3QHCA

Crystal structure of symerythrin from cyanophora paradoxa, reduced with dithionite
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
179
structure length
179
Chain Sequence
GLNYNQEDFMGLDRFFQDAVSHNNTDANAASSIEVEMYECDCMYPTFAEIARRSGQPEIGAMFDAIAKEEGMHAQLLTKLYSELEVKDSAETLEAKRLVSTIESQIDAVASDSRGLRRALETALEVETIESQKTYPAFAKLAAEQGNMEVATAFEAIVKSETKHANWVKRALENLLEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Symerythrin
publication title Symerythrin structures at atomic resolution and the origins of rubrerythrins and the ferritin-like superfamily.
pubmed doi rcsb
source organism Cyanophora paradoxa
molecule tags Oxidoreductase
total genus 81
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3qhcA00
3RD0A 2ZA7A 1MOJA 5E2DA 1IERA 2ZG8X 3KA4A 2VZBA 4ML5A 3AF9X 2BKCA 3QZ3A 2GS4A 1HRSA 2V2MA 4LQNA 4OYNA 3ISEA 5J9VA 5D8YA 5I4JA 4TOCA 3EZ0A 3WVWA 5FFBA 3SH6A 4KVRA 2C2JA 2OC5A 2BK6A 4MUDA 2XJNA 4DYUA 1O9IA 3AJPA 5GU3X 4M33A 2FL0A 1XZ1A 3E1LA 3QHCA 2Z5PA 3PVRA 4ZL6A 1R03A 3KX9A 1TKOA 4ZLWA 5CMQA 3EGMA 4LPNA 2C41A 5GN8A 4EVCA 1MFRA 2F7NA 2OH3A 2Z5QA 1BG7A 4II4A 2V2NA 3WNWA 3F37A 1RYTA 2C2FA 2GYQA 4CVRA 3QB9A 2FFXJ 1O9RA 3PVYB 3PW8A 1LKOA 5D8QA 1XZ3A 1Z4AA 4LQJA 3UOIA 5GOUA 4ZJKA 3Q4NA 1VEIA 3E1NA 4MKUA 4RC5B 3OJ5A 5GU1X 4ITWA 2ITBA 1Z6OA 4DYXA 4TODA 1S2ZA 3E1JA 3ES3A 2ZA6A 2XKQA 2V15A 3HL1A 1RCCA 5FFEA 3O7SA 2C2UA 1RCEA 3A9QA 2ZG9X 1JGCA 3QD8A 2JD70 1LKPA 5HJHA 4ETRA 3PW1A 4LPJA 2CF7A 1S30A 3F36A 1RCIA 1B71A 1JI4A 2XJMA 2WLUA 2V2IA 1QGHA 3E1OA 2ZA8A 2HR5A 4Y08A 3U90A 1VLGA 3ERZA 3FVBA 4II4B 4PG0A 3PWQA 4RC6B 2XJOA 5LS9A 3E1QA 5FFDA 1JYBA 2X170 1ZS3A 4CY9A 3GE4A 4PGKA 3BVFA 2CHIA 3WVUA 3EZUA 2D5KA 1UVHA 3HIUA 1BCFA 4M35A 4ZKWA 5K53A 2FHAA 3NOZX 3PZAA 2CHPA 3Q4QA 1KRQA 2C6RA 3PVTA 4MN9A 3PW8C 2ZG7X 5LG2A 2FG8A 5CMRA 3MPSA 2G4HA 2GYDA 5D8PA 1JIGA 2CLBA 4CVTA 4ITTA 3R2OA 3KWOA 1SOFA 1TJOA 2QF9A 5JKLA 3O7RA 4DZ0A 5JKMG 3NP0X 1ZUJA 4U3GA 3E2CA 4Z3BA 4DYZA 3AK9A 1VELA 3R2HA 5FEJA 4AM5A 3WVVA 5J8WA 1LB3A 2V2OA 3E6SA 3R2RA 4AM4A 1F33A 5HQOA 3NP2X 5GU2X 3RBCA 2QQYA 4REUA 4CMYA 3H7GA 2VXXA 3BVIA 2W0OA 4DASA 3PWQC 2RBDA 4LYXA 2WLAA 4M34A 4RC7A 1DATA 5LG8A 1YV1A 1RCDA 2CN6A 3AF8X 4DYYA 3SE1A 3T9JA 3AJOA 3R2MA 3F32A 1SQ3A 5J93A 2Y3QA 1FHAA 4ISMA 4CVPA 1L8HA 4TW3A 3E1PA 3AF7X 4TO9A 3PVRB 1NF6A 3IS8A 1L8IA 4P18A 3E6RA 3OGHA 5AXSA 4AM2A 3RE7A 4CMYV 1JTSA 3QVDA 2CLUA 1DPSA 3R2KA 4PGIA 4LYUA 5ERJA 3UOFA 3F35A 1S3QA 4XKTA 5GN8B 1BFRA 2Z5RA 3RAVA 2BJYA 4LPMA 1QYBA 5JACA 1AEWA 2IY4A 4R42A 3E1MA 5C6FA 2WTLA 1YUZA 4CYAA 3Q4RA 2IB0A 4LQVA 4TOFA 3AK8A 5CZUA 1RCGA 4KVSA 2V2LA 3IQ1A 2V2RA 2CIHA 2HTNA 3KA8A 5LBHA 3TA8A 3UNOA 4CYBA 4XKUA 2YW7A 4A25A 1NNQA 1JKVA 5JKLG 2BW1A 1GWGA 4PG1A 3BT5A 3SIDA 3SHXA 3PW1B 4XGSA 4Z5SA 3PVYA 5HJFA 1J30A 1JREA 4TOAA 4ZTTA 4TOHA 4EVDA 2JD60 5J8SA 3F39A 2FZFA 2ZURX 4MY7A 4TOBA 3BKNA 4RC5A 3GVYA 4ZL5A 4ZMCA 1JKUA 3IS7A 3FSEA 3FI6A 4KVQA 4QUWA 1TK6A 1DVBA 3QHBA 1VEQA 4ZKHA 2YJKA 1LKMA 3BVKA 1TKPA 3AJQA 3F38A 2FG4A 2FKZA 4IWKA 1OTKA 5ERKA 5FFAA 4EVEA 2Z90A 2YJJA 3PVTB 2XGWA 5D8XA 3KA9A 5E1UA 4RC8A 4RC6A 3Q4OA 5JKMA 4TOEA 2CEIA 3BVEA 4IXKA 2IU2A 4MJYA 4ERUA 2Z6MA 1N1QA 1JI5A 3A68A 3R2SA 3R2LA 1IESA 1VJXA 4YKHA 3KA3A 3BVLA 3GHQA 2V2SA 5D8OA 4ZKXA 4XKSA 4CVSA 4EVBA 4E6KA 1Z6OM 2FJCA 3KA6A 1YUXA 3PWFA 1H96A 5GU0X 5K52A 3F33A 4TOGA 1F30A 3RGDA 4DE6A 5D8SA 5FFCA 4RC7B 2V2JA 3F34A 4M32A 3ISFA 1EUMA 2YW6A 5IX6A 4IWJA 5D8RA 4LQHA 2VXIA 1NF4A 1UMNA 2JD80 3VNXA 4ISPA 1NFVA 2CN7A 3KXUA 2UX1A 2V2PA 4DI0A 2PYBA
chains in the Genus database with same CATH superfamily
3RD0A 2ZA7A 1MOJA 5E2DA 1IERA 2ZG8X 3KA4A 2VZBA 4ML5A 3AF9X 2BKCA 3FRRA 3QZ3A 2GS4A 1HRSA 2V2MA 4LQNA 4OYNA 3ISEA 5J9VA 5D8YA 5I4JA 4TOCA 2N02A 3EZ0A 3WVWA 5FFBA 3SH6A 4KVRA 2C2JA 2OC5A 2BK6A 4MUDA 2XJNA 4DYUA 1O9IA 3AJPA 3FRSA 5GU3X 4M33A 2FL0A 1XZ1A 2AR0A 3E1LA 3QHCA 2Z5PA 3PVRA 4ZL6A 1R03A 3KX9A 1TKOA 4ZLWA 5CMQA 3EGMA 4LPNA 2C41A 3C23A 5GN8A 4EVCA 1MFRA 2F7NA 2OH3A 2Z5QA 1BG7A 4II4A 2V2NA 3WNWA 3F37A 1RYTA 2C2FA 2GYQA 3LKDA 4CVRA 3QB9A 2FFXJ 1O9RA 3PVYB 3PW8A 1LKOA 5D8QA 1XZ3A 1Z4AA 4LQJA 3JZ9A 3UOIA 5GOUA 3C1ZA 3Q4NA 4ZJKA 3L0MA 1VEIA 4KXRB 3KDQA 3E1NA 4MKUA 4RC5B 3OJ5A 5GU1X 4ITWA 2ITBA 1Z6OA 4DYXA 4TODA 1S2ZA 3E1JA 3ES3A 2ZA6A 2XKQA 2V15A 3HL1A 1RCCA 5FFEA 3UFBA 3O7SA 2C2UA 1RCEA 3A9QA 2ZG9X 1JGCA 3QD8A 2JD70 1LKPA 5HJHA 4ETRA 3PW1A 4LPJA 2CF7A 1S30A 3F36A 2V8UA 1RCIA 1B71A 1JI4A 2XJMA 2WLUA 2V2IA 1QGHA 3E1OA 2ZA8A 2HR5A 4Y08A 3U90A 1VLGA 3ERZA 3FVBA 4II4B 4PG0A 3PWQA 4RC6B 2XJOA 5LS9A 3E1QA 5FFDA 1JYBA 2X170 1ZS3A 4CY9A 3GE4A 4PGKA 3W54A 3BVFA 2CHIA 3WVUA 3EZUA 2D5KA 2WWXB 1UVHA 3HIUA 1BCFA 5JDOA 3GGYA 4M35A 4ZKWA 5K53A 2FHAA 3NOZX 3PZAA 2CHPA 3Q4QA 1KRQA 2C6RA 3PVTA 4MN9A 3PW8C 2ZG7X 5LG2A 2FG8A 5CMRA 3MPSA 2G4HA 2GYDA 5D8PA 1JIGA 2CLBA 4CVTA 4ITTA 3R2OA 3KWOA 1SOFA 1TJOA 2QF9A 5JKLA 3O7RA 4DZ0A 5JKMG 3NP0X 3JZAB 1ZUJA 4U3GA 3E2CA 4Z3BA 2V8TA 4DYZA 2G38B 3AK9A 1VELA 3R2HA 5FEJA 4AM5A 3WVVA 2OKCA 5J8WA 1LB3A 2V2OA 3E6SA 3R2RA 4AM4A 1F33A 5HQOA 3NP2X 5GU2X 3RBCA 2QQYA 4REUA 4CMYA 3H7GA 2VXXA 3BVIA 2W0OA 4DASA 3PWQC 2RBDA 4LYXA 2WLAA 4M34A 4RC7A 1DATA 5LG8A 3V3KB 2MGYA 1YV1A 1RCDA 2CN6A 3AF8X 4DYYA 4X0JA 3SE1A 3T9JA 4E40A 3AJOA 3R2MA 3M6JA 3F32A 1SQ3A 5J93A 2Y3QA 1FHAA 4ISMA 4CVPA 1L8HA 4TW3A 3E1PA 3AF7X 2Y44A 4TO9A 3PVRB 1NF6A 3IS8A 1L8IA 4P18A 3E6RA 3OGHA 5AXSA 4AM2A 3RE7A 4CMYV 1JTSA 3QVDA 4YXJA 2CLUA 1DPSA 3R2KA 4PGIA 4LYUA 5ERJA 3UOFA 3F35A 1S3QA 4XKTA 5GN8B 2CWLA 4W4KB 1BFRA 2Z5RA 3RAVA 2BJYA 4LPMA 1QYBA 5JACA 4YVZA 1AEWA 2IY4A 4R42A 3E1MA 5C6FA 2WTLA 1YUZA 4CYAA 3Q4RA 2IB0A 4LQVA 3VV9A 4TOFA 3C21A 3AK8A 5CZUA 1RCGA 4KVSA 2V2LA 3IQ1A 2V2RA 2CIHA 2HTNA 3KA8A 5LBHA 3TA8A 3UNOA 4CYBA 4XKUA 2YW7A 4A25A 1NNQA 1JKVA 5JKLG 2BW1A 1GWGA 4PG1A 5HU6D 3BT5A 3SIDA 3SHXA 3PW1B 4XGSA 3VVAA 4Z5SA 3PVYA 5HJFA 1J30A 1JREA 4TOAA 4ZTTA 4TOHA 4EVDA 2JD60 5J8SA 3F39A 2FZFA 2ZURX 4MY7A 4TOBA 3BKNA 4W4LB 4RC5A 4MXPA 3GVYA 4ZL5A 4ZMCA 1JKUA 3IS7A 3FSEA 3FI6A 4KVQA 4QUWA 1TK6A 1DVBA 3QHBA 1VEQA 4ZKHA 2YJKA 5JDOB 1LKMA 3BVKA 1TKPA 3AJQA 3F38A 2FG4A 2FKZA 4IWKA 1OTKA 5ERKA 5FFAA 4EVEA 2Z90A 2YJJA 3PVTB 2XGWA 5D8XA 3KA9A 5E1UA 4RC8A 4RC6A 3Q4OA 5JKMA 4TOEA 2CEIA 3BVEA 4IXKA 2IU2A 4MJYA 4ERUA 2Z6MA 1N1QA 1JI5A 3A68A 3R2SA 3R2LA 1IESA 1VJXA 3N6OA 4YKHA 3KA3A 3D19A 3KHKA 3BVLA 3GHQA 3C1YA 4WJG4 2V2SA 5D8OA 4ZKXA 4XKSA 4CVSA 4EVBA 4E6KA 4YXMA 1Z6OM 2FJCA 3KA6A 3GGZA 1YUXA 3PWFA 1H96A 5GU0X 5K52A 3F33A 4TOGA 1F30A 3RGDA 4DE6A 5D8SA 5FFCA 4RC7B 2V2JA 3F34A 4M32A 3ISFA 1EUMA 2YW6A 5IX6A 4IWJA 5D8RA 4LQHA 2VXIA 1NF4A 1UMNA 2JD80 3VNXA 4ISPA 1NFVA 2CN7A 3KXUA 2UX1A 2V2PA 3DBYA 4DI0A 2PYBA
chains in the Genus database with same CATH topology
3RD0A 2ZA7A 1MOJA 5E2DA 1IERA 2ZG8X 3KA4A 2VZBA 4ML5A 3AF9X 2BKCA 3FRRA 3QZ3A 2GS4A 1HRSA 2V2MA 4LQNA 4OYNA 3ISEA 5J9VA 5D8YA 5I4JA 4TOCA 2N02A 3EZ0A 3WVWA 5FFBA 3SH6A 4KVRA 2C2JA 2OC5A 2BK6A 4MUDA 2XJNA 4DYUA 1O9IA 3AJPA 3FRSA 5GU3X 4M33A 2FL0A 1XZ1A 2AR0A 3E1LA 3QHCA 2Z5PA 3PVRA 4ZL6A 1R03A 3KX9A 1TKOA 4ZLWA 5CMQA 3EGMA 4LPNA 2C41A 3C23A 5GN8A 4EVCA 1MFRA 2F7NA 2OH3A 2Z5QA 1BG7A 4II4A 2V2NA 3WNWA 3F37A 1RYTA 2C2FA 2GYQA 3LKDA 4CVRA 3QB9A 2FFXJ 1O9RA 3PVYB 3PW8A 1LKOA 5D8QA 1XZ3A 1Z4AA 4LQJA 3JZ9A 3UOIA 5GOUA 3C1ZA 3Q4NA 4ZJKA 3L0MA 1VEIA 4KXRB 3KDQA 3E1NA 4MKUA 4RC5B 3OJ5A 5GU1X 4ITWA 2ITBA 1Z6OA 4DYXA 4TODA 1S2ZA 3E1JA 3ES3A 2ZA6A 2XKQA 2V15A 3HL1A 1RCCA 5FFEA 3UFBA 3O7SA 2C2UA 1RCEA 3A9QA 2ZG9X 1JGCA 3QD8A 2JD70 1LKPA 5HJHA 4ETRA 3PW1A 4LPJA 2CF7A 1S30A 3F36A 2V8UA 1RCIA 1B71A 1JI4A 2XJMA 2WLUA 2V2IA 1QGHA 3E1OA 2ZA8A 2HR5A 4Y08A 3U90A 1VLGA 3ERZA 3FVBA 4II4B 4PG0A 3PWQA 4RC6B 2XJOA 5LS9A 3E1QA 5FFDA 1JYBA 2X170 1ZS3A 4CY9A 3GE4A 4PGKA 3W54A 3BVFA 2CHIA 3WVUA 3EZUA 2D5KA 2WWXB 1UVHA 3HIUA 1BCFA 5JDOA 3GGYA 4M35A 4ZKWA 5K53A 2FHAA 3NOZX 3PZAA 2CHPA 3Q4QA 1KRQA 2C6RA 3PVTA 4MN9A 3PW8C 2ZG7X 5LG2A 2FG8A 5CMRA 3MPSA 2G4HA 2GYDA 5D8PA 1JIGA 2CLBA 4CVTA 4ITTA 3R2OA 3KWOA 1SOFA 1TJOA 2QF9A 5JKLA 3O7RA 4DZ0A 5JKMG 3NP0X 3JZAB 1ZUJA 4U3GA 3E2CA 4Z3BA 2V8TA 4DYZA 2G38B 3AK9A 1VELA 3R2HA 5FEJA 4AM5A 3WVVA 2OKCA 5J8WA 1LB3A 2V2OA 3E6SA 3R2RA 4AM4A 1F33A 5HQOA 3NP2X 5GU2X 3RBCA 2QQYA 4REUA 4CMYA 3H7GA 2VXXA 3BVIA 2W0OA 4DASA 3PWQC 2RBDA 4LYXA 2WLAA 4M34A 4RC7A 1DATA 5LG8A 3V3KB 2MGYA 1YV1A 1RCDA 2CN6A 3AF8X 4DYYA 4X0JA 3SE1A 3T9JA 4E40A 3AJOA 3R2MA 3M6JA 3F32A 1SQ3A 5J93A 2Y3QA 1FHAA 4ISMA 4CVPA 1L8HA 4TW3A 3E1PA 3AF7X 2Y44A 4TO9A 3PVRB 1NF6A 3IS8A 1L8IA 4P18A 3E6RA 3OGHA 5AXSA 4AM2A 3RE7A 4CMYV 1JTSA 3QVDA 4YXJA 2CLUA 1DPSA 3R2KA 4PGIA 4LYUA 5ERJA 3UOFA 3F35A 1S3QA 4XKTA 5GN8B 2CWLA 4W4KB 1BFRA 2Z5RA 3RAVA 2BJYA 4LPMA 1QYBA 5JACA 4YVZA 1AEWA 2IY4A 4R42A 3E1MA 5C6FA 2WTLA 1YUZA 4CYAA 3Q4RA 2IB0A 4LQVA 3VV9A 4TOFA 3C21A 3AK8A 5CZUA 1RCGA 4KVSA 2V2LA 3IQ1A 2V2RA 2CIHA 2HTNA 3KA8A 5LBHA 3TA8A 3UNOA 4CYBA 4XKUA 2YW7A 4A25A 1NNQA 1JKVA 5JKLG 2BW1A 1GWGA 4PG1A 5HU6D 3BT5A 3SIDA 3SHXA 3PW1B 4XGSA 3VVAA 4Z5SA 3PVYA 5HJFA 1J30A 1JREA 4TOAA 4ZTTA 4TOHA 4EVDA 2JD60 5J8SA 3F39A 2FZFA 2ZURX 4MY7A 4TOBA 3BKNA 4W4LB 4RC5A 4MXPA 3GVYA 4ZL5A 4ZMCA 1JKUA 3IS7A 3FSEA 3FI6A 4KVQA 4QUWA 1TK6A 1DVBA 3QHBA 1VEQA 4ZKHA 2YJKA 5JDOB 1LKMA 3BVKA 1TKPA 3AJQA 3F38A 2FG4A 2FKZA 4IWKA 1OTKA 5ERKA 5FFAA 4EVEA 2Z90A 2YJJA 3PVTB 2XGWA 5D8XA 3KA9A 5E1UA 4RC8A 4RC6A 3Q4OA 5JKMA 4TOEA 2CEIA 3BVEA 4IXKA 2IU2A 4MJYA 4ERUA 2Z6MA 1N1QA 1JI5A 3A68A 3R2SA 3R2LA 1IESA 1VJXA 3N6OA 4YKHA 3KA3A 3D19A 3KHKA 3BVLA 3GHQA 3C1YA 4WJG4 2V2SA 5D8OA 4ZKXA 4XKSA 4CVSA 4EVBA 4E6KA 4YXMA 1Z6OM 2FJCA 3KA6A 3GGZA 1YUXA 3PWFA 1H96A 5GU0X 5K52A 3F33A 4TOGA 1F30A 3RGDA 4DE6A 5D8SA 5FFCA 4RC7B 2V2JA 3F34A 4M32A 3ISFA 1EUMA 2YW6A 5IX6A 4IWJA 5D8RA 4LQHA 2VXIA 1NF4A 1UMNA 2JD80 3VNXA 4ISPA 1NFVA 2CN7A 3KXUA 2UX1A 2V2PA 3DBYA 4DI0A 2PYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RD0 A;  2ZA7 A;  1MOJ A;  5E2D A;  1IER A;  2ZG8 X;  3KA4 A;  2VZB A;  4ML5 A;  3AF9 X;  2BKC A;  3QZ3 A;  2GS4 A;  1HRS A;  2V2M A;  4LQN A;  4OYN A;  3ISE A;  5J9V A;  5D8Y A;  5I4J A;  4TOC A;  3EZ0 A;  3WVW A;  5FFB A;  3SH6 A;  4KVR A;  2C2J A;  2OC5 A;  2BK6 A;  4MUD A;  2XJN A;  4DYU A;  1O9I A;  3AJP A;  5GU3 X;  4M33 A;  2FL0 A;  1XZ1 A;  3E1L A;  3QHC A;  2Z5P A;  3PVR A;  4ZL6 A;  1R03 A;  3KX9 A;  1TKO A;  4ZLW A;  5CMQ A;  3EGM A;  4LPN A;  2C41 A;  5GN8 A;  4EVC A;  1MFR A;  2F7N A;  2OH3 A;  2Z5Q A;  1BG7 A;  4II4 A;  2V2N A;  3WNW A;  3F37 A;  1RYT A;  2C2F A;  2GYQ A;  4CVR A;  3QB9 A;  2FFX J;  1O9R A;  3PVY B;  3PW8 A;  1LKO A;  5D8Q A;  1XZ3 A;  1Z4A A;  4LQJ A;  3UOI A;  5GOU A;  4ZJK A;  3Q4N A;  1VEI A;  3E1N A;  4MKU A;  4RC5 B;  3OJ5 A;  5GU1 X;  4ITW A;  2ITB A;  1Z6O A;  4DYX A;  4TOD A;  1S2Z A;  3E1J A;  3ES3 A;  2ZA6 A;  2XKQ A;  2V15 A;  3HL1 A;  1RCC A;  5FFE A;  3O7S A;  2C2U A;  1RCE A;  3A9Q A;  2ZG9 X;  1JGC A;  3QD8 A;  2JD7 0;  1LKP A;  5HJH A;  4ETR A;  3PW1 A;  4LPJ A;  2CF7 A;  1S30 A;  3F36 A;  1RCI A;  1B71 A;  1JI4 A;  2XJM A;  2WLU A;  2V2I A;  1QGH A;  3E1O A;  2ZA8 A;  2HR5 A;  4Y08 A;  3U90 A;  1VLG A;  3ERZ A;  3FVB A;  4II4 B;  4PG0 A;  3PWQ A;  4RC6 B;  2XJO A;  5LS9 A;  3E1Q A;  5FFD A;  1JYB A;  2X17 0;  1ZS3 A;  4CY9 A;  3GE4 A;  4PGK A;  3BVF A;  2CHI A;  3WVU A;  3EZU A;  2D5K A;  1UVH A;  3HIU A;  1BCF A;  4M35 A;  4ZKW A;  5K53 A;  2FHA A;  3NOZ X;  3PZA A;  2CHP A;  3Q4Q A;  1KRQ A;  2C6R A;  3PVT A;  4MN9 A;  3PW8 C;  2ZG7 X;  5LG2 A;  2FG8 A;  5CMR A;  3MPS A;  2G4H A;  2GYD A;  5D8P A;  1JIG A;  2CLB A;  4CVT A;  4ITT A;  3R2O A;  3KWO A;  1SOF A;  1TJO A;  2QF9 A;  5JKL A;  3O7R A;  4DZ0 A;  5JKM G;  3NP0 X;  1ZUJ A;  4U3G A;  3E2C A;  4Z3B A;  4DYZ A;  3AK9 A;  1VEL A;  3R2H A;  5FEJ A;  4AM5 A;  3WVV A;  5J8W A;  1LB3 A;  2V2O A;  3E6S A;  3R2R A;  4AM4 A;  1F33 A;  5HQO A;  3NP2 X;  5GU2 X;  3RBC A;  2QQY A;  4REU A;  4CMY A;  3H7G A;  2VXX A;  3BVI A;  2W0O A;  4DAS A;  3PWQ C;  2RBD A;  4LYX A;  2WLA A;  4M34 A;  4RC7 A;  1DAT A;  5LG8 A;  1YV1 A;  1RCD A;  2CN6 A;  3AF8 X;  4DYY A;  3SE1 A;  3T9J A;  3AJO A;  3R2M A;  3F32 A;  1SQ3 A;  5J93 A;  2Y3Q A;  1FHA A;  4ISM A;  4CVP A;  1L8H A;  4TW3 A;  3E1P A;  3AF7 X;  4TO9 A;  3PVR B;  1NF6 A;  3IS8 A;  1L8I A;  4P18 A;  3E6R A;  3OGH A;  5AXS A;  4AM2 A;  3RE7 A;  4CMY V;  1JTS A;  3QVD A;  2CLU A;  1DPS A;  3R2K A;  4PGI A;  4LYU A;  5ERJ A;  3UOF A;  3F35 A;  1S3Q A;  4XKT A;  5GN8 B;  1BFR A;  2Z5R A;  3RAV A;  2BJY A;  4LPM A;  1QYB A;  5JAC A;  1AEW A;  2IY4 A;  4R42 A;  3E1M A;  5C6F A;  2WTL A;  1YUZ A;  4CYA A;  3Q4R A;  2IB0 A;  4LQV A;  4TOF A;  3AK8 A;  5CZU A;  1RCG A;  4KVS A;  2V2L A;  3IQ1 A;  2V2R A;  2CIH A;  2HTN A;  3KA8 A;  5LBH A;  3TA8 A;  3UNO A;  4CYB A;  4XKU A;  2YW7 A;  4A25 A;  1NNQ A;  1JKV A;  5JKL G;  2BW1 A;  1GWG A;  4PG1 A;  3BT5 A;  3SID A;  3SHX A;  3PW1 B;  4XGS A;  4Z5S A;  3PVY A;  5HJF A;  1J30 A;  1JRE A;  4TOA A;  4ZTT A;  4TOH A;  4EVD A;  2JD6 0;  5J8S A;  3F39 A;  2FZF A;  2ZUR X;  4MY7 A;  4TOB A;  3BKN A;  4RC5 A;  3GVY A;  4ZL5 A;  4ZMC A;  1JKU A;  3IS7 A;  3FSE A;  3FI6 A;  4KVQ A;  4QUW A;  1TK6 A;  1DVB A;  3QHB A;  1VEQ A;  4ZKH A;  2YJK A;  1LKM A;  3BVK A;  1TKP A;  3AJQ A;  3F38 A;  2FG4 A;  2FKZ A;  4IWK A;  1OTK A;  5ERK A;  5FFA A;  4EVE A;  2Z90 A;  2YJJ A;  3PVT B;  2XGW A;  5D8X A;  3KA9 A;  5E1U A;  4RC8 A;  4RC6 A;  3Q4O A;  5JKM A;  4TOE A;  2CEI A;  3BVE A;  4IXK A;  2IU2 A;  4MJY A;  4ERU A;  2Z6M A;  1N1Q A;  1JI5 A;  3A68 A;  3R2S A;  3R2L A;  1IES A;  1VJX A;  4YKH A;  3KA3 A;  3BVL A;  3GHQ A;  2V2S A;  5D8O A;  4ZKX A;  4XKS A;  4CVS A;  4EVB A;  4E6K A;  1Z6O M;  2FJC A;  3KA6 A;  1YUX A;  3PWF A;  1H96 A;  5GU0 X;  5K52 A;  3F33 A;  4TOG A;  1F30 A;  3RGD A;  4DE6 A;  5D8S A;  5FFC A;  4RC7 B;  2V2J A;  3F34 A;  4M32 A;  3ISF A;  1EUM A;  2YW6 A;  5IX6 A;  4IWJ A;  5D8R A;  4LQH A;  2VXI A;  1NF4 A;  1UMN A;  2JD8 0;  3VNX A;  4ISP A;  1NFV A;  2CN7 A;  3KXU A;  2UX1 A;  2V2P A;  4DI0 A;  2PYB A; 
#chains in the Genus database with same CATH topology
 3RD0 A;  2ZA7 A;  1MOJ A;  5E2D A;  1IER A;  2ZG8 X;  3KA4 A;  2VZB A;  4ML5 A;  3AF9 X;  2BKC A;  3FRR A;  3QZ3 A;  2GS4 A;  1HRS A;  2V2M A;  4LQN A;  4OYN A;  3ISE A;  5J9V A;  5D8Y A;  5I4J A;  4TOC A;  2N02 A;  3EZ0 A;  3WVW A;  5FFB A;  3SH6 A;  4KVR A;  2C2J A;  2OC5 A;  2BK6 A;  4MUD A;  2XJN A;  4DYU A;  1O9I A;  3AJP A;  3FRS A;  5GU3 X;  4M33 A;  2FL0 A;  1XZ1 A;  2AR0 A;  3E1L A;  3QHC A;  2Z5P A;  3PVR A;  4ZL6 A;  1R03 A;  3KX9 A;  1TKO A;  4ZLW A;  5CMQ A;  3EGM A;  4LPN A;  2C41 A;  3C23 A;  5GN8 A;  4EVC A;  1MFR A;  2F7N A;  2OH3 A;  2Z5Q A;  1BG7 A;  4II4 A;  2V2N A;  3WNW A;  3F37 A;  1RYT A;  2C2F A;  2GYQ A;  3LKD A;  4CVR A;  3QB9 A;  2FFX J;  1O9R A;  3PVY B;  3PW8 A;  1LKO A;  5D8Q A;  1XZ3 A;  1Z4A A;  4LQJ A;  3JZ9 A;  3UOI A;  5GOU A;  3C1Z A;  3Q4N A;  4ZJK A;  3L0M A;  1VEI A;  4KXR B;  3KDQ A;  3E1N A;  4MKU A;  4RC5 B;  3OJ5 A;  5GU1 X;  4ITW A;  2ITB A;  1Z6O A;  4DYX A;  4TOD A;  1S2Z A;  3E1J A;  3ES3 A;  2ZA6 A;  2XKQ A;  2V15 A;  3HL1 A;  1RCC A;  5FFE A;  3UFB A;  3O7S A;  2C2U A;  1RCE A;  3A9Q A;  2ZG9 X;  1JGC A;  3QD8 A;  2JD7 0;  1LKP A;  5HJH A;  4ETR A;  3PW1 A;  4LPJ A;  2CF7 A;  1S30 A;  3F36 A;  2V8U A;  1RCI A;  1B71 A;  1JI4 A;  2XJM A;  2WLU A;  2V2I A;  1QGH A;  3E1O A;  2ZA8 A;  2HR5 A;  4Y08 A;  3U90 A;  1VLG A;  3ERZ A;  3FVB A;  4II4 B;  4PG0 A;  3PWQ A;  4RC6 B;  2XJO A;  5LS9 A;  3E1Q A;  5FFD A;  1JYB A;  2X17 0;  1ZS3 A;  4CY9 A;  3GE4 A;  4PGK A;  3W54 A;  3BVF A;  2CHI A;  3WVU A;  3EZU A;  2D5K A;  2WWX B;  1UVH A;  3HIU A;  1BCF A;  5JDO A;  3GGY A;  4M35 A;  4ZKW A;  5K53 A;  2FHA A;  3NOZ X;  3PZA A;  2CHP A;  3Q4Q A;  1KRQ A;  2C6R A;  3PVT A;  4MN9 A;  3PW8 C;  2ZG7 X;  5LG2 A;  2FG8 A;  5CMR A;  3MPS A;  2G4H A;  2GYD A;  5D8P A;  1JIG A;  2CLB A;  4CVT A;  4ITT A;  3R2O A;  3KWO A;  1SOF A;  1TJO A;  2QF9 A;  5JKL A;  3O7R A;  4DZ0 A;  5JKM G;  3NP0 X;  3JZA B;  1ZUJ A;  4U3G A;  3E2C A;  4Z3B A;  2V8T A;  4DYZ A;  2G38 B;  3AK9 A;  1VEL A;  3R2H A;  5FEJ A;  4AM5 A;  3WVV A;  2OKC A;  5J8W A;  1LB3 A;  2V2O A;  3E6S A;  3R2R A;  4AM4 A;  1F33 A;  5HQO A;  3NP2 X;  5GU2 X;  3RBC A;  2QQY A;  4REU A;  4CMY A;  3H7G A;  2VXX A;  3BVI A;  2W0O A;  4DAS A;  3PWQ C;  2RBD A;  4LYX A;  2WLA A;  4M34 A;  4RC7 A;  1DAT A;  5LG8 A;  3V3K B;  2MGY A;  1YV1 A;  1RCD A;  2CN6 A;  3AF8 X;  4DYY A;  4X0J A;  3SE1 A;  3T9J A;  4E40 A;  3AJO A;  3R2M A;  3M6J A;  3F32 A;  1SQ3 A;  5J93 A;  2Y3Q A;  1FHA A;  4ISM A;  4CVP A;  1L8H A;  4TW3 A;  3E1P A;  3AF7 X;  2Y44 A;  4TO9 A;  3PVR B;  1NF6 A;  3IS8 A;  1L8I A;  4P18 A;  3E6R A;  3OGH A;  5AXS A;  4AM2 A;  3RE7 A;  4CMY V;  1JTS A;  3QVD A;  4YXJ A;  2CLU A;  1DPS A;  3R2K A;  4PGI A;  4LYU A;  5ERJ A;  3UOF A;  3F35 A;  1S3Q A;  4XKT A;  5GN8 B;  2CWL A;  4W4K B;  1BFR A;  2Z5R A;  3RAV A;  2BJY A;  4LPM A;  1QYB A;  5JAC A;  4YVZ A;  1AEW A;  2IY4 A;  4R42 A;  3E1M A;  5C6F A;  2WTL A;  1YUZ A;  4CYA A;  3Q4R A;  2IB0 A;  4LQV A;  3VV9 A;  4TOF A;  3C21 A;  3AK8 A;  5CZU A;  1RCG A;  4KVS A;  2V2L A;  3IQ1 A;  2V2R A;  2CIH A;  2HTN A;  3KA8 A;  5LBH A;  3TA8 A;  3UNO A;  4CYB A;  4XKU A;  2YW7 A;  4A25 A;  1NNQ A;  1JKV A;  5JKL G;  2BW1 A;  1GWG A;  4PG1 A;  5HU6 D;  3BT5 A;  3SID A;  3SHX A;  3PW1 B;  4XGS A;  3VVA A;  4Z5S A;  3PVY A;  5HJF A;  1J30 A;  1JRE A;  4TOA A;  4ZTT A;  4TOH A;  4EVD A;  2JD6 0;  5J8S A;  3F39 A;  2FZF A;  2ZUR X;  4MY7 A;  4TOB A;  3BKN A;  4W4L B;  4RC5 A;  4MXP A;  3GVY A;  4ZL5 A;  4ZMC A;  1JKU A;  3IS7 A;  3FSE A;  3FI6 A;  4KVQ A;  4QUW A;  1TK6 A;  1DVB A;  3QHB A;  1VEQ A;  4ZKH A;  2YJK A;  5JDO B;  1LKM A;  3BVK A;  1TKP A;  3AJQ A;  3F38 A;  2FG4 A;  2FKZ A;  4IWK A;  1OTK A;  5ERK A;  5FFA A;  4EVE A;  2Z90 A;  2YJJ A;  3PVT B;  2XGW A;  5D8X A;  3KA9 A;  5E1U A;  4RC8 A;  4RC6 A;  3Q4O A;  5JKM A;  4TOE A;  2CEI A;  3BVE A;  4IXK A;  2IU2 A;  4MJY A;  4ERU A;  2Z6M A;  1N1Q A;  1JI5 A;  3A68 A;  3R2S A;  3R2L A;  1IES A;  1VJX A;  3N6O A;  4YKH A;  3KA3 A;  3D19 A;  3KHK A;  3BVL A;  3GHQ A;  3C1Y A;  4WJG 4;  2V2S A;  5D8O A;  4ZKX A;  4XKS A;  4CVS A;  4EVB A;  4E6K A;  4YXM A;  1Z6O M;  2FJC A;  3KA6 A;  3GGZ A;  1YUX A;  3PWF A;  1H96 A;  5GU0 X;  5K52 A;  3F33 A;  4TOG A;  1F30 A;  3RGD A;  4DE6 A;  5D8S A;  5FFC A;  4RC7 B;  2V2J A;  3F34 A;  4M32 A;  3ISF A;  1EUM A;  2YW6 A;  5IX6 A;  4IWJ A;  5D8R A;  4LQH A;  2VXI A;  1NF4 A;  1UMN A;  2JD8 0;  3VNX A;  4ISP A;  1NFV A;  2CN7 A;  3KXU A;  2UX1 A;  2V2P A;  3DBY A;  4DI0 A;  2PYB A; 
#chains in the Genus database with same CATH homology
 3RD0 A;  2ZA7 A;  1MOJ A;  5E2D A;  1IER A;  2ZG8 X;  3KA4 A;  2VZB A;  4ML5 A;  3AF9 X;  2BKC A;  3FRR A;  3QZ3 A;  2GS4 A;  1HRS A;  2V2M A;  4LQN A;  4OYN A;  3ISE A;  5J9V A;  5D8Y A;  5I4J A;  4TOC A;  2N02 A;  3EZ0 A;  3WVW A;  5FFB A;  3SH6 A;  4KVR A;  2C2J A;  2OC5 A;  2BK6 A;  4MUD A;  2XJN A;  4DYU A;  1O9I A;  3AJP A;  3FRS A;  5GU3 X;  4M33 A;  2FL0 A;  1XZ1 A;  2AR0 A;  3E1L A;  3QHC A;  2Z5P A;  3PVR A;  4ZL6 A;  1R03 A;  3KX9 A;  1TKO A;  4ZLW A;  5CMQ A;  3EGM A;  4LPN A;  2C41 A;  3C23 A;  5GN8 A;  4EVC A;  1MFR A;  2F7N A;  2OH3 A;  2Z5Q A;  1BG7 A;  4II4 A;  2V2N A;  3WNW A;  3F37 A;  1RYT A;  2C2F A;  2GYQ A;  3LKD A;  4CVR A;  3QB9 A;  2FFX J;  1O9R A;  3PVY B;  3PW8 A;  1LKO A;  5D8Q A;  1XZ3 A;  1Z4A A;  4LQJ A;  3JZ9 A;  3UOI A;  5GOU A;  3C1Z A;  3Q4N A;  4ZJK A;  3L0M A;  1VEI A;  4KXR B;  3KDQ A;  3E1N A;  4MKU A;  4RC5 B;  3OJ5 A;  5GU1 X;  4ITW A;  2ITB A;  1Z6O A;  4DYX A;  4TOD A;  1S2Z A;  3E1J A;  3ES3 A;  2ZA6 A;  2XKQ A;  2V15 A;  3HL1 A;  1RCC A;  5FFE A;  3UFB A;  3O7S A;  2C2U A;  1RCE A;  3A9Q A;  2ZG9 X;  1JGC A;  3QD8 A;  2JD7 0;  1LKP A;  5HJH A;  4ETR A;  3PW1 A;  4LPJ A;  2CF7 A;  1S30 A;  3F36 A;  2V8U A;  1RCI A;  1B71 A;  1JI4 A;  2XJM A;  2WLU A;  2V2I A;  1QGH A;  3E1O A;  2ZA8 A;  2HR5 A;  4Y08 A;  3U90 A;  1VLG A;  3ERZ A;  3FVB A;  4II4 B;  4PG0 A;  3PWQ A;  4RC6 B;  2XJO A;  5LS9 A;  3E1Q A;  5FFD A;  1JYB A;  2X17 0;  1ZS3 A;  4CY9 A;  3GE4 A;  4PGK A;  3W54 A;  3BVF A;  2CHI A;  3WVU A;  3EZU A;  2D5K A;  2WWX B;  1UVH A;  3HIU A;  1BCF A;  5JDO A;  3GGY A;  4M35 A;  4ZKW A;  5K53 A;  2FHA A;  3NOZ X;  3PZA A;  2CHP A;  3Q4Q A;  1KRQ A;  2C6R A;  3PVT A;  4MN9 A;  3PW8 C;  2ZG7 X;  5LG2 A;  2FG8 A;  5CMR A;  3MPS A;  2G4H A;  2GYD A;  5D8P A;  1JIG A;  2CLB A;  4CVT A;  4ITT A;  3R2O A;  3KWO A;  1SOF A;  1TJO A;  2QF9 A;  5JKL A;  3O7R A;  4DZ0 A;  5JKM G;  3NP0 X;  3JZA B;  1ZUJ A;  4U3G A;  3E2C A;  4Z3B A;  2V8T A;  4DYZ A;  2G38 B;  3AK9 A;  1VEL A;  3R2H A;  5FEJ A;  4AM5 A;  3WVV A;  2OKC A;  5J8W A;  1LB3 A;  2V2O A;  3E6S A;  3R2R A;  4AM4 A;  1F33 A;  5HQO A;  3NP2 X;  5GU2 X;  3RBC A;  2QQY A;  4REU A;  4CMY A;  3H7G A;  2VXX A;  3BVI A;  2W0O A;  4DAS A;  3PWQ C;  2RBD A;  4LYX A;  2WLA A;  4M34 A;  4RC7 A;  1DAT A;  5LG8 A;  3V3K B;  2MGY A;  1YV1 A;  1RCD A;  2CN6 A;  3AF8 X;  4DYY A;  4X0J A;  3SE1 A;  3T9J A;  4E40 A;  3AJO A;  3R2M A;  3M6J A;  3F32 A;  1SQ3 A;  5J93 A;  2Y3Q A;  1FHA A;  4ISM A;  4CVP A;  1L8H A;  4TW3 A;  3E1P A;  3AF7 X;  2Y44 A;  4TO9 A;  3PVR B;  1NF6 A;  3IS8 A;  1L8I A;  4P18 A;  3E6R A;  3OGH A;  5AXS A;  4AM2 A;  3RE7 A;  4CMY V;  1JTS A;  3QVD A;  4YXJ A;  2CLU A;  1DPS A;  3R2K A;  4PGI A;  4LYU A;  5ERJ A;  3UOF A;  3F35 A;  1S3Q A;  4XKT A;  5GN8 B;  2CWL A;  4W4K B;  1BFR A;  2Z5R A;  3RAV A;  2BJY A;  4LPM A;  1QYB A;  5JAC A;  4YVZ A;  1AEW A;  2IY4 A;  4R42 A;  3E1M A;  5C6F A;  2WTL A;  1YUZ A;  4CYA A;  3Q4R A;  2IB0 A;  4LQV A;  3VV9 A;  4TOF A;  3C21 A;  3AK8 A;  5CZU A;  1RCG A;  4KVS A;  2V2L A;  3IQ1 A;  2V2R A;  2CIH A;  2HTN A;  3KA8 A;  5LBH A;  3TA8 A;  3UNO A;  4CYB A;  4XKU A;  2YW7 A;  4A25 A;  1NNQ A;  1JKV A;  5JKL G;  2BW1 A;  1GWG A;  4PG1 A;  5HU6 D;  3BT5 A;  3SID A;  3SHX A;  3PW1 B;  4XGS A;  3VVA A;  4Z5S A;  3PVY A;  5HJF A;  1J30 A;  1JRE A;  4TOA A;  4ZTT A;  4TOH A;  4EVD A;  2JD6 0;  5J8S A;  3F39 A;  2FZF A;  2ZUR X;  4MY7 A;  4TOB A;  3BKN A;  4W4L B;  4RC5 A;  4MXP A;  3GVY A;  4ZL5 A;  4ZMC A;  1JKU A;  3IS7 A;  3FSE A;  3FI6 A;  4KVQ A;  4QUW A;  1TK6 A;  1DVB A;  3QHB A;  1VEQ A;  4ZKH A;  2YJK A;  5JDO B;  1LKM A;  3BVK A;  1TKP A;  3AJQ A;  3F38 A;  2FG4 A;  2FKZ A;  4IWK A;  1OTK A;  5ERK A;  5FFA A;  4EVE A;  2Z90 A;  2YJJ A;  3PVT B;  2XGW A;  5D8X A;  3KA9 A;  5E1U A;  4RC8 A;  4RC6 A;  3Q4O A;  5JKM A;  4TOE A;  2CEI A;  3BVE A;  4IXK A;  2IU2 A;  4MJY A;  4ERU A;  2Z6M A;  1N1Q A;  1JI5 A;  3A68 A;  3R2S A;  3R2L A;  1IES A;  1VJX A;  3N6O A;  4YKH A;  3KA3 A;  3D19 A;  3KHK A;  3BVL A;  3GHQ A;  3C1Y A;  4WJG 4;  2V2S A;  5D8O A;  4ZKX A;  4XKS A;  4CVS A;  4EVB A;  4E6K A;  4YXM A;  1Z6O M;  2FJC A;  3KA6 A;  3GGZ A;  1YUX A;  3PWF A;  1H96 A;  5GU0 X;  5K52 A;  3F33 A;  4TOG A;  1F30 A;  3RGD A;  4DE6 A;  5D8S A;  5FFC A;  4RC7 B;  2V2J A;  3F34 A;  4M32 A;  3ISF A;  1EUM A;  2YW6 A;  5IX6 A;  4IWJ A;  5D8R A;  4LQH A;  2VXI A;  1NF4 A;  1UMN A;  2JD8 0;  3VNX A;  4ISP A;  1NFV A;  2CN7 A;  3KXU A;  2UX1 A;  2V2P A;  3DBY A;  4DI0 A;  2PYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...