEA 5CIYA 3S68A 5DM0A 4GOLD 1MHTA 4EKGA 3FTCA 4XUEA 5FQNA 2EFJA 1U2ZA 4FT4A 5K0FA 3GNLA 3DXYA 2P41A 3O7WA 2P40A 4RVGA 3VYWA 2O06A 3JWHA 4EKIA 5LQUA 2DULA 3BWYA 3VC2A 1O54A 1ZGAA 2ZWAA 3BWCA 1QAMA 5E8JA 2JG3A 9MHTA 4X1OA 1ZQ9A 1SQFA 3CC8A 2H11A 1BKYA 4CKEA 3BT7A 1I4WA 4V0QA 3T7SA 3P71T 2FK7A 3P8ZA 3UA4A 2FYTA 1R6AA 4KDRA 3I5UA 4MQ4A 2JH9A 2PJDA 1XDUA 3A25A 3G89A 3GIWA 3KPJA 5CVJA 1SKMA 3JWGA 4L7VA 2R3SA 1R18A 1D2CA 3HA5A 1WXWA 4FP9A 4AZTA 1RJDA 3M70A 1M6EX 5FUBA 3FUTA 4RVDA 2IH4A 3LDGA 1JSZA 4ER3A 1VIDA 1JQ3A 3EVGA 4IWNA 4F86A 5BW4A 2CL5A 4PYKA 1D2HA 4QVKA 1KPGA 3ELUA 5CCBA 4ER7A 4BP1A 2ZZNA 1VPTA 2ZZKA 2UYHA 2ZBPA 3NTVA 10MHA 1RI1A 3M33A 2BH2A 2AOTB 4R8SA 1KPHA 1EIZA 1WG8A 3IYLW 5HEKA 1P39A 2YXDA 3C6MA 3GRYA 4PONA 1VLMA 3UJCA 2G1PA 3NWEA 3RODA 1BC5A 1KP9A 2NXJA 2P1DA 4KW7A 4FGZA 2PXXA 1JG1A 1VE3A 1F3LA 3BZBA 1NE2A 2IDKA 4C03A 3R24A 5GIOE 4QTTB 4M38A 3UJ6A 5K0GA 4DKJA 2NXCA 3LKZA 2PXAA 3M6WA 2NXEA 3T0IA 1Y8CA 3THRA 1EAMA 3JWJA 1XXLA 5T6BA 4ER0A 2ZW9A 5DM1A 3E05A 2H00A 3I58A 2OB2A 4PYIA 2JHPA 2JHAA 4YUZA 1JQDA 2PWYA 5FQOA 3MGGA 3X0DA 3L8DA 3P2KA 4Y2HA 4KIFA 2XVMA 3DMHA 4P7GA 2FPOA 5DTQA 4IV0A 3GXOA 2AOTA 4YUWA 4OX9Y 3ELDA 1JG4A 1VP3A 3UA3A 2OY0A 4O29A 3BGDA 2NNWB 4DA4A 2ZIFA 3MHTA 5IH3A 1TPYA 2IGTA 1XJ5A 3EMBA 2P8JA 4IV8A 1IM8A 3QV2A 2IH5A 1R74A 5JUWA 2HWKA 3DXZA 1JG3A 1JSXA 1RI5A 1X1CA 4PWYA 5FA5A 3ER9A 3PT9A 2VDVE 3P2EA 4K6MA 1JTFA 3HA7A 4LG1A 1N7JA 4C4AA 4XCXA 3GJYA 2HMYB 3UJ9A 4YV0A 7MHTA 5DX1A 3K0BA 5DM2A 5DXJA 3KKZA 3B3GA 1JR4A 3EVZA 2OKCA 1KYZA 3HVIA 3RW9A 4POOA 4YV1A 5EEGA 1RJFA 3FZGA 1WY7A 4QTUB 2IBTA 3OZTA 2IH2A 3BKXA 2WA2A 1YF3A 1VQ1A 3NW9A 3F4KA 4PNEA 4BLUA 3EVDA 5ICCA 3K6RA 2I7CA 4HG2A 4GF5A 4OQDA 3RIEA 3DOUA 3KQOA 4HGZA 2OXTA 3TM4A 3REOA 4OQEA 3FRIA 2B3TA 3FUWA 5GIPE 3H2BA 3LBYA 2BR5A 1NW5A 2I6GA 2A14A 3M6VA 5EG5A 4E32A 4RTLA 3ER8A 3UFBA 3KQQA 4DMGA 3FTDA 4RTSA 5C9ZA 4FSDA 3SX0A 3EVCA 4AZWA 3DXXA 5CVVA 1V39A 2QYOA 4GUAA 4LWOA 3E23A 1L3CA 1WXXA 3GRUA 5DM4A 4A6DA 3HEMA 1NW7A 4DZRA 2XBMA 5K01A 1ORIA 1WZNA 2VDUE 3MQ2A 2O0LA 3GRVA 4PIPA 3LGAA 3KPVA 1TW3A 5M5BA 5BW5A 5K0NA 3DLCA 3FYCA 3G88A 1I9GA 2G70A 1UWVA 5HFJA 3EVAA 3ANXA 5EKXA 5P8WA 4GOOD 3SVZA 3DUWA 3CJRA 3FUXA 4FZVA 2IFTA 3LDUA 2Z6QA 3EVFA 1ZGJA 5K05A 4U7PB 4MIKA 2C7PA 1KR5A 3OE4A 2ZWVA 2YXEA 2IBSA 5KVAA 1KPIA 2CMHA 2NXNA 2ZTHA 3LSTA 3TLJA 5KQSA 3SR4A 5K0JA 3Q87B 3ERCA 1RJEA 4FT2A 1G8SA 3OZRA 1H1DA 4GOND 1XDZA 3AWIA 4G56A 2FCAA 3DP7A 5DX0A 4A6EA 2ZULA 3GRRA 4AZSA 1YB2A 1FPQA 3OU6A 5DLYA 1KXZA 2PBFA 4RTKA 3KQWA 3NJRA 1Q0SA 5K0BA 3FPJA 3ELYA 2AVDA 1L3BA 1X1AA 1I1NA 5CVUA 1NW8A 2ESRA 3M4XA 5DRYA 4AUKA 5BP7A 3NVMB 3PLAE 3FUUA 3A7DA 4YV2A 5HZMA 1G55A 1P1BA 1YUBA 3B89A 2CWWA 5DSTA 4DF3A 4MTLA 2WK1A 4X41A 3C3PA 4M7RA 1YFLA 1G60A 2XYVA 2HR1A 1D2GA 1EJ0A 2QY6A 5CCXA 3FPFA 1L9KA 1B42A 3SGLA 2AN4A 2QM3A 3B3JA 1PRYA 3UJBA 3OZSA 8MHTA 5F2NA 2NP6A 2N47A 2OZVA 3P9IA 4RVFA 5EIWA 4RTOA 5IKMA 2K4MA 1EJ6A 2XYRA 2ORED 3FPHA 3TKYA 2VP3A 1BHJA 2FRXA 1XCLA 4RVHA 2GAFA 1VBFA 3D2LA 3G2MA 3PX2A 3PX3A 3T7RA 1DUSA 3OFKA 2PKWA 3R6TA 5E9JA 2PLWA 3BWBA 3HNRA 5DX8A 2P3OA 2ZBQA 3FPEA 3THSA 5EZQA 2HV9A 4KDCA 5FCDA 4C05A 1VL5A 5EMLA 4ER6A 3Q7EA 2AZTA 1O9GA 2EG5A 2B2CA 3OU2A 2PT9A 4E70A 2PSSA 3V8VA 5E9WA 1HNNA 3EEOA 1NV9A 2V7EA 3CJTA 5EKUA 3GDHA 4EQZA 2ADMA 3E7PA 3G5LA 3LCCA 3UJ7A 4XUCA 1FBNA 4C07A 4RTQA 2PGXA 3I53A 5CUQA 3P9CA 4PIMA 3KPYA 1EG2A 5LQRA 3R0QA 2PXCA 5DT2A 3JWIA 5E1OA 5EMKA 1G6Q1 1SVUA 2O07A 2YXLA 4X60A 5CVDA 3R9XB 4GBED 5E1BA 1R00A 3GO4A 5D1HA 3FTEA 3KQYA 5EPEA 4YUVA 4PCAA 2IP2A 2FHPA 3P2IA 2AVNA 3MTIA 5GINE 3KQVA 4QQNA 3E8SA 3HTXA 1ORHA 1G38A 3KR9A 3C3YA 1VP9A 3OU7A 3G2OA 1QZZA 1M0EA 2G72A 2UYCA 4HTFB 3EGEA 4E2WA 3HVKA 4CXMA 5K03A 3G7UA 2ONYA 4GOMD 5E1MA 2B78A 3MCZA 4DQ0A 1KIAA 4OA5A 2OYRA 4BLVA 5DWQA 1AF7A 4MHTA 3ELWA 3MERA 2YUIA 3C0KA 2P7HA 2PX8A 4RWZA 5HIJA 3NVKI 3EEYA 2H1RA 1X1BA 4KRGA 3LHDA 3VSEA 1WS6A 2VS1A 3B5IA 4GQBA 4R8RA 2BM9A 4ER5A 5H02A 1JTEA 3UZUA 1YZHA 1NBIA 2AN5A 2ZIGA 3A7EA 3HCCA 2AR0A 3ME5A 3KU1A 2NP7A 1ZKDA 3TMAA 4P7JA 4PCLA 3R3HA 3LL7A 3PTAA 4RV9A 4JXJA 2UYOA 4R05A 2B25A 3VC1A 3BUSA 5GM1A 2VZ9A 4X61A 5EIFA 4C04A 5LQKA 2IPXA 5FHRA 5GOZA 2GB4A 3G2QA 4FSXA 5U4XA 3O31A 4XUDA 2C7OA 4HTFA 5HIMA 1QYRA 2P3QA 1NV8A 4WXHA 5LQCA 5FTWA 1P91A 5F2OA 1UFKA 2EJTA 2PX5A 3IV6A 1HMYA 4GEKA 4M36A 5EGSA 2G71A 3OCJA 5T67A 2KW5A 3O4FA 4IKPA 5KQRA 3AXTA 4RTJA 4PGGA 3EGIA 4PYNA 2JHCA 1N7IA 2B9EA 2OBFA 1DCTA 3TR6A 3FYDA 5EEHA 2GPYA 4OBXA 3KQTA 3BGIA 4E33A 2Z6AA 3TRKA 1YZ3A 5E2AA 2PVCA 4GC5A 4KWCA 5EHIA 4HSGA 3DLIA 2ZSUA 2Y1XA 2BM8A 3HP7A 3G8AA 2EJUA 3KQPA 3HCBA 1Q0TA 2EX4A 4C08A 2ZBRA 3KHKA 2I62A 3LPMA 5CM2Z 3I9FA 1IXKA 3AXSA 1PJZA 1XVAA 3CGGA 3CCFA 3DTNA 3ORHA 5EOVA 5K8VA 5LQNA 3HM2A 2PX4A 1OR8A 3GU3A 1R8XA 4ZTBA 4C06A 1L3IA 5GP1A 4DM3A 2YR0A 1SQGA 1JG2A 3LCVB 5K0EA 3KR2A 2GA9A 2ZLBA 3PB3A 3NWBA 4ATNA 1N2XA 1EQAA 5B1SA 4CKCA 1QAQA 5EC8A 1XCJA 5GM2A 3NDJA 5LR6A 4F84A 5ICEA 2DPMA 5JR3A 3SMQA 5DTMA 5FA8A 4P58A 4KVZA 4CTJA 4RTRA 4E30A 3T7TA 3GGDA 5CD1A 3GRZA 5EQJB 2Z6UA 2YVLA 3GWZA 4LWPA 3KPWA 4QDKA 3TOSA 1M6YA 4FS8A 3C6KA 3P97A 3GCZA 5KS2A 3MTEA 5E1DA 1F38A 1RI2A 1XDSA 3EVBA 3PVCA 2AOUB 2PWPA 3IHTA 3M6UA 4HC4A 3HCAA 1ZHFA 2JH8A 3MCTA 5EHGA 2V74B 3UJAA 2AOXA 2ZIEA 2BZGA 1NW6A 3FUVA 5K0CA 3TFWA 1IY9A 1NT2A 2P35A 3DMGA 1FP2A 2F8LA 4B17A 4Z2YA 1QANA 3DR5A 4RX1A 4BP3A 1AV6A 4CWAA 4ISCA 1RI4A 4AX8A 3KQMA 3OPNA 5HOQA 4U7TB 5K09A 1FP1D 3QOWA 5EMMA 3TM5A 1SUIA 2ZZMA 3BWMA 4DCGA 3EPPA 2P3LA 4PYMA 1DL5A 4E2YA 3TPZA 3HVJA 4FR0A 4WVLA 3UBTA 2VDWA 4P7KA 1SUSA 1AQIA 4KIGA 4PYJA 5HILA 4M37A 3ID6C 3OE5A 2PX2A 2AOUA 2XYQA
chains in the Genus database with same CATH superfamily
3UH0A 1U65A 4MR7B 3ROQA 4EECA 5A3SA 1QZUA 4QJIA 3ZHOA 3BX1A 3IEIA 4KIWA 3ZUGA 5M29A 2HW8A 3P0JA 3PGJA 1H2BA 1RMQA 2QEQA 3W5VA 4E31A 3EOBI 5D5HA 3BE5A 3OETA 3P9NA 3CVOA 2RBGA 4YRSA 3PHJA 4UNIA 3FVBA 4L9WA 4FYMA 2V4ZA 4KGZA 4XGIA 2Y6VA 3QOFA 1O6BA 1PT6A 3V3TA 4LK3A 2V3VA 4JGGA 3WSTA 5I8PA 2KHZA 3GFFA 2HF2A 4B8WA 4EJSB 1MPXA 2E21A 3BXOA 5IULC 3AZPA 2HR5A 3NHMA 4O8CA 1VIYA 3IHLA 5C2JB 5KX5F 3EXIB 2J0UB 4Q01A 1KOLA 3LCUA 4PZEA 4MJ3A 3EZUA 3JYPA 3IP9A 1RXYA 4MR7A 1QO0A 1NXPA 1RLMA 2DAPA 2E4AA 4Q7JB 5ALJA 5AW7A 2XIJA 5BV1A 3E9NA 4PX5A 3ZWMA 1FVOA 1FX0B 1CCWA 1M2OB 2A4KA 2XUJA 2YIVX 4DR4B 2ZJ0A 5E9QA 2AV6A 3OFJA 1P9RA 2RI1A 1GDHA 2Y1GA 3D43A 5K9ZA 3HO1A 2OBMA 3MQFA 1OFVA 2CMKA 2GFIA 1CZRA 1KYYA 1QF7A 2VA8A 1U7XA 1PJBA 1YKSA 4IXDA 2NQTA 2EBWA 2QLNA 3VXKA 3QLUC 3WMXA 3ZXIA 4EJSA 3QG5A 3DCIA 2BDUA 2QNRA 3TSOA 4U2DA 2J0UA 1YR3A 1QE0A 2JA1A 3EGDB 3RE7A 1LKOA 1QPBA 4EGSA 1V1MB 3KKLA 2OXFA 1HDOA 4TOGA 1U2EA 2IYSA 2KWIA 3R7NA 4BEVA 5CPBA 2WRZA 5F1PA 4ITWA 2HB6A 1JEAA 2HA3A 4WXYB 5ALIA 4E7OA 4UAUA 2NADA 3FGOA 1FX0A 5SYMA 1M2OA 3PDIB 2I03A 3V2IA 3DR3A 4IXNA 1NBOA 4RS4A 3LAWA 2PWZA 3O1JC 2Q7XA 3QE4A 5E95A 3CSSA 3GZJA 1GNRA 4MAFA 3JQGB 1LVGA 3PP8A 5KU7A 2XNSA 3MPUA 2XE6A 3HKEB 3RHFA 1PJSA 3TO5A 3A1NA 2Q9BA 3DO5A 1KFCB 4RH1A 1JMVA 1GEGA 1NNSA 3OHPA 1M74A 3R3JA 5FL7D 2PR2A 1JUDA 1ITZA 5LLSA 1FMLA 3ZEAA 5DM60 1P1IA 2Y4OA 1VPDA 3MTBA 1DKMA 1P6UA 5T3UA 1SXJC 4MVCA 3EGDA 5J8WA 4TVOA 2N3ZA 2CL6X 1V1MA 1XZNA 3IE2A 1H4VB 3KOZA 3BH7A 3V8NA 1ZG3A 3O4JA 3ZH9B 4M1YA 3JPYA 3NUQA 5IT4A 2AJCA 4Y6SA 3JD4A 4JQOA 4YC7A 1V1JA 1H1LB 2WFLB 3CZ5A 3OSUA 5AHOA 3PDIA 4ZAYA 3T8YA 3A0UA 5C0OE 5KVVA 5DNVA 3OURA 1DBVO 3WYFA 1P75A 3CXRA 3Q3IA 3QHAA 3VI3B 3QZUA 4QOHA 4FW9A 1IZ8A 1KK0A 5A4JA 4NI5A 3ZX5A 3JQGA 1E2HA 3SN6A 1YL6A 3DVRX 4MITA 5KEIA 4RM2A 1QQ5A 1WDLA 1Y3DE 2VI5A 4XCVA 5F4BA 1KKUA 4XUEA 4AM4A 3VNQA 5EJ6A 1R3DA 1YRYE 4ZU6X 2RI6A 4N6OA 5HHTA 4MUFA 4XJSA 3ONDA 2Y44A 4XD7A 1N2HA 4KMMA 2BW1A 2G4VA 5H70A 2PS3A 1BG6A 2X86A 4FVTA 1RPNA 4EBBA 1UP7A 2WU3A 4O1MA 5AJUA 4EMBA 3WXMA 4ZYUA 1I4WA 3GLGB 4W8GA 4YRKA 1LVHA 2WFLA 3CLRD 3CT6A 3NM5A 4IQ0A 5IN5A 4MV0A 4J0JA 5HKOA 1AZLA 3HMQA 1U7PA 1SKMA 3UTCA 1BCFA 5BQXA 4KRXA 5F98A 3JATB 2C7VA 1GCAA 4HUJA 2OZKA 3HDYA 2WAYA 1KYIA 1LI7A 1GGMA 1XVIA 1JLMA 4MGZR 3HV2A 4HBZA 4ER3A 3CZCA 1J2UA 3DC7A 3EVGA 3RH0A 1VC2A 4AD8A 3GVPA 3JARA 3ZKAA 5E2DA 1SHLA 3DHWC 4X91A 4ZQGA 3LBIA 2RHTA 1MOZA 3CR3C 1EIZA 4PLGA 5FUXA 1RLTA 2WPDD 4PONA 1QFXA 3RAFC 2IXBA 4KHPB 1KP9A 4A2CA 1CS0B 1CVLA 2ZRHA 1EX6A 2QK4A 1HURA 2I33A 3DKKA 1DAKA 3DAGA 4IDDA 3PPVA 3QU5A 5CPFA 4CMBA 4KBFA 3FHOA 2IEGA 1F0NA 4CZ2A 1KFEB 2C00A 3LDAA 4FE7A 3D6VA 5JEEA 1MRZA 3RBAA 1A8HA 2ZRCA 3LVQE 2A84A 4Z3OA 1O5IA 3RWOA 1N34B 5F7OA 3VR2A 2JHPA 1LI5A 2OZPA 2Y66A 1UP4A 1TU3A 1ZSVA 2Y1OA 2WZQA 5B1DA 3PEFA 3QE9Y 2J6IA 2QF9A 3C3MA 2GVNA 2P77A 1OUMA 3A32A 3LPAA 3NBYC 1Z8DA 3KEOA 2P2LA 3HB1A 2J0VA 3AFMA 4JKIA 5I9TA 4ZK6A 2GM5A 2RHHA 2ZJ1A 3EZYA 1PR4A 3PUXA 3NONA 4RPIA 1LPAB 1OU0A 3EPKA 5T4HA 2FG7C 4B6FA 2X77A 4YMTA 1TC2A 5ER9A 1YJQA 1Y5IA 3BD6A 3K2BA 3FJYA 4Q21A 4ZI3A 1I7QB 5JD5A 2VDVE 4LJSA 2W6ZA 1VE9A 3AI3A 4L73A 4OHOA 4F3RA 3IQIX 1T2CA 1X92A 1NBEA 2MSNA 3LVRE 4DDUA 2BZSA 3RVPA 1ZD4A 3RYTC 4EVEA 1J8DA 4WOPA 5DXJA 5FNVB 4ZVSA 4CKXA 1HORA 1OI7A 2AMFA 2LRHA 2I54A 1TZMA 2CN7A 4N8EA 1WY7A 5AO9A 2E6KA 2GWRA 4QTZA 5ECWA 4RK0A 4YCSA 3DMRA 3EVDA 3NCHA 1NVVQ 5CT5A 5IJZA 2WVAA 4C22A 5C3UA 4HK4A 1LRJA 3KQOA 4DQKA 5F21A 5I3CA 4CN9A 4GL2A 3KJXA 2WLSA 3L5OA 4M8IA 2H1CA 5AIBA 5DCUA 2JATA 4NMXB 4F2PA 3FUWA 3H83A 5I3ZA 1ABBA 3IDFA 4X85A 1G5PA 3TN7A 5AOCA 3FRSA 1YVUA 4NV3A 4Z0TA 4RTSA 5JI3E 2O5RA 3AKDA 3BIJA 3SX2A 3ZHRA 4Q00A 1CEXA 4XM2A 2POCA 1PX0A 3ZX4A 1BG7A 3QTTA 2LCQA 4L4YA 5AKKA 3UMMA 2BJWA 1NW7A 5FNVA 4LEIA 5HQTA 1B00A 4MWEA 3F34A 1U6IA 1ZI8A 2O0LA 3JVDA 4PIPA 2CLCX 1X8JA 4G5XA 5B55A 3WGGA 1EDDA 2GN9A 1Q16A 2R60A 1LDGA 1EA5A 1YQDA 1SMKA 3ANNA 4OFWA 3TH5A 5CDTA 2FDRA 2C3OA 5FFCA 2ZPAA 3GEPA 4PE5B 1RKQA 3B1KA 3DEJA 3F90A 5CX4A 4BFCA 4D0SA 3GARA 4QDUA 4UEKA 1UOEA 1T5BA 1G6KA 1N2JA 1YHYA 2NXNA 1Z5UA 3IHWA 1P6QA 1VCNA 4OXXA 1A71A 3WKCA 3ZLUA 4EG8A 1QHXA 1Q19A 1Y4DE 1TKAA 1B0AA 1QCYA 1Q7CA 2GCEA 1XRJA 2FUCA 1H1DA 2Q46A 3QKWA 4QLBA 4JC4A 2VHTA 5LMNB 4LFAB 2AC2A 1LJUA 2HK6A 5IJXA 4NMWA 3ZE0B 2A1TR 5DYIA 5BQOA 4Q4HB 4EA7A 1C0IA 1ZY2A 1NW4A 2EV9A 2IXGA 3QFFA 2GN2A 2GCGA 2GPAA 3HG7A 1XZPA 4G63A 1GRVA 1J00A 1DT5A 2FQQA 4L28A 5CEFA 3MRSA 2ESRA 5AW3A 1MOSA 4YAKA 3Q15C 1R0WA 5JARA 1YHNA 1T9AA 2Y0DA 5DI9A 4GOKA 2IE0A 4IHKA 4D98A 4FFOA 1KC3A 1NQAO 4CYAA 1DMRA 3C7TA 4HFMA 1QB7A 2FRDA 3RWMB 4ZJPA 3D8NA 3QX3A 3CEPB 1S89A 1KAGA 3DGEC 1ONSA 1EJ0A 1R0BA 2JHGA 3FLMA 1T3SA 3KEQA 4QHTA 5IAGA 4XR4A 4ENWA 2BWJA 1JU4A 1RTKA 2QM3A 2F1HA 4DNFA 1FLAA 5KSPA 4NICA 3R76A 1V95A 2V7QD 1NVFA 4OL9A 3SP1A 2K4MA 4TMKA 4CL0A 2Y3QA 4Q4HA 2FRXA 2RC5A 4OLFA 5B3AA 4B7ZA 1DUSA 1FMTA 4LVNA 3ZCVA 1NLUA 3LSYA 4L95C 4PC6A 1M2KA 1AMNA 4F12A 3SQMA 1HFJA 1OFGA 5EZQA 1CQPA 2ZUUA 3S2FA 3TEJA 3G2IA 1UC8A 4IIJB 2UZ1B 2Z8YM 1LVUA 3K73O 2OHGA 1Z6TA 2QL5A 1Z26A 4O33A 4TRNA 3V7UA 5FL7A 3HBFA 1ZK0A 3HVUA 5ARBA 1BS1A 4YJFA 1O9BA 3HCPA 4NYMQ 2ADMA 3G5LA 3N2LA 4UNSA 1P19A 1XVUA 2OHIA 1FRQA 5HX7A 3NUZA 4B76A 1XK7A 3I53A 2X0EA 4OGKA 3KPYA 3SKYA 4TQUS 5DT2A 4DCCA 3BREA 1C3OB 4RHCA 2FHAA 2JLUA 2F7NA 1HE8B 3UT0A 1EWQA 3WWCA 5D3QA 2YMPA 5EWJB 3CBQA 2WT8A 4DCPA 2CV0A 3A36A 2R8YA 4IUBS 2FHPA 3Q5DA 3HBNA 4ZGBA 2BELA 1FDRA 4YI5A 4Z8YA 4KPFC 2XLBA 3PGXA 3R7FA 3IR7A 5ALWA 3JZ9A 2XTNA 2G4HA 2G72A 1MTZA 5AW9A 2GEUA 5BSFA 5FPSA 4O4JF 2UZ1A 4CYBA 5E1MA 4BJ5A 2Q9AA 4JROA 2ZAYA 1L5OA 2C2KA 2HJWA 1TJ3A 3R8FA 1Y3IA 1A7UA 1CY4A 2YCLA 2WWTA 4OK3A 3BK1A 1WS6A 2YOHA 2WJGA 2WIGA 1YA4A 4B4OA 4LCBA 2VTKA 3AFGA 5E6RB 2AN5A 2AR0A 2EF1A 1DV2A 4KWIA 4NZYA 3BOSA 4FFVA 5EWJA 3S1AB 4CODB 4QT4A 4N0MA 3WK5A 3LM8A 4JASB 5K3DA 4F6CA 2H1SA 2W6ID 3DNPA 3KB6A 2CD9A 1MEJA 2QQFA 1AU9A 1YS7A 1E4YA 2H4XA 3C1UA 5L40A 2XPCA 2IPXA 3MBOA 3R9WA 5DKFA 4XKSA 3DMPA 3ZGZA 2MSEB 4QEZA 4YQEA 4DWJA 3O31A 5HIMA 5AHRA 1UBKS 1AXEA 4J2HA 2P9EA 5EJGA 5LQCA 4DUYB 2IZ0A 1XTKA 3CG0A 4E6KA 1BX0A 1VCIA 3IV6A 1HMYA 1GNVA 3ZWBA 3OCJA 1Z36A 3RROA 3EW9A 2PUGA 3WGIA 1RCTE 4BFYA 3GG2A 4PYNA 3EBLA 1EXNA 1NP7A 5CH3A 1DCTA 2WPDA 3QSYA 1A9XB 1GSIA 4M0LA 3AU8A 5E6RA 3TQRA 1YIAA 5FLKA 3S1AA 4KSCA 3T3OA 5E2AA 4CF6A 3D6NB 1XEXB 3H3FA 4J7CA 4UFOA 4ZQCB 1A8PA 5A4FS 3HGTA 1KR2A 1MN6A 1G64A 3G0IA 4RA9B 2AE1A 3EC1A 3ICCA 1GTSA 4RO0A 5ICMA 4N8SA 4TL9A 2C29D 1E59A 4Q4CA 2VP4A 1YZTA 2BGTA 2J45A 2OOKA 3OZUA 5D84A 4BAZA 3OOYA 3E3NA 4QZVA 3UTDA 1CNEA 1QVVA 2I8AA 1QRRA 2W6CX 3IHKA 4IDFA 2JB9A 4MK4A 4QE3A 5KQGA 1F6DA 2HHJA 4FILA 4CM6A 1E3EA 1OAOA 3T7CA 3J7AC 4N5HX 5K0EA 2V0GA 3ZOKA 3PB3A 3Q40A 4ATNA 1NPDA 1I0LA 3KTFA 1PUXA 1E9FA 2XBUA 2ZDHA 1JR2A 1OI3A 1QAQA 1JHZA 4OJTA 4Q3NA 4ZWNA 3E5HA 3G9UA 5GM2A 4BNWA 1A9XA 3A1DA 4QUEA 4F84A 2X7HA 4BYMA 3R2RA 4QIHA 4YP6A 4KVZA 1ISGA 3I01M 4HZIA 4BRZA 3ZU3A 1XEXA 1T8TA 3C5WP 2G7ZA 3L7AA 3PC7A 1E6WA 3Q8LA 3ADKA 4O5OA 4MV7A 2VZ8A 2CHGA 4RA9A 3U4AA 4YBZA 4W8OA 3WLIA 3HV0A 2Z57A 4LDZA 2QX7A 3GJZA 4KZPA 1I10A 3B7GA 3HXKA 3LUPA 3WAKA 1K1EA 3CWZA 4MVJE 1VJXA 1XEWX 4B43A 2FEPA 2VO1A 2FPLA 3K9WA 3EW7A 3ZWPA 1VLVA 5DHUA 2WWHA 4LYJA 2WSIA 3G5MA 3PC8C 4OHXA 5L4SA 2EBFX 1UKEA 2NTNA 3OZIA 4IOMA 4XWGA 4ZOBA 3U6KA 2TMKA 5GAJA 5F51A 2L82A 1MQAA 2NO5A 1TTPB 2XNDD 4HMQA 1RQPA 3GPLA 1LBHA 4QUHA 1P5FA 4RPKA 4AM8A 4JLSA 1EGVB 4JJAA 3RFVA 1MRNA 5EZ5A 1Q50A 2VOEA 4Z2AA 3N5KA 4W1RA 4OK5A 1FP1D 5GZ3A 5CXSA 1SUIA 3CFYA 3ENVA 4ZEXA 1DL5A 3WNCA 1I36A 4BMSA 1I51A 2HJ9A 3PFFA 4JP2A 2VNKA 2JJ1D 1S2OA 1O58A 3L05A 4LXHA 2A57A 2P11A 1JYFA 3LDHA 2AMVA 4QOJA 4US0R 1QQ6A 1Z88A 2V7TA 2X42A 4B7CA 2ZB8A 2FDCA 5DISB 1PS8A 2BR3A 1EE1A 1KQOA 2JLBA 2ZR9A 5KJ1A 3RSOA 1SKAA 2NPIA 1CB0A 3C16C 3R6WA 5HA5A 1PR9A 5LFAA 1CZLA 1TA9A 2HO4A 1G3RA 2CYBA 1F6WA 2AXQA 3L8YA 5B7GA 1TK2A 4WLFA 4ZP1A 5EJ5A 3BB3A 1BOOA 3ETCA 3LRXA 1B43A 1V47A 5K3EA 5C1PA 2D13A 1B4DA 1YH3A 4H15A 4KR2A 2E37A 4PBRA 1FTWA 4GDMA 4I08A 3SM3A 2G5GX 2HIHA 1CD5A 1U8ZA 1AUPA 1CJCA 3LC0A 4GM0A 4LNHA 3SJCA 3TTSA 3WB2A 2EVWX 4NZOA 1VBNA 3N2EA 1SCUB 4IYRA 4LOHA 1DAEA 4GMKA 1ZIXA 5D3KA 1WMBA 2P9YA 2RGCA 3T4EA 2YV5A 4C2UA 3D8RA 4OX9B 4AI6A 4DSUA 1Z4MA 3L1KA 3LVFO 2WC1A 2HDHA 3ROKA 3OM9A 1GNLA 5GWXA 2J3JA 4H59A 1O6CA 1U2RA 2B30A 1IATA 2C98A 3LUBA 3LY8A 2FSGA 3FPGA 4BU0A 2DYKA 4EBFA 4KV9A 1SD1A 4F7WA 2C96A 4MP3A 5CW2A 4GQIA 2B7CA 3AJOA 1QVAA 1FB5A 2V7QA 3EUAA 1BNCA 4JJ7A 4E22A 2AZMA 1XZAA 1EWKA 3Q4GA 3C8UA 3HDVA 1FFWA 3KLBA 3ZY2A 4MYCA 5FR1A 1NMYA 1X7DA 4LZOA 4YKHA 2NAFA 5FBQB 3B70A 4QSMA 5CM8B 1H96A 3TQFA 3X1KA 1SCUA 1DEAA 1SHKA 3ET5A 1S7CA 4OHCA 1XTTA 2NO1A 4C87A 4LF6B 3FPCA 4AWBA 3IJRA 3DOFA 1O9IA 4BO3A 1DPFA 4DWWA 9LDTA 2JS7A 5AUNB 1EVLA 3OMXA 4YQYA 4KXNA 4QJ5A 4R2HA 5AWFC 5B1IA 2YXPX 1QTRA 1I9CA 1TQ8A 1FL9A 3K35A 4M0KA 4PC3A 2QRHA 1EFTA 4HNGA 1TDJA 4QQKA 4ZALA 3TFQA 3W9SA 3WDSA 4Q7KA 2WPNA 4NEGA 4C7MA 4EYEA 4MW9A 4YUXA 3TRFA 1E7YA 4G37A 2HMWA 2WWXB 2P2YA 1O6GA 5HU6D 2B36A 3P2OA 3FRJA 5DYWA 5CBPA 1CJKC 4U6SA 4BV2A 1Q91A 4GPEA 1OXTA 2TSYB 1ZBDA 2GVZC 2DHEA 3NKLA 4RSGA 1LZKA 5JLAA 4GD3Q 1W85A 4YCBA 5HYVA 4AY5A 1T5DX 4IFTA 2J9GA 5ECGC 2NVWA 3ZK9A 3K53A 5JRZA 2Y0CA 2ZB2A 3HWWA 1KI8A 3F6BX 2A59A 4EG6A 3ZDEA 2V7VA 4RXMA 3K70D 1BSVA 2X13A 4KG7A 3R44A 1OWLA 7REQB 3VPDA 4YUYA 4GOJA 4OBEA 5GOUA 2XTAA 1KYWA 4ZZIA 5K8IA 1ML4A 5HSGA 4YREA 2QX4A 5FYQA 2UUPA 4HPWA 4Q4LA 4TXNA 3UHOA 4YMVA 3VJRA 4ACAA 5FV4A 4UOEA 2BMJA 2V55B 1W75A 2HHCA 2I78A 4JITA 2C4MA 3UMCA 2CFOA 2GJAA 1QYWA 2WWXA 2WZCA 3FTCA 3UGKA 4RACA 3EZNA 3CPEA 4MVXA 5ELLA 221PA 4C20A 1UDCA 4TTIA 1HGXA 4V0NA 4IS3A 2H4HA 2IB0A 1O54A 1J8YF 1NN5A 1V96A 1XU7A 3DZFA 3PC3A 3S1LA 2W6IA 5KQPA 3V2HA 5F23A 5IYZB 4QFDA 1C9YA 3T99A 1QDLB 4KQ2A 2XWQA 2EQAA 3EDMA 3H2JA 3UOWA 2C2JA 2WP8J 4K88A 2Z2XA 3NHBA 5MFPA 3PGMA 7REQA 3EE6A 4OXIA 1ZESA 1E4VA 3GC6A 4RGBA 4RVSA 3QE2A 4J1NA 1BDJA 5CB4F 3R6GA 4HATA 1WU7A 3PHCA 2HREA 4HEQA 3CEJA 3QEAZ 2GHIA 2C2UA 4GW3A 5KNLA 1TO2E 3H1PA 4YMSA 4KR0A 2HRQA 2G5TA 4TQAA 5EPUA 3VI4B 4E2FA 3K0KA 2ORVA 2FVXA 4FJ1A 1AKQA 1OBVA 4AK9A 1MJGM 3IDAA 1U3FA 1L5NA 1H2WA 2PH5A 4GKVA 4M8KA 4YRTA 3RYFB 1KPHA 1G3MA 1MIOB 3I9LA 3D6MA 4H0CA 3SHQA 4LTDA 3FTNA 4U7FA 1L5FA 1VLMA 1ZCBA 2X14A 1FTGA 3A2LA 1PFYA 1Z2EA 4MUYA 4N1AA 5EIOA 4PLTA 4LDJA 4D99A 4AG6A 4XH9B 4MCHA 4L15A 3C5HA 4M38A 4MCIA 3DL7A 4EA8A 4JJ6A 2OYSA 2QG6A 3AIMA 3NKFA 4I46A 5HS6A 2VWPA 2NXEA 3BVKA 1C7QA 3IS3A 3LY9A 3IP5A 4DSNA 2PD4A 1NULA 3AVOA 3FR8A 1C4OA 2H1OA 1US8B 2ZJZA 3HN6A 2QD1A 3L5KA 1O0SA 1SUWA 1V11B 1B7GO 3R0JA 4KODA 3SFTA 2JHAA 5GADl 3LP6A 4H18A 1HR0B 2PWYA 1T5OA 4PG6A 1A77A 1X7GA 1Z6YA 2W71A 3NC0C 4CIDA 4F92B 3GFQA 3RYFA 5INTA 1MIOA 1SVKA 2OY0A 2PFKA 1O89A 3AF2A 3P2YA 4O29A 5D2CA 4ND1A 4B2LA 5J2TF 3MB8A 4MW5A 4CETA 4BNHA 3K94A 3LHFA 1CW2B 2I1WA 2F3UA 1CY1A 2J85A 1G8PA 1JG3A 2N75A 1SU7A 2EBHX 3DXZA 1E98A 2Q07A 3OFNA 3OTGA 3ZUPA 1UK8A 3RUCA 2UUAB 5KZMB 1IOLA 1P0IA 1TJ5A 3UCXA 3CPSA 4ZEVA 1I3MA 3QPBA 2WYWA 4Q03A 4RJJA 1JI3A 3E82A 2JGEA 2QY9A 3PA6A 4WCFC 4KH1A 5TJ9A 1FYXA 2NO9A 4W5OA 4G85A 1HEYA 5BN3A 1US8A 2GETA 1KO5A 3N75A 3KKZA 1KYZA 3IBGA 1J22A 2XNDA 3UAZA 2AX4A 3WVWA 1ZN8A 4HOYA 3U2QA 4AF7A 4WJLA 4AJNA 3NTUA 1XI2A 3OZTA 1TUBA 1RYNA 3HZRA 4UMFA 1ZMXA 4AKHA 4BLUA 4YXJA 1TEHA 2KBFA 2CJYA 1I5OA 3K6RA 1N2CE 3Q41A 1TCCA 1U8AA 4GF5A 1J8FA 2UVQA 2P5TB 2G17A 3PXCX 4E5PA 1XCGB 2HT6A 1YD7A 5AVKA 2R79A 4E4YA 1YVPA 4KBGA 1IMOA 2KLHA 3LYAA 4Z7OB 5AI8A 1N6RA 2JJ1A 1GZSA 2X8AA 3NPAA 4FE4A 1SY7A 1T8YA 1VE5A 1E6MA 4J3FA 4PIVA 3ZWVA 3GUYA 4E32A 2XZOA 4DBZA 3VOSA 1L8IA 1L5QA 2YY6A 1NF9A 2P5UA 1SRQA 2WJIA 4PZAA 4G86A 4D4IA 4Q12A 4CKCB 2QQYA 2CN6A 4RA6B 5M3BA 3T9BA 3ONFA 3GGGA 3VU0A 3DMTA 4M33A 1RM0A 5EZYB 3RRXA 5LKRA 2Z0MA 1M83A 4C2AA 3GPBA 4WFKA 1Z3IX 3PX7A 2QL7A 3NIFB 4FZVA 4FQ8A 1A9YA 1FW6A 2WM9B 3VNXA 3WBFA 1XLTC 3J81A 3JQEA 2PGJA 3B6ZA 4BNMA 2WKQA 3BL6A 5FX2A 2FUEA 1W2GA 3N2NA 3ZQJA 1YFKA 3Q87B 2B3DA 4BGUA 2DBYA 1RJEA 1SRRA 4QRDA 4HQRA 1WZCA 1XTBA 3T3EA 2YINC 3GRRA 3O1IC 1SC9A 3OTWA 3Q6NA 4RA6A 1P8JA 5DLYA 5L3ZA 8LDHA 4HDQB 3ZI0A 1XZ1A 3KQWA 4CG3A 1PU2A 2V2IA 4MV3A 4U7JA 2GBIA 5EZYA 1X1AA 3OJOA 1ULHA 2AN1A 2C3YA 4WADA 4DYDA 3RAGA 3UV6A 3TZ6A 2V3CC 3AYXB 4LW8A 5TGTA 5HZMA 2YCBA 1AH2A 2Q99A 2FN4A 3EZ9A 3PC6A 4H7DA 3MT9A 3LTEA 3B5JA 4TZTA 5HJ5A 2OT3B 4ENPA 1UPBA 4FPXA 3U3XA 5B36A 2V3WA 4Y9DA 1ADCA 1TQ4A 5HJFA 4FMBB 3QZ3A 3C1YA 1TJPB 2OD9A 3LT1A 3PFCA 3VAYA 3BD7A 1U2SA 1YDHA 4DLNA 1W5BA 3LXUX 1PL7A 3AR5A 4CL8A 2G0NA 2XT6A 5E6SB 3FPHA 4K6FA 3QYFA 4F60A 1M9NA 4BKRA 3CNHA 3AVTA 1QIJA 1OBOA 1KRWA 3AF8X 3OFKA 3L92A 1V26A 1MJ5A 3U4CA 3FFTA 2QRGA 4BLOA 1ZI6A 1AB6A 1ESDA 2GD0A 1OY1A 4TWJA 2Q5CA 2H5JA 3H17A 3K9QO 4KDCA 4BFLA 5CBPB 1ST2A 1NXTA 4H7JA 4TWAA 3DDWA 4CNQA 3N05A 2B2CA 4P9NA 3UB2A 1VDMA 4PO3X 1PZXA 5IUJC 3ETJA 4JUAA 1FQKA 4HZUB 1YQXA 5K8TA 1CYEA 2DH6A 4LC1A 2MINB 1QIDA 2OOSA 1GGJA 4ERUA 3JW8A 2IZ1A 4JX9A 4XUCA 2RARA 2UVPB 3W90A 4UJ5A 3R0QA 2IT1A 2V98A 4ZHQB 3NV7A 4WJZA 4PLPA 1KE1A 5LNK6 2HK8A 2YXLA 1JDTA 1ISJA 1MX5A 3BB1A 3F47A 3AG5A 2H17A 4HXYA 4PYRA 1GADO 3F6RA 2X5NA 1UADA 5K4AA 3ZK7A 2DE0X 1VMDA 3LWBA 3MTIA 3ZKWB 3CX6A 2PPLA 5BUCA 3O8DA 1W87A 4UHEA 1T2FA 4ALIA 2OECA 4U2CA 3KYIB 1DARA 1SKBA 1IPFA 4O4LB 4UE3S 5H83A 2WHPB 4GMFA 1G5QA 3P9QA 5AQ1A 3HVKA 3U62A 2H51A 2MR5A 4QU9A 2RGDA 1FUKA 2JIRA 3MNFA 4R1LA 4URZR 4RAOA 3T52A 4FWIB 3WGNA 4N3NA 4AJJA 2ZI6A 3RUHA 4BLVA 1AF7A 4MHTA 1FXWA 3PRJA 4HZUA 4YGXB 1LLFA 1CJUC 3GG9A 6YASA 3NWJA 3OBBA 2MINA 3L7CA 5C7LO 5EQTA 1CV2A 1B0PA 1WLSA 3BL5A 3C98A 3N76A 3LHDA 3UG6A 2H18A 4BMPB 5KYVA 3E81A 1GPDG 1YGPA 2OMKA 4YIKA 3RUPA 3VR4D 4ZHQA 4F91B 3IVMA 3VDQA 2XYPA 2H9IA 1CRZA 3FA2A 5I9LA 2QMYA 3G9QA 4WBSA 3OIYA 5LXTB 2QAIA 1TM4E 1ZVJA 2IXAA 3HKDB 5IKXA 3QMVA 5JD6A 2OO5C 4HB4A 4RIIA 1EE9A 3O84A 5CK5A 3LK7A 4O4LA 1JECA 1U9IA 3JS5A 2WHPA 3RT7A 4C06A 2NU6B 2A67A 1PT8A 1QHNA 3WIEA 5FTWA 3TPFA 1P91A 1D0SA 1EDEA 2EJCA 1Q57A 5B58T 5AFSA 1T25A 5JV5A 3PUZA 1EGHA 3FBTA 3EASA 3RGDA 2CVQA 4ZI5A 1YAJA 4TLCA 4TYPA 4UUAA 3W9UA 5JISA 4PZ0A 4N3AA 3TGWA 1A69A 2NVUB 1TE2A 3HJAA 4P4TA 4CMAA 1TQ2A 3KQTA 2FMHA 3DT8A 2R1TB 1KMMA 4C2TA 5LXTA 3ZD7A 3N7TA 5EXPA 3I2YX 3ZQUA 3HKDA 4I4LA 3ZWXA 5F3WB 3A9TA 5C80A 1WXGA 2EJUA 4V0LA 3URMA 1LCIA 4ALNA 1QH0A 3P9XA 1Z7GA 3NHLA 1MU0A 2HQSA 2NU6A 1XWIA 3KD2A 5IWCA 1TTTA 3UH1A 2ZIAA 3VOBA 1Z06A 1HI9A 4DVJA 1Z2DA 1BZYA 1JFVA 2IRWA 4CI9A 1V2GA 2BTEA 3PEEA 2BAGA 3E1JA 3LQKA 2Q45A 3G8CA 3H18A 3OSZA 3RG8A 2P1RA 3BVLA 4TVBA 1Q1QA 3DDNA 3WFZA 1JDBC 1GFZA 4MLPA 1JQKA 4R0MA 3PKJA 5LL6P 1Y5RA 4MUGA 2XB6A 1ZDMA 3A6ZA 1LSOA 2GJ9A 4S0ZA 2R1TA 3ZH2A 1ZJWA 1ZK1A 4G89A 2A86A 3N5CA 3AERB 2C0PA 3Q7RA 4KPUB 4XDHA 3ABOB 1IY1A 1BVUA 1V6SA 1Y63A 1Z0FA 3KZKA 1YRQA 1D6JA 2QNIA 1W25A 1ECFA 1FNBA 3GGDA 4LV5B 4PO1A 3RF6A 4ARBA 1OQAA 1GPH1 1GR1A 5CD1A 2EJVA 4LOLA 4WUVA 5JHHB 4L5AA 3TB4A 1G8YA 3OM8A 2F1RA 5JCOA 1YBAA 2PO5A 3QEOA 4QJ4A 4QSHA 4OQLA 1HDRA 3OQJA 1XN1A 1ZVMA 1R0ZA 2J9XB 4YAIA 3C6QA 3INRA 1GZ6A 1X15A 3NOVA 4MV6A 5J2UF 2XCRB 2ZIEA 1MT3A 3DG9A 4MW6A 4OMCA 4II4B 1TAGA 2I6QA 3TINA 4JUCA 3Q9UA 4OMFG 4P93A 4Z2YA 1EXWA 3VJKA 4JFAA 2QRZA 3QUQA 3E1OA 2R25B 3PUWA 1AF4A 4C01A 6Q21A 3EQ8A 4A8HA 1GGEA 3ILHA 1ZN2A 4KPUA 3L49A 4LCEA 5HOQA 2R65A 3PQ5A 3OJCA 2YFHA 4MV1A 5T5QA 4F6RA 4YUAA 4KQMA 2ZUTA 3RUEA 2NV2B 5IM4F 2ID7A 1KY5A 3HBAA 3FNHA 3G7SA 1GAEO 1PWEA 2VEOA 3A9RA 4IL5A 4YRJA 3TPZA 1HDEA 1KAHA 1SUSA 3I2FA 2VRCD 1Z7BA 1M2FA 2DWQA 2GEVA 1C0EA 4HGQA 4PYJA 5BUZA 4F4IA 2GDJA 4Z4CA 4P4LA 3JZDA 4UQOA 4DYVA 3DEFA 3P5SA 3T4PA 3ZCQA 2CHIA 2QMEA 4II4A 3P9RA 3QOXA 1NY6A 2YICA 1W44A 1GUZA 2YZ2A 4XASA 4PG7A 4OQ4A 1TIBA 3G5AA 4E13A 3EBOA 3D19A 3IIKA 4R5MA 4JR1A 4REMA 4R98A 3NRJA 4H6WA 3H86A 3QJ5A 1X3LA 2VAMA 3U19A 5TGDA 3JAKB 4GLOA 1YZKA 4DT1B 2I6XA 4WW0A 2GK4A 1JVBA 4D92A 4DR5B 1LB1B 1V37A 4OJNA 4NPCA 1AUVA 3ITDA 1U0LA 3HRIA 3UN1A 4ZO7A 3P0FA 2J6BA 2VXCA 4A3SA 2DHDA 1T2DA 2WJZB 1HNXB 2ATIA 1X1TA 3I64A 3D5TA 4HHEA 4EG1A 4LBZA 5LDDC 5JDIC 6ADHA 1DKQA 2GTPA 3HR4A 1FDVA 3PHBE 3TQHA 3PXXA 2WQ6A 4QM6A 5IH3A 1UPTA 2Q1WA 1MVOA 4JEHA 2J32A 2HCFA 4L08A 1SFRA 4I5EA 4CG2A 3ETDA 3ICQB 2NLOA 3LQQA 4K03A 2FA9A 1K8ZB 3JAKA 1N2GA 2IYEA 3F7MA 4M0EA 2Z3VA 4KUHA 4DT1A 1TT7A 2KJQA 4QDJA 4XWTA 3D8BA 3RAPR 3FETA 4HMPA 3F6PA 1HKUA 5B1YA 4U63A 3PDUA 3CX4A 3GLUA 1RXVA 2VRBA 4KZKA 2H07A 1DXOA 4A1OA 5B5SA 4HDRB 4CCSA 3OQBA 1DTWB 4XRRA 2PGLA 4NBKA 3T12A 4B3HA 1U2PA 5EYPB 2G4LA 5EWMB 4BNJA 2PUDA 1ZEMA 2V2MA 5E8RA 4RTNA 1RE1A 2GARA 1ECPA 2GLUA 2ZBUA 3C8HA 1T4BA 1M34B 1N1DA 1C9DB 3K1YA 2AQIA 4E14A 4GYJA 3WX0A 3BA1A 4PRKA 4D9GA 4MJXA 5I9MA 4EG5A 4OHFA 5IJ0B 3KQLA 1N9KA 1UXHA 1JJIA 3Q7SA 2A1IA 3FMOB 4P7BA 4F5WA 3WYCA 2IYVA 3AU9A 3QLVC 1EJ2A 1F7VA 1THMA 3PD1A 2WWGA 3KEFA 3G2HA 1AURA 3SE7A 3PNPA 4IXWA 4LJKA 1Z7WA 1VPVA 3OE7D 4A6XA 3OJXA 2H4WA 3EF3A 2GOYA 3MAGA 4HDRA 4MYRA 4BMVA 2ZJ5A 3ENQA 1J21A 1U8XX 4PGHA 3V5NA 2FWBA 5EYPA 5EWMA 3AR4A 2LVBA 4Q1BA 4D3FA 4QVGA 3CG4A 2EL7A 3HJGA 2I55A 2R5FA 1M34A 2R84A 2O8NA 1JIXA 3GDGA 4AIIA 1IPHA 2FGJA 4BO5A 5C1IA 2FLKA 1P80A 4L0MA 1OH8A 3L0SA 1OU4A 2JJQA 4IFIA 4M9UA 3NXSA 4O6VA 3SOPA 3FFAA 3F3MA 4X8MA 1BXGB 5IJ0A 1DRVA 1LFDB 1YI1A 4EDHA 2GJ4A 3GCWA 5F2KA 4DMFA 1JBEA 3EMVA 3OZVA 1RCGA 1LA2A 3EIHA 3BWXA 3RVNA 2DUJA 2R7AA 3SQWA 5FBZA 3OIGA 5JSFA 5IARA 1I2MA 5CLFA 2I6UA 1A8SA 3RC7A 1R15A 1E6LA 3TNYA 4XYBA 1WM1A 1E7WA 3HBMA 4K8RB 3KRTA 4LJ6A 3STYA 2MSWA 4N6GA 4UVGA 5E8JA 5KYYB 3G2NA 4L0DA 2OAQ1 3RJTA 2BTOA 3L40A 5DBFA 4OP1A 2IUTA 3B9RA 4WWHA 1W46A 3P71T 5DGDA 1VXRA 2L2QA 1Q5PA 3P8ZA 1OXVA 4IIGA 2OWDA 4PHHA 5AOAA 1VJCA 3C14C 5E0KB 3UMFA 4KO8A 2JH9A 2PJDA 4P80A 2ZJ3A 5FJIA 5JNLA 5LP6F 4OK6A 1OLUB 1BXGA 1Z9BA 3BDVA 4N18A 1OE0A 4F5DA 2PYDA 3HA5A 1WXWA 4RSMA 4BQNA 3MM4A 2QWXA 4PTLA 1QYCA 4YAFA 3L6CA 1FQWA 2G76A 5CFQA 5J59A 1WW3A 2DUNA 1J0AA 3LDGA 3K31A 3BHJA 4M1KA 1N2EA 1VB3A 4F86A 5C1OA 3CPJB 2CL5A 1BJRE 1YZFA 5CCBA 3COJA 1EG7A 2ZITA 1Q2UA 3QPCA 3OCWA 2ZZKA 5CTAA 3RADC 5FWNA 2BH2A 4P34A 1UBTS 4REUA 5KYYA 1DKRA 1JR3E 1K75A 3G8YA 1B73A 4DUZB 3ZVMA 1SWVA 2B4TO 4JK3A 1MC5A 2FUNB 4FGKA 1UKVY 1M1NB 2C92A 3A4IA 1G7CA 3BJIC 4LXIA 3O7RA 2IDKA 3M82A 4RHUA 4PG8A 3CR7A 1JXAA 3S8YA 3ZBTA 4M76B 1OLUA 1UMNA 5TGZA 2HEIA 3IR5A 4ZKWA 2QSUA 421PA 5T6BA 4DEVA 1M1XB 2NYRA 3MC1A 3M5CA 5DYGA 2XUGA 4UFPA 1DWUA 4XJTA 2DETA 3DBLB 2DM6A 2OB2A 3K4PA 3TEFA 3HP1A 3WMEA 4EP1A 3IQEA 2X4GA 4ZAFA 3UMVA 5TMDA 1LLDA 1DC7A 2JLAA 3E61A 2R00C 3P2KA 1NI5A 1RYBA 1TKRA 1SVLA 3AI1A 3JVIA 3LFTA 3Q1LA 3QY9A 1U8TA 4RD2A 4PGIA 4YP9A 5LBUA 4C5AA 1SCBA 4HQ6A 5G0TA 5JNVA 3AEXA 3H42B 1K8RA 2ZI3A 3KFLA 3N0VA 4JQSA 1CNFA 1GQ2A 2BMWA 4R9SA 2W0SA 2HD4A 4RNDB 3CVUA 2IH5A 3OJLA 2QD5A 4LXQA 1K66A 1MV5A 3T35A 1C0LA 1WABA 3N53A 2JI6A 2SICE 2WFMA 1HDZA 2HRZA 3D3QA 3HRHA 4R2WA 2XJOA 1FYDA 3AG6A 3HZOA 3ZGLA 4Z49A 3QVUA 1BXKA 2AUNA 3WDMA 1DLJA 3AKYA 1CFJA 3BH0A 3FVQA 3K0BA 4Z1MA 5REQB 3RIMA 3DBLA 1H5NA 4KMRA 1MT0A 3I73A 2X5KO 1ZNZA 3R0ZA 1E79D 4G01B 2BHRA 4A8TA 5DNEA 3VVMA 3RSSA 1VXOA 1BFDA 3EVNA 4IRUB 1VQ1A 1MCZA 1KK3A 3B3AA 3V9AA 3KT3A 3F5DA 5JZ9A 2ZBDA 3SI7A 4OQDA 4YMIA 4BCDA 3DOUA 5G0UA 4DRXA 3GN2A 1P9OA 3KXUA 3MWGA 1RU3A 2EQ5A 5DMHA 2EX0A 4C0JA 3AHEA 3PPYA 3EQ2A 1L5MA 2B1QA 1NW5A 2VRCA 3G0CA 4G5QA 5G1NA 1DKUA 1W5FA 4KUEA 3W6OA 4AQYB 1I6LA 1NAIA 3FTDA 5LZ7A 2OGWA 5JCPA 1Z6ZA 2YDXA 3VV9A 4K9KA 3R1IA 1W4RA 2O2GA 3RJMA 5D8PA 1RDFA 3KJFA 1PZMA 4GBJA 5REQA 2QRPA 2ZCUA 1P4HA 3D6HA 4NU5A 1MEOA 4IIEA 2YN2A 1SXJD 4ID9A 4YA6A 1XZGA 5DE3A 2ZYUX 1ACLA 2BEVB 3BC1A 1X77A 3H2HA 4G0NA 4YYZA 1J5PA 2IQ5A 4ZOLF 5BSTA 3EEFA 4CVTA 4YACA 4EHLA 8OHMA 3DBOB 1C29B 2YXBA 2K7ZA 1PHRA 3OPXA 3PYLA 4PWZA 3K2EA 2HQRA 2JFQA 5A6SB 4ZT2A 3AQIA 4DMRA 4YR7A 1KR5A 3QA9A 2EHDA 2OFWA 4NZ9A 1TUGA 3FZYA 3VR5H 1A8QA 1TJOA 2PUWA 3GRFA 4D9BA 4IUCS 1I2DA 1G16A 5K45A 1LK0A 2DTXA 3ERCA 3KQKA 3OZRA 4JT9A 4CM9D 1HDGO 1WWKA 3WI7A 5TF4A 3AWIA 1HFWA 1Z62A 3VDRA 4EHDA 4N48A 3I2GA 1PDOA 1EGQA 2HDWA 1DE0A 4A6EA 4AZSA 4YCNA 3HJHA 1KXZA 1VL8A 2GCPA 1WSAA 3SZOA 2QMOA 3FZEA 2W11A 3QKRB 2BEVA 4ID3A 4LVCA 1ZNXA 2AVDA 2QENA 1DHTA 3UB4A 3G82C 4RPGA 5JADA 2R6AA 1WAMA 3PLAE 4MGIR 1ZU5A 1D2AA 3A7DA 4EMTA 2H54A 1E8NA 3MK31 4X45A 5CB0A 3BIOA 2BTQB 3ZQ6A 5A6SA 4LRTB 1VCHA 2QLLA 3WLSA 4C3OB 2HOQA 2XODA 5KX5B 4NL4H 3UVEA 1ILWA 1F0KA 4DLZA 1RWWA 2HA7A 4HJXA 3CUEF 4WTOA 3DTTA 4X6UA 5A06A 3ONVA 1RYEA 1LF0A 2VJPA 3MLAA 4G6ZA 4HBGA 4GVLA 4IDOA 5K3AA 4EB3A 5A5FA 2W8BB 1TCBA 5FYDA 2RGAA 2CE2X 5BMVB 2Q4EA 2OQRA 4WOJA 3SIDA 2VYQA 5TVGA 2O2DA 5IKMA 4D3ZA 2QTFA 2QOEA 3GF4A 4M0MA 3E7WA 2FF5A 4LMPA 1X3SA 2O3QA 5K1ZA 1NP3A 3D2LA 3QKRA 2JPDA 1ZOPA 3FB1A 5U9CA 2XQKA 3BWBA 4QXOA 1I13A 4ENQA 1P7PA 1O7JA 2CWLA 2Z5RA 1TI7A 2QN9A 3CB4A 2A0UA 5EMNA 2ZRQA 2BTQA 3K8YA 3WKAA 1J20A 2UZAA 1S3SA 3QJYA 5KX5A 1G21B 3AHJA 1O5OA 2Z5GA 2IYZA 1RMYA 1YT5A 4X5OA 4W9NC 1LC3A 4JMLA 1OZFA 4X6LA 2Z9DA 2W8BA 3FKSD 3OCVA 1LTQA 3JWPA 3P9CA 1RCDA 1UC5B 1RWXA 2WV7A 2XMDA 3HS3A 3IJ5A 1EDZA 3GJRA 4JQYA 1E89A 3Q3VA 3VTFA 3WB0A 3RAEC 2O2EA 5CVDA 4LDPA 3BORA 1NUTA 4GBED 5JS2A 1QPZA 4RDCA 1CY8A 2OG2A 2XDYA 4EW2A 3S40A 1UDRA 1GA1A 5B30A 3ZHXA 3RJ9A 4LGYA 1BD4A 1J39A 1XKQA 2V15A 2V0NA 4CVRA 4B3FX 3HTXA 3WA6A 2BGWA 2MDTA 4HTFB 2M6SA 4OB6A 1PJ8A 1Q6ZA 2J0SA 4MUMA 1G21A 2B78A 3KWJA 4ETIA 4RLHA 3FYUB 1P1HA 3W1EA 2JEYA 3T7EA 1YU6A 1KKLA 1BU5A 3OOJA 3NVKI 1G5IA 5HZKA 1MC4A 4GO1A 4NDNE 3EEYA 3K3PA 3VR5A 3WB1A 4Z8XA 3B5IA 4HI0E 4R8RA 1S0UA 3AJEA 2BCEA 3OOSA 2ATVA 3PI6A 5DO9A 1DO2A 4BYGA 4ETNA 1DIAA 1R8QA 5IEBA 2PLRA 1V45E 1XPRA 2QM7A 2J5RA 3PVYB 2J59A 5K99A 4LXUA 2PV7A 4YCMA 3K6SB 3D7NA 1PQUA 3W4JA 4CCYB 2R66A 4LQJA 1SZPA 4XLLA 2W22A 5DHFA 3NS7A 3AGQA 2JEOA 3BHIA 2NVBA 1CKEA 3B2NA 4ACBA 2Z3ZA 2VNSA 3OZEA 4B35A 5L3VA 1UPUA 3FPKA 5CEJA 2W2NA 4HTFA 1QYRA 1ZLYA 2GBPA 2HJRA 3ROFA 3L4BC 3SZUA 1Y89A 2JD2A 1U3WA 3W7BA 3WKBA 3FYUA 1LSSA 3GT4A 2COKA 4UBLA 1PZFA 2WHRA 4GWGA 4J2TA 1T36B 3ZE2B 3OEHD 1U9ZA 2CLMB 3ZWDA 1DUIA 4NAVA 3LQRA 4Y9UA 4V0SA 2L19A 3V00A 1NSFA 3GUVA 1ISSA 1OXMA 1Z6PA 3H9GA 2Z6AA 2PCLA 5LUAA 4AKIA 4EVDA 1Z83A 4FNOA 2A5FA 4IIVA 3WHKA 2HLNA 2ERYA 3ZXUB 1F20A 3L7LA 2ALJA 4QHSA 2Y1XA 4FDMA 1F33A 4NE7A 4U2KA 2XCQA 4B3XA 2H5EA 2W0MA 3D8HA 3HCBA 3NKVA 1IH8A 2PFGA 4WK0B 4BWYA 3KELA 1QGED 5CFLA 3NT4A 5IN4A 2R44A 4D82A 3RRMA 2WTBA 5LQNA 2WUGA 4Q4AB 5E7MA 4K7JA 3HB4X 2ZS9A 1USWA 3I2JA 2GK3A 2MR6A 3F7NA 3IBCA 3IP7A 5EXTA 3U13A 4Y2XA 3ZLTA 2VNAA 4B71A 2IKSA 2CFIA 3GLHB 4N6NA 4TTRA 1T36A 4E1AA 2AQHA 2JANA 1EQAA 2OCAA 3GVHA 4Z1OA 1RJ9B 3ZHCA 4D8WA 1GG9A 1KU6A 2A9VA 1DBWA 2QN1A 3RASA 1DP4A 3CLSC 1GSOA 4EHKA 1EQUA 3T9DA 2O3RA 4CTJA 3BN3A 3H16A 3UY4A 3W8NA 4OQFA 4CQMD 2JCXA 2JFXA 1UBRS 3GRZA 4ZT4A 5KHAA 2WQZA 4WLNA 5TIIA 5H9WA 3QLUA 4KB5A 3GL9A 1JNYA 3PR3A 2QRUA 1DG1G 3HA2A 4PU0A 4Q4AA 1C1DB 1SXJB 5E1DA 2GAJA 4M9SA 3ZE9A 4HPXB 6REQB 3F74A 3AHFA 3INTA 3GEHA 3SHXA 1SC3A 3GLHA 2CLSA 1T2UA 3LPNA 4KLAA 3OVMA 1B8UA 3F1LA 4FFNA 4EB8A 2O8EA 2A3NA 3QQ5A 5LS9A 1RJ9A 1J9EA 3V8BA 5J4LA 4MI6A 1J70A 4ROSA 3TG2A 1AOXA 5HZGA 2PJRA 4LMBA 3DM9B 2I2DA 4DBLE 3LCJA 4P86A 2NYVA 3OQMA 3U3RA 4CWAA 1RI4A 1OCEA 5FIUA 3ZCUA 1FW8A 4LBYA 3WNVA 1M7GA 2Y27A 1QM5A 2HZ7A 4GM4A 2GLTA 4QBGB 5D00A 1UJ4A 4F4DA 2AW5A 1JDNA 4MMXB 5CB6A 3FSGD 3PC4A 4E5VA 5EJ2A 4EFLA 2GUGA 2I3GA 2JIMA 1TTQB 4P7KA 4HAIA 1C4KA 1KEWA 4ZL6A 1D03A 1MABB 2O2HA 3IJPA 1C1DA 2PSDA 1SXJA 3GROA 3NHSA 1U2DA 4GLJA 4X20B 4YBRA 4CLOB 1QVRA 4EGAA 3AOEA 3EARA 1XKXA 4P4SB 3PQ8A 3WLJA 1MAUA 1VFNA 1DC8A 4UHCA 5AHWA 3WADA 5LN1A 4OBWA 2A0KA 1GRNA 3D7LA 1AKUA 4W5JA 2HTEA 4N0PA 1GA4A 1YZLA 3GFVA 4FFMA 5CLGA 4Y1GA 3H6HA 1KJZA 3OEYA 4EA6A 5DRTA 3PGLA 2IBMA 3TW4A 2O2YA 2YHIB 1DQSA 4K0KB 2H31A 5E2BA 3ZGVA 3LBNA 3X44A 2WTUA 3ZE8A 1PJRA 5DTJA 2C9ZA 5EMHA 4CM9A 2XQVA 1DO0A 4F9FA 4AN1A 5CMQA 2PT6A 3FVWA 1MVLA 1KL7A 4OQPA 3PXBA 3UWMA 4A5OA 3NBFA 5AJHA 1MABA 1LBTA 1K92A 2VCHA 4CLOA 4X20A 5C37A 4IFBA 3A4YA 5ICGA 1C7FA 3KR1A 1KZ7B 4P4SA 3F49S 3IILA 3JD1A 4CKWB 3WAJA 1GD1O 5DHSA 3TL6A 7ADHA 4AS1A 3E9MA 2F8SA 2VBGA 2AL7A 2BBTA 2VCYA 3OMWA 4CMJA 1HNZB 3B9QA 3K5WA 4KR7A 3AHGA 3W04A 1RR6A 3H04A 1CR2A 4TTAA 3WGQA 1JIVA 3WK4A 4DDTA 3TKAA 3T3HA 1HEUA 4TS1A 5FUVA 5LA6F 2B2XA 2YHIA 3UUGA 5D7BA 3UENA 5LOVB 3NHZA 3UCFA 1F2VA 2ZETA 4KSBA 1WMFA 4JT8A 3LFUA 1VJ0A 4JI8B 2FMFA 1HDXA 2AF3C 3F8TA 2O9JA 4LHSA 2VQSA 3AQ4A 5EI5A 2RG7A 2V54A 3CF6R 1QKIA 4PYLA 3NOOA 3P5BA 2PWBA 3GEDA 4S1OA 5C81A 1CF4A 1ZIYA 1AT1A 1QVZA 3E84A 3IUQA 4D9EA 2XZPA 4DA0A 4F5EA 4CKWA 2FE1A 5JVDF 1ICIA 1X9HA 2IDJA 3DOHA 2R87A 4RZHA 1YACA 1YC5A 1L7AA 2AG5A 5I7OA 1G4AE 2P68A 4DLAA 1DAFA 1SUEA 4Y2RA 4B7UA 2Z8ZA 2BKCA 4PSUA 4RSRA 3DOCA 4FFBB 3SSNA 3W78A 4RKFA 3R09A 1GN9A 1VM6A 3KB2A 2AZXA 5LOVA 4PPFA 1P6XA 2A4MA 3OJWA 1IZYA 3FKSA 3MMXA 4M1EA 4KO4S 2P9HA 2HI0A 2RGXA 3PSHA 4L22A 3OOWA 4GT1A 3WAGA 3DOIA 4B40A 1B93A 2FX2A 4IIYA 1EEHA 3DYBA 4C5BA 3E7DA 1L5WA 1OV4A 3AX6A 3QMMA 4L16A 2DHRA 1ZUWA 4EZIA 2HUPA 4URUR 2C78A 4FBMA 5BOSB 3PQEA 4G0PA 3T9CA 2XUPA 4Y2VA 2P62A 1TKBA 1RAIA 1DADA 2FPIB 3HC7A 2I0FA 3QIVA 3ZN2A 2CYAA 2IEYA 1ZMOA 2QYTA 1DRKA 3W2IA 4V0RA 3T1HB 1PJ2A 3PEYA 2HIGA 2XMBA 2BUCA 1J7KA 2CCKA 4DLPA 2VJLA 3VU1A 1M2JA 1LEHA 3I9KA 3FRHA 3QVDA 4BQIA 1TTHA 3DZJA 1C8LA 2C4TA 2RGRA 4I4NA 1ZD9A 1B2RA 3GJ5A 3C48A 5C4GB 5TX7A 1DXYA 1OPRA 4A03A 4QUKA 3WXBA 1PZNA 5E4YA 1E1QD 1F14A 1RABA 2RCYA 3G79A 3I4LA 2VUSA 3C5CA 3CRMA 2PMKA 2O06A 2PLAA 1Q7RA 3D7RA 3DB2A 4FGJA 1PG2A 4RVCA 2ZWAA 1R0KA 3RS5A 4JB8A 2O5CA 4PS1A 3ZVKA 5AK3A 3H75A 5GQSA 4HQLA 1L7VC 2GM9A 5JMPA 4DPLA 2H11A 2XMCA 5IKOA 3C3DA 4YALA 4UEJA 1PFKA 2BFDB 2FPIA 3K1JA 3PRYA 3EXHB 4V0QA 5B4TA 1ZWKA 4O4JB 4XXHA 2X15A 4FYJA 3AF1A 3HXPA 3M5PA 5FUYA 2COEA 3G89A 3GIWA 2GHRA 4L7VA 3I04M 5KAMA 3EOZA 3G02A 4BRSA 5EPEA 3TK1A 5TV2A 4MQLA 3WIDA 1GG5A 2P79A 1ZGGA 4OXQA 4S1WA 3OEHA 4IS2A 4J0CA 1S2DA 1STOA 4R81A 4ESEA 1VIDA 1JQ3A 1EFHA 1OVMA 2J3HA 5KWSA 3WGUA 4E5KA 4KOEC 3TLBA 3MUEA 2OFXA 4BP1A 2ZJYA 3E70C 3FD8A 1MFZA 3M33A 3ETHA 3PR2B 1UCFA 1KMCA 1MO6A 4CQMB 4L8YA 4EF4A 2W4QA 3QXHA 1QTNA 3K1ZA 3ZY5A 3JYLA 5JNUA 2BFDA 4P0PB 2IYYA 3QY0A 3EXHA 4FGZA 2ZR7A 4O4JA 1RXCA 2Z8XA 2EZUA 4DG9A 5BSEA 5DB4A 3UFXA 3VC3A 1Y3FE 1ZH2A 2X8JB 4WVFA 4BX8A 2Q4TA 5BWCA 5EIBC 3TW6A 4A23A 3DA8A 1N3LA 3AB8A 4I9NA 5DSZA 1C7EA 4MVYA 1OFHA 1NKTA 1LBSA 1VL2A 2H1IA 2XH8A 2YVAA 3DPIA 3IURA 3KAJA 3DQQA 1GLGA 4HYEA 3SSAA 4BMOB 3GA5A 1Z74A 4X93A 2X58A 5AP9A 1EDOA 3T0GA 3FPLA 3RLFA 4URHA 4P4NA 4UZEA 2HXSA 2VFAA 2DC1A 4NOKA 4LZWA 4W4KB 4MKUA 4U1RA 2QT1A 4YUWA 3VSCA 2QQ5A 3B1XA 3C74A 4I3FA 3UA3A 3VHQA 4CQMA 2ZIFA 3MHTA 1KBQA 2ODWA 1CY6A 1TUEA 2ZR8A 2V2OA 4PVCA 3ET4A 5FA5A 2QB5A 2X8JA 4EEZA 1IVSA 3PT9A 3SFVA 2VP2A 4K6MA 3WOVA 1GM5A 1WHSB 2JVIA 2KI5A 3AUUA 2W6PA 1QGAA 3HYNA 1N7JA 4GVXA 4JXZA 2UX1A 4IMPA 3W3AH 3WBKA 4P92A 3ZTTA 2RJNA 1AGYA 4AT1A 3LQ2A 2GBCA 3B36A 4OMUA 1AQNA 3B3GA 3V2GA 5DP2A 1JFRA 5CHEA 3HXTA 3R7SA 4BE9A 2XGOA 3JZMA 3TG8A 1IUNA 1OT3A 3R5XA 1KJWA 2H7CA 6PFKA 1ODIA 2DLDA 2HPAA 3PENA 4Y6PA 5BSRA 2OUIA 1JGTA 2BM1A 4K5QA 1VYHA 3QVSA 3FSGA 4ZGWA 5HRCA 4OQEA 1XXHB 3CUUA 5GIPE 4BNYA 3QXCA 5LYJB 2BR5A 2F8MA 2OAP1 1E8DA 3PGA1 4X44A 1A5SB 1GHTA 3AMVA 3KYCA 2FWAA 3ZHZA 1VEQA 4PC7A 4RKRA 3PU6A 3FWKA 3TOVA 4KFUA 4LWOA 3E23A 4XM1A 2C5HA 1X9GA 2FPMA 1CQIA 1OV6A 1FUYB 1PFQA 2DVMA 1SURA 2IP4A 1YUMA 4B6PA 4F93B 1ORIA 3I62A 1KO8A 5H5JA 2EF0A 1IQ0A 3DDSA 4L8LA 2Q0SA 3ROTA 5M5BA 4MR8B 5ALOA 4URVR 3AF7X 1GGHA 3GHQA 1C3JA 1SBCA 5D3ZA 4DNOA 1ZICA 2YYSA 4P2BA 4A7PA 5KVCA 1YQGA 3E2IA 4Y08A 1VJ1A 3H5RA 2IFTA 4AP9A 2DY0A 3YASA 4MIKA 5B57C 1ENPA 1XXHA 2IBSA 3HKBA 5LYJA 4NYJR 3AEKB 4K26A 3OJ5A 3RTDA 3GN1A 5CAEA 2JGMA 3PCXA 2P6OA 1WPQA 3OPVA 4AWAA 1TEVA 1XE3A 2IS4A 4Y6OA 4R4JA 4PICA 4LJ4A 3IEVA 1FZTA 1P3DA 1DV1A 1E2IA 2MYPA 2PMCA 2V6BA 3AEYA 3DAHA 3KOYA 1ZM2A 5FPHA 3URKA 4HLNA 5C5EA 3CEAA 1H2ZA 1VL6A 2IW3A 3D4IA 3MG9A 3L93A 3MWYW 4MR8A 2Z5PA 1I1NA 1G3UA 1UBMS 4QREA 3TXAA 1SOFA 4AUKA 5IK2D 1WXHA 3LF1A 3M5WA 4JV5B 4RGVA 3NP0X 2CNBA 5AVSA 5IUNC 4H0FA 1SUCA 3G17A 4H4CA 1T0HB 3CNNA 1YUBA 3MD0A 4JKYA 1WUKS 3GLIE 4HDKB 5JAUA 1SHUX 4JP5A 4AJOA 4LQ4A 5JW6A 1XTIA 4M7RA 3STHA 2CC2A 1Q77A 1TAUA 2G3YA 4G9EA 1TZ2A 4ZKEA 4B3CA 4OSEA 2IHVA 1QKJA 3B2QA 1XYGA 2X4IA 3FI6A 5FNZA 5GU0X 3QKUA 5CW1A 3UJBA 3OO0A 3UJHA 1WRBA 3O82A 3PLRA 4LRSB 4EFDA 1ZH6A 4ZYVA 1TJNA 4D8TA 2XKKA 2AEJA 4W5HA 4YDRA 4AS2A 3KT6A 5KB3A 1E2KA 3WLHA 1T0IA 1XCLA 2G40A 4WJKB 3PX2A 3QFHA 1HT2E 1QG2A 2H1WA 2FZFA 3CH7A 2BZ1A 1Q7TA 4TTVA 2NPOA 2ODAA 5E9JA 2I2FA 2J6CA 4IDBA 5ALHA 4HWKA 2BKUA 2P3OA 3TD9A 4QC2A 2R6HA 4Q7EA 1G20E 4QAJA 3SEFA 3TI9A 1TYCA 1KQNA 4ER6A 4HDKA 3VMFA 2ZG9X 2QDKA 4WCDA 2WOOA 5CHYA 2HGZA 3HLYA 1J7JA 3L7IA 3DVSX 4G1UC 5CYOA 1Y8QB 2VRNA 3QVVA 1U5BB 3TYXA 2D0DA 1KDTA 4JLNA 2HO5A 4XX0A 1OPXA 2ECKA 4Z4IA 2P75A 3U7JA 1QXSA 1UQTA 4DNQA 4NPAA 5TQJA 2RJ3A 1B8VA 2OQ2A 3HBJA 1JX6A 4BFSA 4C14A 1VPLA 1V8DA 2C0CA 1JVNA 4QQNA 4AS3A 3ZQ4A 3DGFC 4E3ZA 4YJGB 2W6NA 2YL2A 1QZZA 2UYCA 1QCDA 5K03A 3E2CA 3NJ4A 3ADBA 1I24A 1PF7E 1ZJ5A 2TMDA 1I1OA 5DWQA 2F4NA 1E1QA 1KO1A 1KNXA 2HM7A 3PC8A 4PO9A 1TFRA 4RWZA 3VUFA 3IAS6 3TVTA 5KWEA 2EOAA 1Y8QA 2HCRA 3ZDAA 1LK5A 2VS1A 5J8SA 4LKOA 4ZV4A 3H11B 4GYYA 1GY8A 4KLCA 2JLCA 3HCCA 3K9GA 5HUJA 1GYRA 1SPBS 3ME5A 3I37X 4AJEA 2VQEB 4Q3CA 1UINA 1E1DA 1YCGA 3KKMA 2XCUA 4I9HA 5EESA 3ZNOA 4ZVMA 1NIJA 5ISMA 3OC6A 3KDAA 3MOGA 4M35A 1A7AA 2AQ8A 3BEOA 4K9MA 4YJGA 2VP0A 1XQ9A 3HZHA 2P4HX 4PQRA 3V4LA 2CXTA 3FJ1A 1QR2A 3T7DA 1GZ3A 2W2QA 2B5WA 3STVA 4ZVNA 1L5KA 1TADA 3WJ2A 1P45A 1KMNA 3R3UA 1SQ3A 3R2HA 1M8GA 1NTRA 2W00A 4IXTA 3SQOA 2QJOA 4BE4A 2HSEA 4L57A 4WDRA 2I4MA 1ZOLA 5MN6A 3K05A 4DC1A 3H11A 5EEHA 3LX5A 3P27A 2GPYA 4OKIA 2IC5A 2PUVA 2BFWA 1LPNA 1RRMA 2XECA 4AMBA 5DK6A 3QU7A 4UZFA 1TMOA 4XEUA 3OZDA 4BP8A 1JKIA 5JXIA 2XUKA 3DZBA 4TSFD 2FG5A 5CB4B 1JGCA 1OD6A 4MO9A 4R9NA 2FZVA 5D6NA 5K20A 2NSDA 3TS1A 2DCUA 4AJPA 4IY1A 2HV8A 2B7LA 1JEYB 1I30A 4ZLWA 1RCFA 5HQOA 1I3CA 2BOVA 3JRXA 3QA3E 3DD1A 3QX8A 1J0XO 2AMLA 4P5EA 3TW0A 3QG1A 1IVYA 3MUOA 3EDCA 1OR8A 2JI7A 1ULTA 3GU3A 1CZNA 1TM3E 2ETXA 4GM1A 4W1PA 5IBRA 2FFHA 1K2VN 4G36A 1V16A 1YZUA 3SEQA 4QXAA 3VPBA 4W4TA 3GP5A 4U4AA 3F73A 3OZXA 3Q7QA 4HCJA 4MIYA 4R8MA 4JELA 2QUAA 1GNQA 2REBA 3PVRA 3AW8A 2YRWA 3CUYA 3FIJA 4I5DA 3AUSA 4HR7A 3TTTA 3S55A 4FFSA 4EUEA 4HVAA 4AP6A 1Q22A 5FA8A 4P33A 2F00A 1Z33A 2CIHA 4MGYR 4RIFA 4EGJA 1F0PA 2GRUA 5FI3A 1I32A 1ODKA 1HMPA 1OF1A 1B0UA 4F56A 5AMXA 5CB4A 1RHMA 2G9NA 2QVYX 1NPYA 2FB9A 1Z75A 4YT5A 2Z09A 1JEYA 4JBIA 4E15A 5IF9A 1QHHA 1M6YA 4OLBA 1ZS3A 3A1WA 3GAFA 3LLVA 3U3OA 2KPOA 2Q3HA 2DUUA 2Q3FA 2QJWA 3HYCA 2JAXA 4GE3A 4EHJA 1QF6A 3PVCA 3KA8A 2ZRLA 1YASA 2PWPA 3ZE7A 1ZHFA 4TTPA 2V74B 4QOFA 3UJAA 2YW2A 1PV1A 3AETB 2E3JA 4NIMA 3CF0A 5DCWA 1Y8RB 3ERZA 3TFWA 2O6HA 3TOZA 4TYNA 1RXIA 3SC2B 4FCTA 5KTTA 3OFSA 3NPMA 4D9IA 2LP4Y 5EHZA 4GIBA 3A70A 2QKYA 3LY7A 4TOIA 1ODLA 4U7TB 2UZIR 1XF1A 4C76A 3B52X 3ADOA 4V1CA 1CUVA 2DJ5A 3EUWA 4WY8A 2ZZMA 2YBEA 2B99A 5IAJA 1OH6A 3EWIA 2VT6A 3E9CA 3KIPA 1IXZA 4KE9A 4FD3A 2AWNA 2I1LA 2IYNA 1PLKA 3Q7TA 4ZVLA 4WE3A 5CP8A 5FPTA 2FEWB 1T4GA 3D3WB 2V45A 1KRQA 3EQ7A 1FQJA 2NUTB 1JILA 3ID6C 4OQYA 5I9BA 4CU5A 1WEHA 3B20A 2AB0A 1MH1A 2DR3A 3NYQA 2I4OA 3RU7A 4CDNA 3F4LA 3AETA 1O6FA 3LQYA 2C42A 1Y8RA 4BVAA 1XZLA 3NWPA 4DVGA 3SC2A 1Y5MA 3KTDA 1FS6A 5F78A 4HDNB 3W4IA 5KPDA 5AOBA 2ONKA 1RWPA 4HYQA 1NMZA 3LECA 5EZSA 1PV4A 1VLZA 1Q20A 4CVPA 3BCRA 3COSA 3LXRA 4YRMA 5JT1A 4Y6QA 1IM5A 1I0IA 4EJ6A 3P32A 4P7FA 3H5AA 1ENZA 2XD9A 4O4HF 2BI8A 3KDPA 3U56A 3PD0A 2DSTA 5E6UB 2YNMA 3C7DB 3PQCA 4EHBA 3VX3A 1H6BA 5EHQA 4YMHA 2P6PA 3ZDXB 1PQWA 1ZVKA 3G8BA 4QD3A 2AS0A 3RC2A 1ISFA 1KJYA 1MZPA 3N0XA 3MS7A 1SBHA 2GSWA 3D3WA 3WLLA 1FNCA 2NUTA 2C2XA 2YV2A 3ZBUA 5IHPA 4ZYLA 1LFAA 3OLCX 4BBPA 2JAWA 1HE2A 1VSTA 5IK2A 3UXMA 1T4CB 3GLFB 4DKXA 4KPYA 5C46F 3W5BA 3PFWO 1EP9A 4HDNA 4NARA 5J4HA 3W54A 3CUSA 4GLBA 3SM9A 2Q27A 3MJEA 3U44B 1FFCA 1AY0A 1F17A 2VDKB 1JZTA 1W5TA 4ME6A 3T1QA 3QYJA 1T43A 3R8CA 3V4SA 2H5LA 3LXMA 3W7AA 5UKDA 4N5NA 2YKGA 5FHQA 1XEFA 2YQZA 2XYGA 4FFWA 2G38B 4LYYA 4CIVA 3A6HA 2A58A 1NRIA 1R8YA 4UAVA 4YDHB 5DSXA 1BH2A 2BHSA 2C7RA 5MHTA 4EGQA 1RLIA 1GZDA 4Z4GA 1PHPA 4WDQA 1BFUA 3RSQA 2R1ZA 4B5LA 2DT5A 2I2AA 1ADGA 2NZWA 2GM4A 4BEWA 2CF6A 4J0IA 1T4CA 1M2GA 4UDYX 2H52A 1HG0A 4Z0HO 3VPXA 1JVSA 2YUTA 3LPDA 3RT9A 3TSYA 5K2MA 4CV1A 1YB1A 1CT9A 1FU4A 4FEEA 1UVHA 1OILA 1UBLS 2IV2X 3U44A 1A2BA 1N5RA 1BMDA 3LNTA 1ZM4A 4RDIA 2LD4A 1UIRA 4WCFB 2X0DA 3O9ZA 1N5LA 4M1TA 2JGAA 1DELA 3CW8X 4NQRA 3TRDA 2P8SA 3V33A 4OPMA 3WYAA 3L9WA 4KTTE 1PAUA 2HY7A 1ZOSA 4BNXA 4M88A 1IPEA 4J75A 2HUNA 3W5SA 4X62B 3MZ0A 3NORA 1HE1C 4YH1A 3ZG6A 1LTKA 3B85A 3PXDA 3WRWA 1A9PA 1GFIA 1TGYA 4DCJA 4EY5A 1YQUA 4KO2S 4A91A 1KZHA 4MKZA 3E5RA 5DW0A 4OTZA 2ZS7A 3N87A 3TNDA 2XMSA 4CEHB 2C7BA 4LXYA 4R6WA 4WCFA 3WC4A 4DMUB 2CFCA 2XHZA 3CEHA 3AUYA 1K86A 4TTTS 1C3XA 3EFEA 4M2LA 2W98A 1HSOA 3PFIA 4MEAA 1OZHA 3IQGX 1W4CA 2M32A 2Y1DA 1RAAA 3O6VA 4HN2A 1VI6A 2PFSA 1CR1A 3P9SA 4WZAB 5KWVA 2ILTA 3BJRA 3AV0B 1RLUA 2WM2A 3JSXA 4JNCA 1MO3A 1T9KA 1HTWA 4LBWA 4QT0A 5DM70 3KHSA 2JHFA