3QHCA

Crystal structure of symerythrin from cyanophora paradoxa, reduced with dithionite
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
179
structure length
179
Chain Sequence
GLNYNQEDFMGLDRFFQDAVSHNNTDANAASSIEVEMYECDCMYPTFAEIARRSGQPEIGAMFDAIAKEEGMHAQLLTKLYSELEVKDSAETLEAKRLVSTIESQIDAVASDSRGLRRALETALEVETIESQKTYPAFAKLAAEQGNMEVATAFEAIVKSETKHANWVKRALENLLEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Symerythrin
publication title Symerythrin structures at atomic resolution and the origins of rubrerythrins and the ferritin-like superfamily.
pubmed doi rcsb
source organism Cyanophora paradoxa
total genus 81
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3qhcA00
3GE4A 4LPJA 4CYAA 5K52A 3BVIA 4LQHA 4E6KA 4AM4A 5LS9A 3RE7A 3UOIA 5LG8A 2HTNA 2C2JA 4ZMCA 4II4B 2Z5PA 1S30A 3OJ5A 4QUWA 4U3GA 4IXKA 3KWOA 4XGSA 2QF9A 2GYQA 1VELA 3Q4QA 4YKHA 2FG8A 2VXXA 4Y08A 1JIGA 3R2KA 5JKLA 4IWKA 3PZAA 1RCIA 4LQVA 4CVPA 3AK9A 4ZLWA 3FVBA 2GYDA 4Z5SA 1B71A 2JD60 1VJXA 3SH6A 2V2OA 3PVYB 3TA8A 5GOUA 1RCDA 5GU0X 3F39A 2BW1A 4ZKXA 4RC6B 2C2FA 1FHAA 1DPSA 5JKLG 2HR5A 4CVSA 2FG4A 4MJYA 1QGHA 1Z4AA 5LBHA 3WVWA 3NP2X 5AXSA 2D5KA 5FFAA 5CZUA 3AJOA 3F36A 2XGWA 5CMQA 1YUXA 3QHCA 1ZUJA 1YV1A 3AF7X 3KA8A 3WNWA 1JREA 3PW8C 3O7SA 4AM5A 3PVRB 3GHQA 1LB3A 3PVTB 4RC7B 4RC8A 1UVHA 3PW1B 3RAVA 4TW3A 3H7GA 2XJOA 3E2CA 3QB9A 2CHIA 1BCFA 4IWJA 3R2OA 4XKSA 4TOBA 5D8XA 1O9IA 5IX6A 4ZTTA 4II4A 3IS7A 1RCEA 3IS8A 3SIDA 4CYBA 4XKTA 1F30A 4EVEA 2XJMA 4OYNA 3QVDA 5FFCA 2V2LA 3R2RA 4ZL6A 2ITBA 4ZL5A 2V2NA 3F33A 5GU1X 2VZBA 4TOEA 2X170 4TOAA 2V15A 2Z6MA 5LG2A 3PVYA 2PYBA 2JD70 2ZG9X 4A25A 2RBDA 4ZKWA 3EZUA 1JI5A 3KA9A 5J93A 4DE6A 3BT5A 3ES3A 3VNXA 4LQJA 1RYTA 3PWFA 2BJYA 3BVKA 2XKQA 1J30A 5D8YA 3IQ1A 5GU2X 4MY7A 1QYBA 1EUMA 2CEIA 4AM2A 1DVBA 3E6SA 5C6FA 2CF7A 3BVFA 2ZURX 1S2ZA 2G4HA 3E1NA 1NF6A 5JKMA 3NOZX 3KX9A 3PVRA 1MFRA 1L8HA 3KA6A 1F33A 3PVTA 4RC7A 1DATA 1TKPA 4REUA 3KA3A 2V2MA 4CMYV 3R2MA 4ITTA 3PW1A 4RC5A 3E1LA 4LQNA 2V2RA 5D8PA 1BG7A 3PWQC 5FFEA 3A9QA 2V2IA 4LPNA 5K53A 3E1MA 4LPMA 5JKMG 3T9JA 4ML5A 4EVDA 5GN8A 3R2SA 5J9VA 3ERZA 2XJNA 2FFXJ 1O9RA 2BKCA 2CIHA 2FL0A 1TKOA 2YJJA 4P18A 2CN7A 3F32A 1NNQA 5HJFA 5D8QA 2V2SA 3AJPA 1SOFA 3OGHA 2Z90A 3Q4RA 4MUDA 1JGCA 3SHXA 5J8WA 1TJOA 2YJKA 3RBCA 2QQYA 1JI4A 3E1JA 3FI6A 2YW6A 2V2PA 2Z5RA 3KA4A 4TOHA 2CLBA 1IESA 3E1OA 4LYXA 2BK6A 3WVVA 2GS4A 3RD0A 5FFDA 4M33A 5I4JA 3KXUA 3HL1A 4TOFA 4PGIA 1AEWA 1VLGA 3PWQA 3SE1A 2CLUA 4ISPA 4PG1A 2WLAA 5E2DA 1YUZA 1S3QA 3O7RA 4ERUA 3R2LA 2C41A 2C6RA 2CHPA 2WTLA 1LKPA 4RC6A 3MPSA 5FFBA 3WVUA 1VEIA 2OC5A 5ERKA 4M35A 3PW8A 4M34A 2W0OA 1JKUA 1VEQA 1NF4A 3AK8A 1KRQA 2Z5QA 4DYYA 4DZ0A 1GWGA 5HJHA 1JYBA 3AJQA 1UMNA 4ZJKA 4KVSA 4MKUA 1Z6OM 3BVLA 4DI0A 1RCCA 3F38A 2Y3QA 4PG0A 4TOGA 5HQOA 4TODA 2OH3A 5D8OA 3ISFA 4M32A 1MOJA 4MN9A 1LKMA 3NP0X 4EVCA 1HRSA 3R2HA 4PGKA 5CMRA 5ERJA 2IU2A 5D8RA 4DASA 2IY4A 3GVYA 5GU3X 4Z3BA 3U90A 2YW7A 4ISMA 4CVTA 1OTKA 3BKNA 3Q4OA 3E6RA 1NFVA 1RCGA 3UNOA 1Z6OA 4DYUA 3EGMA 4ETRA 4DYXA 3ISEA 3Q4NA 2C2UA 1L8IA 3QD8A 2WLUA 3F37A 2VXIA 2F7NA 2FKZA 2CN6A 3AF8X 3UOFA 3A68A 3E1PA 4EVBA 3FSEA 4XKUA 1XZ3A 1IERA 2ZA7A 4KVRA 2FZFA 2FHAA 4CY9A 4RC5B 3QHBA 4ITWA 3F34A 3HIUA 2V2JA 3RGDA 2IB0A 4TOCA 2ZG8X 2ZA6A 3F35A 4R42A 3AF9X 1JTSA 1XZ1A 4CVRA 2FJCA 3QZ3A 1N1QA 5J8SA 3E1QA 4DYZA 1R03A 4CMYA 1BFRA 1LKOA 3BVEA 5E1UA 5GN8B 2JD80 5JACA 2ZG7X 2ZA8A 1TK6A 2UX1A 5D8SA 4KVQA 4LYUA 1JKVA 3EZ0A 1H96A 4TO9A 1SQ3A 5FEJA 1ZS3A 4ZKHA
chains in the Genus database with same CATH superfamily
3GE4A 4LPJA 4CYAA 5K52A 3BVIA 4LQHA 4E6KA 4AM4A 5LS9A 3RE7A 3UOIA 5LG8A 3VVAA 2HTNA 2C2JA 4ZMCA 4II4B 2Z5PA 1S30A 3OJ5A 4QUWA 4U3GA 4IXKA 3KWOA 4XGSA 2QF9A 2GYQA 1VELA 3Q4QA 4YKHA 2FG8A 2VXXA 4Y08A 1JIGA 3R2KA 5JKLA 4IWKA 3PZAA 1RCIA 4LQVA 4CVPA 3AK9A 3GGYA 4ZLWA 3FVBA 2GYDA 4Z5SA 4YXMA 1B71A 2JD60 1VJXA 3SH6A 2V2OA 3PVYB 3TA8A 5GOUA 4W4LB 3GGZA 3FRRA 1RCDA 5GU0X 3F39A 2BW1A 4ZKXA 4MXPA 4RC6B 2C2FA 1FHAA 1DPSA 5JKLG 2HR5A 4CVSA 2FG4A 4MJYA 1QGHA 1Z4AA 5LBHA 3WVWA 3DBYA 3NP2X 5AXSA 2D5KA 5FFAA 5CZUA 3AJOA 3F36A 2XGWA 5CMQA 1YUXA 3QHCA 1ZUJA 1YV1A 3AF7X 3KA8A 3FRSA 3WNWA 1JREA 3PW8C 4WJG4 3O7SA 4AM5A 3PVRB 3GHQA 1LB3A 3PVTB 4RC7B 4RC8A 1UVHA 3PW1B 3RAVA 3JZ9A 4TW3A 3H7GA 2XJOA 3E2CA 3QB9A 2CHIA 1BCFA 4IWJA 3R2OA 4XKSA 3UFBA 4TOBA 5D8XA 1O9IA 5IX6A 4ZTTA 4II4A 3IS7A 1RCEA 2MGYA 3IS8A 3SIDA 4CYBA 4XKTA 1F30A 4EVEA 2AR0A 2XJMA 4OYNA 3QVDA 5FFCA 3D19A 2V2LA 3R2RA 2OKCA 4ZL6A 2ITBA 2G38B 4ZL5A 2V2NA 3F33A 5GU1X 2VZBA 4TOEA 2X170 5JDOB 4TOAA 2V8TA 2V15A 2Z6MA 5LG2A 3PVYA 2PYBA 2JD70 2ZG9X 4A25A 2RBDA 4ZKWA 3EZUA 1JI5A 3KA9A 2N02A 5J93A 4DE6A 3BT5A 3ES3A 3VNXA 4LQJA 1RYTA 3PWFA 2BJYA 3BVKA 2XKQA 1J30A 5D8YA 3IQ1A 5GU2X 4MY7A 1QYBA 1EUMA 2CEIA 4AM2A 1DVBA 3E6SA 5C6FA 2CF7A 3BVFA 2ZURX 1S2ZA 2G4HA 3E1NA 1NF6A 5JKMA 3NOZX 3KX9A 3PVRA 1MFRA 1L8HA 3KA6A 3C23A 3PVTA 1F33A 4RC7A 1DATA 1TKPA 4REUA 3KA3A 2V2MA 4CMYV 3R2MA 4ITTA 3PW1A 4RC5A 3E1LA 4LQNA 2V2RA 5D8PA 1BG7A 3W54A 3PWQC 5FFEA 3A9QA 2V2IA 4LPNA 5K53A 3E1MA 4LPMA 5JKMG 5HU6D 3T9JA 4ML5A 4EVDA 5GN8A 3R2SA 5J9VA 3C21A 3ERZA 2XJNA 3V3KB 2FFXJ 1O9RA 2BKCA 2CIHA 2FL0A 1TKOA 3VV9A 5JDOA 2YJJA 4P18A 2CWLA 2CN7A 3F32A 1NNQA 5HJFA 5D8QA 2V2SA 3AJPA 1SOFA 3OGHA 2Z90A 3Q4RA 4MUDA 1JGCA 3SHXA 4E40A 5J8WA 1TJOA 2YJKA 3RBCA 2QQYA 1JI4A 3E1JA 3FI6A 2YW6A 2V2PA 2Z5RA 3KA4A 4TOHA 2CLBA 1IESA 3E1OA 4LYXA 2BK6A 3WVVA 2GS4A 3RD0A 5FFDA 4M33A 5I4JA 3KXUA 3HL1A 4TOFA 3KDQA 4PGIA 1AEWA 1VLGA 3PWQA 3SE1A 2CLUA 4ISPA 4PG1A 4X0JA 2WLAA 5E2DA 1YUZA 1S3QA 3O7RA 4ERUA 3R2LA 2C41A 2C6RA 2CHPA 2WTLA 1LKPA 4RC6A 3MPSA 5FFBA 3WVUA 1VEIA 2OC5A 5ERKA 4M35A 3PW8A 4M34A 2W0OA 1JKUA 1VEQA 1NF4A 3AK8A 3KHKA 1KRQA 2Z5QA 4DYYA 4DZ0A 1GWGA 5HJHA 1JYBA 3AJQA 1UMNA 4ZJKA 4KVSA 4MKUA 1Z6OM 3BVLA 4DI0A 1RCCA 3F38A 2Y3QA 4W4KB 4PG0A 4TOGA 5HQOA 4TODA 2OH3A 5D8OA 3ISFA 4M32A 1MOJA 4MN9A 1LKMA 3NP0X 4EVCA 1HRSA 3R2HA 4PGKA 5CMRA 5ERJA 2IU2A 5D8RA 4DASA 2IY4A 3GVYA 5GU3X 4Z3BA 3C1ZA 3U90A 2YW7A 2WWXB 2V8UA 4ISMA 4CVTA 1OTKA 4YXJA 3BKNA 3Q4OA 3E6RA 3M6JA 1NFVA 1RCGA 3UNOA 1Z6OA 3N6OA 4DYUA 3EGMA 4ETRA 4DYXA 3ISEA 3Q4NA 4KXRB 2C2UA 1L8IA 3QD8A 2WLUA 3F37A 2VXIA 2F7NA 2FKZA 2CN6A 3AF8X 3UOFA 3A68A 3E1PA 4EVBA 3FSEA 3JZAB 4XKUA 1XZ3A 1IERA 2ZA7A 4KVRA 2FZFA 2FHAA 4CY9A 4RC5B 3QHBA 3LKDA 4ITWA 3L0MA 4YVZA 3F34A 3HIUA 2V2JA 3RGDA 2IB0A 2Y44A 4TOCA 2ZG8X 2ZA6A 3F35A 4R42A 3AF9X 1JTSA 1XZ1A 4CVRA 2FJCA 3QZ3A 1N1QA 5J8SA 3E1QA 4DYZA 1R03A 4CMYA 1BFRA 1LKOA 3BVEA 5E1UA 5GN8B 3C1YA 2JD80 5JACA 2ZG7X 2ZA8A 1TK6A 2UX1A 5D8SA 4KVQA 4LYUA 1JKVA 3EZ0A 1H96A 4TO9A 1SQ3A 5FEJA 1ZS3A 4ZKHA
chains in the Genus database with same CATH topology
3GE4A 4LPJA 4CYAA 5K52A 3BVIA 4LQHA 4E6KA 4AM4A 5LS9A 3RE7A 3UOIA 5LG8A 3VVAA 2HTNA 2C2JA 4ZMCA 4II4B 2Z5PA 1S30A 3OJ5A 4QUWA 4U3GA 4IXKA 3KWOA 4XGSA 2QF9A 2GYQA 1VELA 3Q4QA 4YKHA 2FG8A 2VXXA 4Y08A 1JIGA 3R2KA 5JKLA 4IWKA 3PZAA 1RCIA 4LQVA 4CVPA 3AK9A 3GGYA 4ZLWA 3FVBA 2GYDA 4Z5SA 4YXMA 1B71A 2JD60 1VJXA 3SH6A 2V2OA 3PVYB 3TA8A 5GOUA 4W4LB 3GGZA 3FRRA 1RCDA 5GU0X 3F39A 2BW1A 4ZKXA 4MXPA 4RC6B 2C2FA 1FHAA 1DPSA 5JKLG 2HR5A 4CVSA 2FG4A 4MJYA 1QGHA 1Z4AA 5LBHA 3WVWA 3DBYA 3NP2X 5AXSA 2D5KA 5FFAA 5CZUA 3AJOA 3F36A 2XGWA 5CMQA 1YUXA 3QHCA 1ZUJA 1YV1A 3AF7X 3KA8A 3FRSA 3WNWA 1JREA 3PW8C 4WJG4 3O7SA 4AM5A 3PVRB 3GHQA 1LB3A 3PVTB 4RC7B 4RC8A 1UVHA 3PW1B 3RAVA 3JZ9A 4TW3A 3H7GA 2XJOA 3E2CA 3QB9A 2CHIA 1BCFA 4IWJA 3R2OA 4XKSA 3UFBA 4TOBA 5D8XA 1O9IA 5IX6A 4ZTTA 4II4A 3IS7A 1RCEA 2MGYA 3IS8A 3SIDA 4CYBA 4XKTA 1F30A 4EVEA 2AR0A 2XJMA 4OYNA 3QVDA 5FFCA 3D19A 2V2LA 3R2RA 2OKCA 4ZL6A 2ITBA 2G38B 4ZL5A 2V2NA 3F33A 5GU1X 2VZBA 4TOEA 2X170 5JDOB 4TOAA 2V8TA 2V15A 2Z6MA 5LG2A 3PVYA 2PYBA 2JD70 2ZG9X 4A25A 2RBDA 4ZKWA 3EZUA 1JI5A 3KA9A 2N02A 5J93A 4DE6A 3BT5A 3ES3A 3VNXA 4LQJA 1RYTA 3PWFA 2BJYA 3BVKA 2XKQA 1J30A 5D8YA 3IQ1A 5GU2X 4MY7A 1QYBA 1EUMA 2CEIA 4AM2A 1DVBA 3E6SA 5C6FA 2CF7A 3BVFA 2ZURX 1S2ZA 2G4HA 3E1NA 1NF6A 5JKMA 3NOZX 3KX9A 3PVRA 1MFRA 1L8HA 3KA6A 3C23A 3PVTA 1F33A 4RC7A 1DATA 1TKPA 4REUA 3KA3A 2V2MA 4CMYV 3R2MA 4ITTA 3PW1A 4RC5A 3E1LA 4LQNA 2V2RA 5D8PA 1BG7A 3W54A 3PWQC 5FFEA 3A9QA 2V2IA 4LPNA 5K53A 3E1MA 4LPMA 5JKMG 5HU6D 3T9JA 4ML5A 4EVDA 5GN8A 3R2SA 5J9VA 3C21A 3ERZA 2XJNA 3V3KB 2FFXJ 1O9RA 2BKCA 2CIHA 2FL0A 1TKOA 3VV9A 5JDOA 2YJJA 4P18A 2CWLA 2CN7A 3F32A 1NNQA 5HJFA 5D8QA 2V2SA 3AJPA 1SOFA 3OGHA 2Z90A 3Q4RA 4MUDA 1JGCA 3SHXA 4E40A 5J8WA 1TJOA 2YJKA 3RBCA 2QQYA 1JI4A 3E1JA 3FI6A 2YW6A 2V2PA 2Z5RA 3KA4A 4TOHA 2CLBA 1IESA 3E1OA 4LYXA 2BK6A 3WVVA 2GS4A 3RD0A 5FFDA 4M33A 5I4JA 3KXUA 3HL1A 4TOFA 3KDQA 4PGIA 1AEWA 1VLGA 3PWQA 3SE1A 2CLUA 4ISPA 4PG1A 4X0JA 2WLAA 5E2DA 1YUZA 1S3QA 3O7RA 4ERUA 3R2LA 2C41A 2C6RA 2CHPA 2WTLA 1LKPA 4RC6A 3MPSA 5FFBA 3WVUA 1VEIA 2OC5A 5ERKA 4M35A 3PW8A 4M34A 2W0OA 1JKUA 1VEQA 1NF4A 3AK8A 3KHKA 1KRQA 2Z5QA 4DYYA 4DZ0A 1GWGA 5HJHA 1JYBA 3AJQA 1UMNA 4ZJKA 4KVSA 4MKUA 1Z6OM 3BVLA 4DI0A 1RCCA 3F38A 2Y3QA 4W4KB 4PG0A 4TOGA 5HQOA 4TODA 2OH3A 5D8OA 3ISFA 4M32A 1MOJA 4MN9A 1LKMA 3NP0X 4EVCA 1HRSA 3R2HA 4PGKA 5CMRA 5ERJA 2IU2A 5D8RA 4DASA 2IY4A 3GVYA 5GU3X 4Z3BA 3C1ZA 3U90A 2YW7A 2WWXB 2V8UA 4ISMA 4CVTA 1OTKA 4YXJA 3BKNA 3Q4OA 3E6RA 3M6JA 1NFVA 1RCGA 3UNOA 1Z6OA 3N6OA 4DYUA 3EGMA 4ETRA 4DYXA 3ISEA 3Q4NA 4KXRB 2C2UA 1L8IA 3QD8A 2WLUA 3F37A 2VXIA 2F7NA 2FKZA 2CN6A 3AF8X 3UOFA 3A68A 3E1PA 4EVBA 3FSEA 3JZAB 4XKUA 1XZ3A 1IERA 2ZA7A 4KVRA 2FZFA 2FHAA 4CY9A 4RC5B 3QHBA 3LKDA 4ITWA 3L0MA 4YVZA 3F34A 3HIUA 2V2JA 3RGDA 2IB0A 2Y44A 4TOCA 2ZG8X 2ZA6A 3F35A 4R42A 3AF9X 1JTSA 1XZ1A 4CVRA 2FJCA 3QZ3A 1N1QA 5J8SA 3E1QA 4DYZA 1R03A 4CMYA 1BFRA 1LKOA 3BVEA 5E1UA 5GN8B 3C1YA 2JD80 5JACA 2ZG7X 2ZA8A 1TK6A 2UX1A 5D8SA 4KVQA 4LYUA 1JKVA 3EZ0A 1H96A 4TO9A 1SQ3A 5FEJA 1ZS3A 4ZKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE4 A;  4LPJ A;  4CYA A;  5K52 A;  3BVI A;  4LQH A;  4E6K A;  4AM4 A;  5LS9 A;  3RE7 A;  3UOI A;  5LG8 A;  2HTN A;  2C2J A;  4ZMC A;  4II4 B;  2Z5P A;  1S30 A;  3OJ5 A;  4QUW A;  4U3G A;  4IXK A;  3KWO A;  4XGS A;  2QF9 A;  2GYQ A;  1VEL A;  3Q4Q A;  4YKH A;  2FG8 A;  2VXX A;  4Y08 A;  1JIG A;  3R2K A;  5JKL A;  4IWK A;  3PZA A;  1RCI A;  4LQV A;  4CVP A;  3AK9 A;  4ZLW A;  3FVB A;  2GYD A;  4Z5S A;  1B71 A;  2JD6 0;  1VJX A;  3SH6 A;  2V2O A;  3PVY B;  3TA8 A;  5GOU A;  1RCD A;  5GU0 X;  3F39 A;  2BW1 A;  4ZKX A;  4RC6 B;  2C2F A;  1FHA A;  1DPS A;  5JKL G;  2HR5 A;  4CVS A;  2FG4 A;  4MJY A;  1QGH A;  1Z4A A;  5LBH A;  3WVW A;  3NP2 X;  5AXS A;  2D5K A;  5FFA A;  5CZU A;  3AJO A;  3F36 A;  2XGW A;  5CMQ A;  1YUX A;  3QHC A;  1ZUJ A;  1YV1 A;  3AF7 X;  3KA8 A;  3WNW A;  1JRE A;  3PW8 C;  3O7S A;  4AM5 A;  3PVR B;  3GHQ A;  1LB3 A;  3PVT B;  4RC7 B;  4RC8 A;  1UVH A;  3PW1 B;  3RAV A;  4TW3 A;  3H7G A;  2XJO A;  3E2C A;  3QB9 A;  2CHI A;  1BCF A;  4IWJ A;  3R2O A;  4XKS A;  4TOB A;  5D8X A;  1O9I A;  5IX6 A;  4ZTT A;  4II4 A;  3IS7 A;  1RCE A;  3IS8 A;  3SID A;  4CYB A;  4XKT A;  1F30 A;  4EVE A;  2XJM A;  4OYN A;  3QVD A;  5FFC A;  2V2L A;  3R2R A;  4ZL6 A;  2ITB A;  4ZL5 A;  2V2N A;  3F33 A;  5GU1 X;  2VZB A;  4TOE A;  2X17 0;  4TOA A;  2V15 A;  2Z6M A;  5LG2 A;  3PVY A;  2PYB A;  2JD7 0;  2ZG9 X;  4A25 A;  2RBD A;  4ZKW A;  3EZU A;  1JI5 A;  3KA9 A;  5J93 A;  4DE6 A;  3BT5 A;  3ES3 A;  3VNX A;  4LQJ A;  1RYT A;  3PWF A;  2BJY A;  3BVK A;  2XKQ A;  1J30 A;  5D8Y A;  3IQ1 A;  5GU2 X;  4MY7 A;  1QYB A;  1EUM A;  2CEI A;  4AM2 A;  1DVB A;  3E6S A;  5C6F A;  2CF7 A;  3BVF A;  2ZUR X;  1S2Z A;  2G4H A;  3E1N A;  1NF6 A;  5JKM A;  3NOZ X;  3KX9 A;  3PVR A;  1MFR A;  1L8H A;  3KA6 A;  1F33 A;  3PVT A;  4RC7 A;  1DAT A;  1TKP A;  4REU A;  3KA3 A;  2V2M A;  4CMY V;  3R2M A;  4ITT A;  3PW1 A;  4RC5 A;  3E1L A;  4LQN A;  2V2R A;  5D8P A;  1BG7 A;  3PWQ C;  5FFE A;  3A9Q A;  2V2I A;  4LPN A;  5K53 A;  3E1M A;  4LPM A;  5JKM G;  3T9J A;  4ML5 A;  4EVD A;  5GN8 A;  3R2S A;  5J9V A;  3ERZ A;  2XJN A;  2FFX J;  1O9R A;  2BKC A;  2CIH A;  2FL0 A;  1TKO A;  2YJJ A;  4P18 A;  2CN7 A;  3F32 A;  1NNQ A;  5HJF A;  5D8Q A;  2V2S A;  3AJP A;  1SOF A;  3OGH A;  2Z90 A;  3Q4R A;  4MUD A;  1JGC A;  3SHX A;  5J8W A;  1TJO A;  2YJK A;  3RBC A;  2QQY A;  1JI4 A;  3E1J A;  3FI6 A;  2YW6 A;  2V2P A;  2Z5R A;  3KA4 A;  4TOH A;  2CLB A;  1IES A;  3E1O A;  4LYX A;  2BK6 A;  3WVV A;  2GS4 A;  3RD0 A;  5FFD A;  4M33 A;  5I4J A;  3KXU A;  3HL1 A;  4TOF A;  4PGI A;  1AEW A;  1VLG A;  3PWQ A;  3SE1 A;  2CLU A;  4ISP A;  4PG1 A;  2WLA A;  5E2D A;  1YUZ A;  1S3Q A;  3O7R A;  4ERU A;  3R2L A;  2C41 A;  2C6R A;  2CHP A;  2WTL A;  1LKP A;  4RC6 A;  3MPS A;  5FFB A;  3WVU A;  1VEI A;  2OC5 A;  5ERK A;  4M35 A;  3PW8 A;  4M34 A;  2W0O A;  1JKU A;  1VEQ A;  1NF4 A;  3AK8 A;  1KRQ A;  2Z5Q A;  4DYY A;  4DZ0 A;  1GWG A;  5HJH A;  1JYB A;  3AJQ A;  1UMN A;  4ZJK A;  4KVS A;  4MKU A;  1Z6O M;  3BVL A;  4DI0 A;  1RCC A;  3F38 A;  2Y3Q A;  4PG0 A;  4TOG A;  5HQO A;  4TOD A;  2OH3 A;  5D8O A;  3ISF A;  4M32 A;  1MOJ A;  4MN9 A;  1LKM A;  3NP0 X;  4EVC A;  1HRS A;  3R2H A;  4PGK A;  5CMR A;  5ERJ A;  2IU2 A;  5D8R A;  4DAS A;  2IY4 A;  3GVY A;  5GU3 X;  4Z3B A;  3U90 A;  2YW7 A;  4ISM A;  4CVT A;  1OTK A;  3BKN A;  3Q4O A;  3E6R A;  1NFV A;  1RCG A;  3UNO A;  1Z6O A;  4DYU A;  3EGM A;  4ETR A;  4DYX A;  3ISE A;  3Q4N A;  2C2U A;  1L8I A;  3QD8 A;  2WLU A;  3F37 A;  2VXI A;  2F7N A;  2FKZ A;  2CN6 A;  3AF8 X;  3UOF A;  3A68 A;  3E1P A;  4EVB A;  3FSE A;  4XKU A;  1XZ3 A;  1IER A;  2ZA7 A;  4KVR A;  2FZF A;  2FHA A;  4CY9 A;  4RC5 B;  3QHB A;  4ITW A;  3F34 A;  3HIU A;  2V2J A;  3RGD A;  2IB0 A;  4TOC A;  2ZG8 X;  2ZA6 A;  3F35 A;  4R42 A;  3AF9 X;  1JTS A;  1XZ1 A;  4CVR A;  2FJC A;  3QZ3 A;  1N1Q A;  5J8S A;  3E1Q A;  4DYZ A;  1R03 A;  4CMY A;  1BFR A;  1LKO A;  3BVE A;  5E1U A;  5GN8 B;  2JD8 0;  5JAC A;  2ZG7 X;  2ZA8 A;  1TK6 A;  2UX1 A;  5D8S A;  4KVQ A;  4LYU A;  1JKV A;  3EZ0 A;  1H96 A;  4TO9 A;  1SQ3 A;  5FEJ A;  1ZS3 A;  4ZKH A; 
#chains in the Genus database with same CATH topology
 3GE4 A;  4LPJ A;  4CYA A;  5K52 A;  3BVI A;  4LQH A;  4E6K A;  4AM4 A;  5LS9 A;  3RE7 A;  3UOI A;  5LG8 A;  3VVA A;  2HTN A;  2C2J A;  4ZMC A;  4II4 B;  2Z5P A;  1S30 A;  3OJ5 A;  4QUW A;  4U3G A;  4IXK A;  3KWO A;  4XGS A;  2QF9 A;  2GYQ A;  1VEL A;  3Q4Q A;  4YKH A;  2FG8 A;  2VXX A;  4Y08 A;  1JIG A;  3R2K A;  5JKL A;  4IWK A;  3PZA A;  1RCI A;  4LQV A;  4CVP A;  3AK9 A;  3GGY A;  4ZLW A;  3FVB A;  2GYD A;  4Z5S A;  4YXM A;  1B71 A;  2JD6 0;  1VJX A;  3SH6 A;  2V2O A;  3PVY B;  3TA8 A;  5GOU A;  4W4L B;  3GGZ A;  3FRR A;  1RCD A;  5GU0 X;  3F39 A;  2BW1 A;  4ZKX A;  4MXP A;  4RC6 B;  2C2F A;  1FHA A;  1DPS A;  5JKL G;  2HR5 A;  4CVS A;  2FG4 A;  4MJY A;  1QGH A;  1Z4A A;  5LBH A;  3WVW A;  3DBY A;  3NP2 X;  5AXS A;  2D5K A;  5FFA A;  5CZU A;  3AJO A;  3F36 A;  2XGW A;  5CMQ A;  1YUX A;  3QHC A;  1ZUJ A;  1YV1 A;  3AF7 X;  3KA8 A;  3FRS A;  3WNW A;  1JRE A;  3PW8 C;  4WJG 4;  3O7S A;  4AM5 A;  3PVR B;  3GHQ A;  1LB3 A;  3PVT B;  4RC7 B;  4RC8 A;  1UVH A;  3PW1 B;  3RAV A;  3JZ9 A;  4TW3 A;  3H7G A;  2XJO A;  3E2C A;  3QB9 A;  2CHI A;  1BCF A;  4IWJ A;  3R2O A;  4XKS A;  3UFB A;  4TOB A;  5D8X A;  1O9I A;  5IX6 A;  4ZTT A;  4II4 A;  3IS7 A;  1RCE A;  2MGY A;  3IS8 A;  3SID A;  4CYB A;  4XKT A;  1F30 A;  4EVE A;  2AR0 A;  2XJM A;  4OYN A;  3QVD A;  5FFC A;  3D19 A;  2V2L A;  3R2R A;  2OKC A;  4ZL6 A;  2ITB A;  2G38 B;  4ZL5 A;  2V2N A;  3F33 A;  5GU1 X;  2VZB A;  4TOE A;  2X17 0;  5JDO B;  4TOA A;  2V8T A;  2V15 A;  2Z6M A;  5LG2 A;  3PVY A;  2PYB A;  2JD7 0;  2ZG9 X;  4A25 A;  2RBD A;  4ZKW A;  3EZU A;  1JI5 A;  3KA9 A;  2N02 A;  5J93 A;  4DE6 A;  3BT5 A;  3ES3 A;  3VNX A;  4LQJ A;  1RYT A;  3PWF A;  2BJY A;  3BVK A;  2XKQ A;  1J30 A;  5D8Y A;  3IQ1 A;  5GU2 X;  4MY7 A;  1QYB A;  1EUM A;  2CEI A;  4AM2 A;  1DVB A;  3E6S A;  5C6F A;  2CF7 A;  3BVF A;  2ZUR X;  1S2Z A;  2G4H A;  3E1N A;  1NF6 A;  5JKM A;  3NOZ X;  3KX9 A;  3PVR A;  1MFR A;  1L8H A;  3KA6 A;  3C23 A;  3PVT A;  1F33 A;  4RC7 A;  1DAT A;  1TKP A;  4REU A;  3KA3 A;  2V2M A;  4CMY V;  3R2M A;  4ITT A;  3PW1 A;  4RC5 A;  3E1L A;  4LQN A;  2V2R A;  5D8P A;  1BG7 A;  3W54 A;  3PWQ C;  5FFE A;  3A9Q A;  2V2I A;  4LPN A;  5K53 A;  3E1M A;  4LPM A;  5JKM G;  5HU6 D;  3T9J A;  4ML5 A;  4EVD A;  5GN8 A;  3R2S A;  5J9V A;  3C21 A;  3ERZ A;  2XJN A;  3V3K B;  2FFX J;  1O9R A;  2BKC A;  2CIH A;  2FL0 A;  1TKO A;  3VV9 A;  5JDO A;  2YJJ A;  4P18 A;  2CWL A;  2CN7 A;  3F32 A;  1NNQ A;  5HJF A;  5D8Q A;  2V2S A;  3AJP A;  1SOF A;  3OGH A;  2Z90 A;  3Q4R A;  4MUD A;  1JGC A;  3SHX A;  4E40 A;  5J8W A;  1TJO A;  2YJK A;  3RBC A;  2QQY A;  1JI4 A;  3E1J A;  3FI6 A;  2YW6 A;  2V2P A;  2Z5R A;  3KA4 A;  4TOH A;  2CLB A;  1IES A;  3E1O A;  4LYX A;  2BK6 A;  3WVV A;  2GS4 A;  3RD0 A;  5FFD A;  4M33 A;  5I4J A;  3KXU A;  3HL1 A;  4TOF A;  3KDQ A;  4PGI A;  1AEW A;  1VLG A;  3PWQ A;  3SE1 A;  2CLU A;  4ISP A;  4PG1 A;  4X0J A;  2WLA A;  5E2D A;  1YUZ A;  1S3Q A;  3O7R A;  4ERU A;  3R2L A;  2C41 A;  2C6R A;  2CHP A;  2WTL A;  1LKP A;  4RC6 A;  3MPS A;  5FFB A;  3WVU A;  1VEI A;  2OC5 A;  5ERK A;  4M35 A;  3PW8 A;  4M34 A;  2W0O A;  1JKU A;  1VEQ A;  1NF4 A;  3AK8 A;  3KHK A;  1KRQ A;  2Z5Q A;  4DYY A;  4DZ0 A;  1GWG A;  5HJH A;  1JYB A;  3AJQ A;  1UMN A;  4ZJK A;  4KVS A;  4MKU A;  1Z6O M;  3BVL A;  4DI0 A;  1RCC A;  3F38 A;  2Y3Q A;  4W4K B;  4PG0 A;  4TOG A;  5HQO A;  4TOD A;  2OH3 A;  5D8O A;  3ISF A;  4M32 A;  1MOJ A;  4MN9 A;  1LKM A;  3NP0 X;  4EVC A;  1HRS A;  3R2H A;  4PGK A;  5CMR A;  5ERJ A;  2IU2 A;  5D8R A;  4DAS A;  2IY4 A;  3GVY A;  5GU3 X;  4Z3B A;  3C1Z A;  3U90 A;  2YW7 A;  2WWX B;  2V8U A;  4ISM A;  4CVT A;  1OTK A;  4YXJ A;  3BKN A;  3Q4O A;  3E6R A;  3M6J A;  1NFV A;  1RCG A;  3UNO A;  1Z6O A;  3N6O A;  4DYU A;  3EGM A;  4ETR A;  4DYX A;  3ISE A;  3Q4N A;  4KXR B;  2C2U A;  1L8I A;  3QD8 A;  2WLU A;  3F37 A;  2VXI A;  2F7N A;  2FKZ A;  2CN6 A;  3AF8 X;  3UOF A;  3A68 A;  3E1P A;  4EVB A;  3FSE A;  3JZA B;  4XKU A;  1XZ3 A;  1IER A;  2ZA7 A;  4KVR A;  2FZF A;  2FHA A;  4CY9 A;  4RC5 B;  3QHB A;  3LKD A;  4ITW A;  3L0M A;  4YVZ A;  3F34 A;  3HIU A;  2V2J A;  3RGD A;  2IB0 A;  2Y44 A;  4TOC A;  2ZG8 X;  2ZA6 A;  3F35 A;  4R42 A;  3AF9 X;  1JTS A;  1XZ1 A;  4CVR A;  2FJC A;  3QZ3 A;  1N1Q A;  5J8S A;  3E1Q A;  4DYZ A;  1R03 A;  4CMY A;  1BFR A;  1LKO A;  3BVE A;  5E1U A;  5GN8 B;  3C1Y A;  2JD8 0;  5JAC A;  2ZG7 X;  2ZA8 A;  1TK6 A;  2UX1 A;  5D8S A;  4KVQ A;  4LYU A;  1JKV A;  3EZ0 A;  1H96 A;  4TO9 A;  1SQ3 A;  5FEJ A;  1ZS3 A;  4ZKH A; 
#chains in the Genus database with same CATH homology
 3GE4 A;  4LPJ A;  4CYA A;  5K52 A;  3BVI A;  4LQH A;  4E6K A;  4AM4 A;  5LS9 A;  3RE7 A;  3UOI A;  5LG8 A;  3VVA A;  2HTN A;  2C2J A;  4ZMC A;  4II4 B;  2Z5P A;  1S30 A;  3OJ5 A;  4QUW A;  4U3G A;  4IXK A;  3KWO A;  4XGS A;  2QF9 A;  2GYQ A;  1VEL A;  3Q4Q A;  4YKH A;  2FG8 A;  2VXX A;  4Y08 A;  1JIG A;  3R2K A;  5JKL A;  4IWK A;  3PZA A;  1RCI A;  4LQV A;  4CVP A;  3AK9 A;  3GGY A;  4ZLW A;  3FVB A;  2GYD A;  4Z5S A;  4YXM A;  1B71 A;  2JD6 0;  1VJX A;  3SH6 A;  2V2O A;  3PVY B;  3TA8 A;  5GOU A;  4W4L B;  3GGZ A;  3FRR A;  1RCD A;  5GU0 X;  3F39 A;  2BW1 A;  4ZKX A;  4MXP A;  4RC6 B;  2C2F A;  1FHA A;  1DPS A;  5JKL G;  2HR5 A;  4CVS A;  2FG4 A;  4MJY A;  1QGH A;  1Z4A A;  5LBH A;  3WVW A;  3DBY A;  3NP2 X;  5AXS A;  2D5K A;  5FFA A;  5CZU A;  3AJO A;  3F36 A;  2XGW A;  5CMQ A;  1YUX A;  3QHC A;  1ZUJ A;  1YV1 A;  3AF7 X;  3KA8 A;  3FRS A;  3WNW A;  1JRE A;  3PW8 C;  4WJG 4;  3O7S A;  4AM5 A;  3PVR B;  3GHQ A;  1LB3 A;  3PVT B;  4RC7 B;  4RC8 A;  1UVH A;  3PW1 B;  3RAV A;  3JZ9 A;  4TW3 A;  3H7G A;  2XJO A;  3E2C A;  3QB9 A;  2CHI A;  1BCF A;  4IWJ A;  3R2O A;  4XKS A;  3UFB A;  4TOB A;  5D8X A;  1O9I A;  5IX6 A;  4ZTT A;  4II4 A;  3IS7 A;  1RCE A;  2MGY A;  3IS8 A;  3SID A;  4CYB A;  4XKT A;  1F30 A;  4EVE A;  2AR0 A;  2XJM A;  4OYN A;  3QVD A;  5FFC A;  3D19 A;  2V2L A;  3R2R A;  2OKC A;  4ZL6 A;  2ITB A;  2G38 B;  4ZL5 A;  2V2N A;  3F33 A;  5GU1 X;  2VZB A;  4TOE A;  2X17 0;  5JDO B;  4TOA A;  2V8T A;  2V15 A;  2Z6M A;  5LG2 A;  3PVY A;  2PYB A;  2JD7 0;  2ZG9 X;  4A25 A;  2RBD A;  4ZKW A;  3EZU A;  1JI5 A;  3KA9 A;  2N02 A;  5J93 A;  4DE6 A;  3BT5 A;  3ES3 A;  3VNX A;  4LQJ A;  1RYT A;  3PWF A;  2BJY A;  3BVK A;  2XKQ A;  1J30 A;  5D8Y A;  3IQ1 A;  5GU2 X;  4MY7 A;  1QYB A;  1EUM A;  2CEI A;  4AM2 A;  1DVB A;  3E6S A;  5C6F A;  2CF7 A;  3BVF A;  2ZUR X;  1S2Z A;  2G4H A;  3E1N A;  1NF6 A;  5JKM A;  3NOZ X;  3KX9 A;  3PVR A;  1MFR A;  1L8H A;  3KA6 A;  3C23 A;  3PVT A;  1F33 A;  4RC7 A;  1DAT A;  1TKP A;  4REU A;  3KA3 A;  2V2M A;  4CMY V;  3R2M A;  4ITT A;  3PW1 A;  4RC5 A;  3E1L A;  4LQN A;  2V2R A;  5D8P A;  1BG7 A;  3W54 A;  3PWQ C;  5FFE A;  3A9Q A;  2V2I A;  4LPN A;  5K53 A;  3E1M A;  4LPM A;  5JKM G;  5HU6 D;  3T9J A;  4ML5 A;  4EVD A;  5GN8 A;  3R2S A;  5J9V A;  3C21 A;  3ERZ A;  2XJN A;  3V3K B;  2FFX J;  1O9R A;  2BKC A;  2CIH A;  2FL0 A;  1TKO A;  3VV9 A;  5JDO A;  2YJJ A;  4P18 A;  2CWL A;  2CN7 A;  3F32 A;  1NNQ A;  5HJF A;  5D8Q A;  2V2S A;  3AJP A;  1SOF A;  3OGH A;  2Z90 A;  3Q4R A;  4MUD A;  1JGC A;  3SHX A;  4E40 A;  5J8W A;  1TJO A;  2YJK A;  3RBC A;  2QQY A;  1JI4 A;  3E1J A;  3FI6 A;  2YW6 A;  2V2P A;  2Z5R A;  3KA4 A;  4TOH A;  2CLB A;  1IES A;  3E1O A;  4LYX A;  2BK6 A;  3WVV A;  2GS4 A;  3RD0 A;  5FFD A;  4M33 A;  5I4J A;  3KXU A;  3HL1 A;  4TOF A;  3KDQ A;  4PGI A;  1AEW A;  1VLG A;  3PWQ A;  3SE1 A;  2CLU A;  4ISP A;  4PG1 A;  4X0J A;  2WLA A;  5E2D A;  1YUZ A;  1S3Q A;  3O7R A;  4ERU A;  3R2L A;  2C41 A;  2C6R A;  2CHP A;  2WTL A;  1LKP A;  4RC6 A;  3MPS A;  5FFB A;  3WVU A;  1VEI A;  2OC5 A;  5ERK A;  4M35 A;  3PW8 A;  4M34 A;  2W0O A;  1JKU A;  1VEQ A;  1NF4 A;  3AK8 A;  3KHK A;  1KRQ A;  2Z5Q A;  4DYY A;  4DZ0 A;  1GWG A;  5HJH A;  1JYB A;  3AJQ A;  1UMN A;  4ZJK A;  4KVS A;  4MKU A;  1Z6O M;  3BVL A;  4DI0 A;  1RCC A;  3F38 A;  2Y3Q A;  4W4K B;  4PG0 A;  4TOG A;  5HQO A;  4TOD A;  2OH3 A;  5D8O A;  3ISF A;  4M32 A;  1MOJ A;  4MN9 A;  1LKM A;  3NP0 X;  4EVC A;  1HRS A;  3R2H A;  4PGK A;  5CMR A;  5ERJ A;  2IU2 A;  5D8R A;  4DAS A;  2IY4 A;  3GVY A;  5GU3 X;  4Z3B A;  3C1Z A;  3U90 A;  2YW7 A;  2WWX B;  2V8U A;  4ISM A;  4CVT A;  1OTK A;  4YXJ A;  3BKN A;  3Q4O A;  3E6R A;  3M6J A;  1NFV A;  1RCG A;  3UNO A;  1Z6O A;  3N6O A;  4DYU A;  3EGM A;  4ETR A;  4DYX A;  3ISE A;  3Q4N A;  4KXR B;  2C2U A;  1L8I A;  3QD8 A;  2WLU A;  3F37 A;  2VXI A;  2F7N A;  2FKZ A;  2CN6 A;  3AF8 X;  3UOF A;  3A68 A;  3E1P A;  4EVB A;  3FSE A;  3JZA B;  4XKU A;  1XZ3 A;  1IER A;  2ZA7 A;  4KVR A;  2FZF A;  2FHA A;  4CY9 A;  4RC5 B;  3QHB A;  3LKD A;  4ITW A;  3L0M A;  4YVZ A;  3F34 A;  3HIU A;  2V2J A;  3RGD A;  2IB0 A;  2Y44 A;  4TOC A;  2ZG8 X;  2ZA6 A;  3F35 A;  4R42 A;  3AF9 X;  1JTS A;  1XZ1 A;  4CVR A;  2FJC A;  3QZ3 A;  1N1Q A;  5J8S A;  3E1Q A;  4DYZ A;  1R03 A;  4CMY A;  1BFR A;  1LKO A;  3BVE A;  5E1U A;  5GN8 B;  3C1Y A;  2JD8 0;  5JAC A;  2ZG7 X;  2ZA8 A;  1TK6 A;  2UX1 A;  5D8S A;  4KVQ A;  4LYU A;  1JKV A;  3EZ0 A;  1H96 A;  4TO9 A;  1SQ3 A;  5FEJ A;  1ZS3 A;  4ZKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...