1VELA

Mycobacterium smegmatis dps tetragonal form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
163
structure length
163
Chain Sequence
SFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQWFVRAHLESAGGQLTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords starvation-induced DNA protecting protein
publication title X-ray analysis of Mycobacterium smegmatis Dps and a comparative study involving other Dps and Dps-like molecules
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 65
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1velA00
4DASA 2ZG8X 2WLUA 3QVDA 1JKVA 4IXKA 3Q4RA 2XKQA 4MY7A 2ZA8A 5CMQA 1LKMA 4CVRA 1TKOA 4Y08A 3R2MA 3PW1A 4YKHA 4OYNA 4A25A 3R2KA 2VZBA 3KX9A 5D8RA 4LYXA 5J8WA 4U3GA 2OC5A 4RC8A 4ZL5A 5FEJA 4ISPA 4TOHA 5K53A 3MPSA 4E6KA 1NFVA 5D8OA 3E2CA 1Z4AA 3F33A 3Q4NA 2V2IA 3UOFA 3KA4A 2FG8A 4RC7A 3AF7X 2V2PA 2XJMA 1O9RA 3R2RA 2X170 4TOAA 3EZUA 4CY9A 2CN7A 4LPMA 4TO9A 3QD8A 3A9QA 2VXXA 5E1UA 1F33A 2F7NA 3PVRB 1NF6A 3SIDA 1BG7A 4CYBA 3SE1A 1AEWA 3BT5A 1JGCA 1N1QA 4ZKHA 1JIGA 5D8XA 4RC6B 3A68A 3O7SA 5LS9A 4II4B 5E2DA 3SH6A 5FFCA 2WLAA 3BVLA 1O9IA 1L8HA 4ZLWA 3F32A 4LPNA 4PG0A 2RBDA 4CMYV 4MKUA 4AM2A 1F30A 2WTLA 5FFDA 4XKSA 5J93A 4REUA 1JYBA 5JKMG 1RYTA 2ZA7A 1IESA 4DYXA 5I4JA 5LG8A 3O7RA 3E6RA 3WVVA 5FFAA 2BK6A 1Z6OM 4KVRA 5CMRA 3PW1B 4RC5A 2CIHA 3F38A 5GN8A 1DATA 3PZAA 3R2SA 3PVYA 4AM4A 3ES3A 3F39A 2ITBA 5CZUA 1HRSA 3F34A 5GU3X 3U90A 4M35A 2GYQA 2V2JA 2YJKA 1R03A 5C6FA 4LPJA 3TA8A 2GYDA 3VNXA 3PWQA 4TOBA 3PW8A 3AJQA 3KA3A 4P18A 2XGWA 2BKCA 1IERA 3R2HA 1LKPA 5JKLA 2ZG7X 1RCIA 3FSEA 3SHXA 3E6SA 1JI4A 4ISMA 4XKUA 4M34A 3AJPA 3NP0X 3Q4QA 2CF7A 1BCFA 1UVHA 2JD60 4EVEA 3UOIA 3QHBA 1Z6OA 3NOZX 2Z6MA 5ERJA 2ZURX 3FI6A 4PGIA 2CLBA 2Z5QA 3AJOA 1S30A 2CEIA 4R42A 2IY4A 4IWKA 2QF9A 2CN6A 1ZS3A 1VEQA 1UMNA 1VELA 2V2NA 3PWQC 1DPSA 3ISFA 4DYYA 3PW8C 4TOGA 2C2FA 1H96A 2BW1A 2V2OA 5FFEA 4DZ0A 2Z5RA 3BKNA 3E1QA 2ZG9X 1MFRA 4CMYA 2XJOA 2V2RA 1S2ZA 2C6RA 3RBCA 3R2LA 2JD70 4LQNA 1TKPA 2C41A 4KVQA 1BFRA 3E1MA 4RC5B 2PYBA 1RCDA 1KRQA 4TOFA 4M33A 2W0OA 3GVYA 1S3QA 4TODA 3BVKA 3HL1A 5GU2X 1L8IA 3UNOA 3IS7A 4Z3BA 1B71A 1FHAA 2FG4A 4EVBA 4CVPA 4MUDA 3AF8X 3E1PA 1VJXA 5GU0X 4MJYA 2V15A 1VLGA 4TOEA 2FL0A 4AM5A 3OJ5A 3BVEA 4EVDA 4EVCA 3H7GA 5D8SA 3PVRA 5AXSA 5HJHA 3WVWA 4LQVA 1NNQA 2IB0A 1RCGA 1J30A 4TW3A 3OGHA 4RC6A 1SOFA 2YJJA 4PG1A 3PVTA 4TOCA 1QGHA 4II4A 2VXIA 5GOUA 5LG2A 2QQYA 5JKLG 4RC7B 4ML5A 5D8YA 4QUWA 2Z90A 1LB3A 3ERZA 3QHCA 4DI0A 5K52A 2CHPA 4ITTA 2FHAA 1GWGA 4DE6A 4ETRA 5FFBA 1QYBA 3NP2X 3F35A 2C2JA 5HJFA 3F36A 3AF9X 4CVTA 3IQ1A 2HR5A 4DYUA 2YW6A 1YV1A 4IWJA 3GE4A 1YUZA 3RGDA 1JI5A 3PWFA 4XGSA 5IX6A 2Z5PA 1LKOA 3KWOA 4ZJKA 4ZMCA 2JD80 5HQOA 1RCEA 1XZ3A 3KA6A 2YW7A 4ZKWA 2BJYA 1MOJA 3QZ3A 4MN9A 4LQHA 4Z5SA 1NF4A 5LBHA 5D8PA 5D8QA 3AK9A 3IS8A 2OH3A 4ZL6A 3EGMA 4CVSA 1XZ1A 3T9JA 5GN8B 2XJNA 5J8SA 2V2LA 3PVYB 1RCCA 2GS4A 2FJCA 2ZA6A 3EZ0A 1OTKA 1EUMA 3KXUA 2UX1A 2G4HA 3FVBA 2D5KA 3R2OA 3WNWA 2CHIA 1DVBA 2FFXJ 1TK6A 2V2MA 3KA9A 3PVTB 2FZFA 4DYZA 3AK8A 2V2SA 1JTSA 3RE7A 3E1LA 1JKUA 4CYAA 4ERUA 3WVUA 3GHQA 4KVSA 3QB9A 1TJOA 3RD0A 3F37A 1JREA 2HTNA 5ERKA 5JACA 1YUXA 1ZUJA 4LYUA 3KA8A 4M32A 3E1JA 2C2UA 4ZTTA 5GU1X 4LQJA 2CLUA 5J9VA 5JKMA 3HIUA 3E1NA 3Q4OA 4ITWA 3ISEA 3E1OA 3BVFA 2IU2A 1SQ3A 2Y3QA 4PGKA 4ZKXA 3RAVA 1VEIA 2FKZA 4XKTA 3BVIA
chains in the Genus database with same CATH superfamily
4DASA 2ZG8X 2WLUA 3QVDA 1JKVA 4IXKA 3Q4RA 2XKQA 4MY7A 2ZA8A 5CMQA 3N6OA 3VVAA 1LKMA 4CVRA 1TKOA 3C1YA 4Y08A 3R2MA 3PW1A 4YKHA 4OYNA 4A25A 3R2KA 2VZBA 3KX9A 5D8RA 4LYXA 5J8WA 4U3GA 2OC5A 4RC8A 4ZL5A 5FEJA 4ISPA 4TOHA 5K53A 3MPSA 4E6KA 1NFVA 5D8OA 3E2CA 3C21A 1Z4AA 3F33A 3Q4NA 2V2IA 3UOFA 3KA4A 2FG8A 4RC7A 3AF7X 2V2PA 2XJMA 1O9RA 3R2RA 2X170 4TOAA 3EZUA 4CY9A 2CN7A 4LPMA 4TO9A 3QD8A 3A9QA 2VXXA 5E1UA 1F33A 2F7NA 3PVRB 1NF6A 3SIDA 1BG7A 4CYBA 3SE1A 1AEWA 3BT5A 1JGCA 1N1QA 4ZKHA 3C23A 1JIGA 3L0MA 5D8XA 4RC6B 2V8UA 2G38B 3A68A 3O7SA 5LS9A 4II4B 5E2DA 3SH6A 5FFCA 2WLAA 3BVLA 1O9IA 1L8HA 4ZLWA 4YXMA 3F32A 4LPNA 4YXJA 4PG0A 2RBDA 4CMYV 4MKUA 4AM2A 1F30A 2WTLA 5FFDA 4XKSA 5J93A 4REUA 1JYBA 5JKMG 1RYTA 2ZA7A 1IESA 4DYXA 5I4JA 5LG8A 3O7RA 2WWXB 3E6RA 3WVVA 5FFAA 2BK6A 1Z6OM 4KVRA 5CMRA 3PW1B 4RC5A 2CIHA 3F38A 5GN8A 1DATA 3PZAA 3R2SA 3PVYA 4AM4A 3ES3A 3F39A 4YVZA 2ITBA 5CZUA 1HRSA 4W4LB 3F34A 5GU3X 3U90A 4M35A 2GYQA 2V2JA 2YJKA 1R03A 5C6FA 4LPJA 3TA8A 2GYDA 3VNXA 3PWQA 4TOBA 3PW8A 3AJQA 3KA3A 4P18A 2XGWA 3VV9A 2BKCA 1IERA 3R2HA 1LKPA 5JKLA 3UFBA 2ZG7X 1RCIA 3FSEA 3SHXA 3E6SA 1JI4A 3KDQA 4ISMA 4XKUA 4M34A 4KXRB 3AJPA 3NP0X 3Q4QA 2CF7A 1BCFA 3GGYA 1UVHA 2JD60 4EVEA 3UOIA 3QHBA 1Z6OA 3NOZX 2Z6MA 5ERJA 5JDOA 2ZURX 3FI6A 4PGIA 2CLBA 2Z5QA 3AJOA 1S30A 2CEIA 4R42A 4WJG4 2IY4A 4IWKA 2QF9A 2CN6A 1ZS3A 1VEQA 1UMNA 1VELA 5HU6D 2V2NA 3PWQC 1DPSA 3ISFA 4DYYA 3PW8C 4TOGA 2C2FA 1H96A 2BW1A 2V2OA 5FFEA 4E40A 4DZ0A 2MGYA 2Z5RA 3BKNA 3E1QA 2ZG9X 1MFRA 4CMYA 2XJOA 2V2RA 1S2ZA 2C6RA 3RBCA 3R2LA 2JD70 4LQNA 1TKPA 2C41A 4KVQA 1BFRA 3E1MA 4RC5B 2PYBA 1RCDA 1KRQA 4TOFA 4MXPA 4M33A 2W0OA 3GVYA 1S3QA 4TODA 3BVKA 3HL1A 5GU2X 1L8IA 3UNOA 3IS7A 4Z3BA 1B71A 1FHAA 2FG4A 4EVBA 4CVPA 4MUDA 3AF8X 3E1PA 1VJXA 3V3KB 4MJYA 5GU0X 2V15A 1VLGA 4TOEA 2FL0A 4AM5A 2OKCA 3OJ5A 3FRRA 3BVEA 4EVDA 4EVCA 2N02A 3H7GA 3GGZA 5D8SA 3PVRA 5AXSA 5HJHA 3WVWA 4LQVA 1NNQA 2IB0A 1RCGA 1J30A 4W4KB 4TW3A 3OGHA 4RC6A 3KHKA 1SOFA 2YJJA 4PG1A 3PVTA 4TOCA 1QGHA 4II4A 2VXIA 3C1ZA 5GOUA 5LG2A 2QQYA 4X0JA 5JKLG 4RC7B 4ML5A 5D8YA 4QUWA 2Z90A 1LB3A 3ERZA 3QHCA 3LKDA 4DI0A 5K52A 2CHPA 4ITTA 2FHAA 1GWGA 4DE6A 4ETRA 5FFBA 1QYBA 3NP2X 3F35A 2C2JA 5HJFA 3F36A 3AF9X 4CVTA 3IQ1A 2HR5A 4DYUA 2YW6A 1YV1A 4IWJA 3W54A 3GE4A 1YUZA 3RGDA 1JI5A 3PWFA 4XGSA 5IX6A 2Z5PA 1LKOA 3KWOA 4ZJKA 2Y44A 2V8TA 4ZMCA 2JD80 5HQOA 1RCEA 1XZ3A 3KA6A 2YW7A 4ZKWA 2BJYA 3JZ9A 1MOJA 3QZ3A 4MN9A 4LQHA 4Z5SA 1NF4A 5LBHA 5D8PA 5D8QA 3AK9A 3IS8A 2OH3A 4ZL6A 3EGMA 4CVSA 1XZ1A 3T9JA 5GN8B 2XJNA 5J8SA 2V2LA 3PVYB 1RCCA 2GS4A 2FJCA 2ZA6A 3EZ0A 1OTKA 1EUMA 2AR0A 3KXUA 2UX1A 2G4HA 3FVBA 2CWLA 2D5KA 3R2OA 3WNWA 2CHIA 1DVBA 2FFXJ 1TK6A 2V2MA 3KA9A 3PVTB 2FZFA 3JZAB 4DYZA 3AK8A 2V2SA 1JTSA 3RE7A 3E1LA 1JKUA 3D19A 4CYAA 4ERUA 3WVUA 3GHQA 4KVSA 3QB9A 1TJOA 3RD0A 3F37A 1JREA 3FRSA 2HTNA 5ERKA 5JACA 1YUXA 3M6JA 1ZUJA 4LYUA 3KA8A 4M32A 3E1JA 2C2UA 4ZTTA 5GU1X 4LQJA 2CLUA 3DBYA 5J9VA 5JKMA 3HIUA 3E1NA 3Q4OA 4ITWA 3ISEA 3E1OA 3BVFA 2IU2A 1SQ3A 5JDOB 2Y3QA 4PGKA 4ZKXA 3RAVA 1VEIA 2FKZA 4XKTA 3BVIA
chains in the Genus database with same CATH topology
4DASA 2ZG8X 2WLUA 3QVDA 1JKVA 4IXKA 3Q4RA 2XKQA 4MY7A 2ZA8A 5CMQA 3N6OA 3VVAA 1LKMA 4CVRA 1TKOA 3C1YA 4Y08A 3R2MA 3PW1A 4YKHA 4OYNA 4A25A 3R2KA 2VZBA 3KX9A 5D8RA 4LYXA 5J8WA 4U3GA 2OC5A 4RC8A 4ZL5A 5FEJA 4ISPA 4TOHA 5K53A 3MPSA 4E6KA 1NFVA 5D8OA 3E2CA 3C21A 1Z4AA 3F33A 3Q4NA 2V2IA 3UOFA 3KA4A 2FG8A 4RC7A 3AF7X 2V2PA 2XJMA 1O9RA 3R2RA 2X170 4TOAA 3EZUA 4CY9A 2CN7A 4LPMA 4TO9A 3QD8A 3A9QA 2VXXA 5E1UA 1F33A 2F7NA 3PVRB 1NF6A 3SIDA 1BG7A 4CYBA 3SE1A 1AEWA 3BT5A 1JGCA 1N1QA 4ZKHA 3C23A 1JIGA 3L0MA 5D8XA 4RC6B 2V8UA 2G38B 3A68A 3O7SA 5LS9A 4II4B 5E2DA 3SH6A 5FFCA 2WLAA 3BVLA 1O9IA 1L8HA 4ZLWA 4YXMA 3F32A 4LPNA 4YXJA 4PG0A 2RBDA 4CMYV 4MKUA 4AM2A 1F30A 2WTLA 5FFDA 4XKSA 5J93A 4REUA 1JYBA 5JKMG 1RYTA 2ZA7A 1IESA 4DYXA 5I4JA 5LG8A 3O7RA 2WWXB 3E6RA 3WVVA 5FFAA 2BK6A 1Z6OM 4KVRA 5CMRA 3PW1B 4RC5A 2CIHA 3F38A 5GN8A 1DATA 3PZAA 3R2SA 3PVYA 4AM4A 3ES3A 3F39A 4YVZA 2ITBA 5CZUA 1HRSA 4W4LB 3F34A 5GU3X 3U90A 4M35A 2GYQA 2V2JA 2YJKA 1R03A 5C6FA 4LPJA 3TA8A 2GYDA 3VNXA 3PWQA 4TOBA 3PW8A 3AJQA 3KA3A 4P18A 2XGWA 3VV9A 2BKCA 1IERA 3R2HA 1LKPA 5JKLA 3UFBA 2ZG7X 1RCIA 3FSEA 3SHXA 3E6SA 1JI4A 3KDQA 4ISMA 4XKUA 4M34A 4KXRB 3AJPA 3NP0X 3Q4QA 2CF7A 1BCFA 3GGYA 1UVHA 2JD60 4EVEA 3UOIA 3QHBA 1Z6OA 3NOZX 2Z6MA 5ERJA 5JDOA 2ZURX 3FI6A 4PGIA 2CLBA 2Z5QA 3AJOA 1S30A 2CEIA 4R42A 4WJG4 2IY4A 4IWKA 2QF9A 2CN6A 1ZS3A 1VEQA 1UMNA 1VELA 5HU6D 2V2NA 3PWQC 1DPSA 3ISFA 4DYYA 3PW8C 4TOGA 2C2FA 1H96A 2BW1A 2V2OA 5FFEA 4E40A 4DZ0A 2MGYA 2Z5RA 3BKNA 3E1QA 2ZG9X 1MFRA 4CMYA 2XJOA 2V2RA 1S2ZA 2C6RA 3RBCA 3R2LA 2JD70 4LQNA 1TKPA 2C41A 4KVQA 1BFRA 3E1MA 4RC5B 2PYBA 1RCDA 1KRQA 4TOFA 4MXPA 4M33A 2W0OA 3GVYA 1S3QA 4TODA 3BVKA 3HL1A 5GU2X 1L8IA 3UNOA 3IS7A 4Z3BA 1B71A 1FHAA 2FG4A 4EVBA 4CVPA 4MUDA 3AF8X 3E1PA 1VJXA 3V3KB 4MJYA 5GU0X 2V15A 1VLGA 4TOEA 2FL0A 4AM5A 2OKCA 3OJ5A 3FRRA 3BVEA 4EVDA 4EVCA 2N02A 3H7GA 3GGZA 5D8SA 3PVRA 5AXSA 5HJHA 3WVWA 4LQVA 1NNQA 2IB0A 1RCGA 1J30A 4W4KB 4TW3A 3OGHA 4RC6A 3KHKA 1SOFA 2YJJA 4PG1A 3PVTA 4TOCA 1QGHA 4II4A 2VXIA 3C1ZA 5GOUA 5LG2A 2QQYA 4X0JA 5JKLG 4RC7B 4ML5A 5D8YA 4QUWA 2Z90A 1LB3A 3ERZA 3QHCA 3LKDA 4DI0A 5K52A 2CHPA 4ITTA 2FHAA 1GWGA 4DE6A 4ETRA 5FFBA 1QYBA 3NP2X 3F35A 2C2JA 5HJFA 3F36A 3AF9X 4CVTA 3IQ1A 2HR5A 4DYUA 2YW6A 1YV1A 4IWJA 3W54A 3GE4A 1YUZA 3RGDA 1JI5A 3PWFA 4XGSA 5IX6A 2Z5PA 1LKOA 3KWOA 4ZJKA 2Y44A 2V8TA 4ZMCA 2JD80 5HQOA 1RCEA 1XZ3A 3KA6A 2YW7A 4ZKWA 2BJYA 3JZ9A 1MOJA 3QZ3A 4MN9A 4LQHA 4Z5SA 1NF4A 5LBHA 5D8PA 5D8QA 3AK9A 3IS8A 2OH3A 4ZL6A 3EGMA 4CVSA 1XZ1A 3T9JA 5GN8B 2XJNA 5J8SA 2V2LA 3PVYB 1RCCA 2GS4A 2FJCA 2ZA6A 3EZ0A 1OTKA 1EUMA 2AR0A 3KXUA 2UX1A 2G4HA 3FVBA 2CWLA 2D5KA 3R2OA 3WNWA 2CHIA 1DVBA 2FFXJ 1TK6A 2V2MA 3KA9A 3PVTB 2FZFA 3JZAB 4DYZA 3AK8A 2V2SA 1JTSA 3RE7A 3E1LA 1JKUA 3D19A 4CYAA 4ERUA 3WVUA 3GHQA 4KVSA 3QB9A 1TJOA 3RD0A 3F37A 1JREA 3FRSA 2HTNA 5ERKA 5JACA 1YUXA 3M6JA 1ZUJA 4LYUA 3KA8A 4M32A 3E1JA 2C2UA 4ZTTA 5GU1X 4LQJA 2CLUA 3DBYA 5J9VA 5JKMA 3HIUA 3E1NA 3Q4OA 4ITWA 3ISEA 3E1OA 3BVFA 2IU2A 1SQ3A 5JDOB 2Y3QA 4PGKA 4ZKXA 3RAVA 1VEIA 2FKZA 4XKTA 3BVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAS A;  2ZG8 X;  2WLU A;  3QVD A;  1JKV A;  4IXK A;  3Q4R A;  2XKQ A;  4MY7 A;  2ZA8 A;  5CMQ A;  1LKM A;  4CVR A;  1TKO A;  4Y08 A;  3R2M A;  3PW1 A;  4YKH A;  4OYN A;  4A25 A;  3R2K A;  2VZB A;  3KX9 A;  5D8R A;  4LYX A;  5J8W A;  4U3G A;  2OC5 A;  4RC8 A;  4ZL5 A;  5FEJ A;  4ISP A;  4TOH A;  5K53 A;  3MPS A;  4E6K A;  1NFV A;  5D8O A;  3E2C A;  1Z4A A;  3F33 A;  3Q4N A;  2V2I A;  3UOF A;  3KA4 A;  2FG8 A;  4RC7 A;  3AF7 X;  2V2P A;  2XJM A;  1O9R A;  3R2R A;  2X17 0;  4TOA A;  3EZU A;  4CY9 A;  2CN7 A;  4LPM A;  4TO9 A;  3QD8 A;  3A9Q A;  2VXX A;  5E1U A;  1F33 A;  2F7N A;  3PVR B;  1NF6 A;  3SID A;  1BG7 A;  4CYB A;  3SE1 A;  1AEW A;  3BT5 A;  1JGC A;  1N1Q A;  4ZKH A;  1JIG A;  5D8X A;  4RC6 B;  3A68 A;  3O7S A;  5LS9 A;  4II4 B;  5E2D A;  3SH6 A;  5FFC A;  2WLA A;  3BVL A;  1O9I A;  1L8H A;  4ZLW A;  3F32 A;  4LPN A;  4PG0 A;  2RBD A;  4CMY V;  4MKU A;  4AM2 A;  1F30 A;  2WTL A;  5FFD A;  4XKS A;  5J93 A;  4REU A;  1JYB A;  5JKM G;  1RYT A;  2ZA7 A;  1IES A;  4DYX A;  5I4J A;  5LG8 A;  3O7R A;  3E6R A;  3WVV A;  5FFA A;  2BK6 A;  1Z6O M;  4KVR A;  5CMR A;  3PW1 B;  4RC5 A;  2CIH A;  3F38 A;  5GN8 A;  1DAT A;  3PZA A;  3R2S A;  3PVY A;  4AM4 A;  3ES3 A;  3F39 A;  2ITB A;  5CZU A;  1HRS A;  3F34 A;  5GU3 X;  3U90 A;  4M35 A;  2GYQ A;  2V2J A;  2YJK A;  1R03 A;  5C6F A;  4LPJ A;  3TA8 A;  2GYD A;  3VNX A;  3PWQ A;  4TOB A;  3PW8 A;  3AJQ A;  3KA3 A;  4P18 A;  2XGW A;  2BKC A;  1IER A;  3R2H A;  1LKP A;  5JKL A;  2ZG7 X;  1RCI A;  3FSE A;  3SHX A;  3E6S A;  1JI4 A;  4ISM A;  4XKU A;  4M34 A;  3AJP A;  3NP0 X;  3Q4Q A;  2CF7 A;  1BCF A;  1UVH A;  2JD6 0;  4EVE A;  3UOI A;  3QHB A;  1Z6O A;  3NOZ X;  2Z6M A;  5ERJ A;  2ZUR X;  3FI6 A;  4PGI A;  2CLB A;  2Z5Q A;  3AJO A;  1S30 A;  2CEI A;  4R42 A;  2IY4 A;  4IWK A;  2QF9 A;  2CN6 A;  1ZS3 A;  1VEQ A;  1UMN A;  1VEL A;  2V2N A;  3PWQ C;  1DPS A;  3ISF A;  4DYY A;  3PW8 C;  4TOG A;  2C2F A;  1H96 A;  2BW1 A;  2V2O A;  5FFE A;  4DZ0 A;  2Z5R A;  3BKN A;  3E1Q A;  2ZG9 X;  1MFR A;  4CMY A;  2XJO A;  2V2R A;  1S2Z A;  2C6R A;  3RBC A;  3R2L A;  2JD7 0;  4LQN A;  1TKP A;  2C41 A;  4KVQ A;  1BFR A;  3E1M A;  4RC5 B;  2PYB A;  1RCD A;  1KRQ A;  4TOF A;  4M33 A;  2W0O A;  3GVY A;  1S3Q A;  4TOD A;  3BVK A;  3HL1 A;  5GU2 X;  1L8I A;  3UNO A;  3IS7 A;  4Z3B A;  1B71 A;  1FHA A;  2FG4 A;  4EVB A;  4CVP A;  4MUD A;  3AF8 X;  3E1P A;  1VJX A;  5GU0 X;  4MJY A;  2V15 A;  1VLG A;  4TOE A;  2FL0 A;  4AM5 A;  3OJ5 A;  3BVE A;  4EVD A;  4EVC A;  3H7G A;  5D8S A;  3PVR A;  5AXS A;  5HJH A;  3WVW A;  4LQV A;  1NNQ A;  2IB0 A;  1RCG A;  1J30 A;  4TW3 A;  3OGH A;  4RC6 A;  1SOF A;  2YJJ A;  4PG1 A;  3PVT A;  4TOC A;  1QGH A;  4II4 A;  2VXI A;  5GOU A;  5LG2 A;  2QQY A;  5JKL G;  4RC7 B;  4ML5 A;  5D8Y A;  4QUW A;  2Z90 A;  1LB3 A;  3ERZ A;  3QHC A;  4DI0 A;  5K52 A;  2CHP A;  4ITT A;  2FHA A;  1GWG A;  4DE6 A;  4ETR A;  5FFB A;  1QYB A;  3NP2 X;  3F35 A;  2C2J A;  5HJF A;  3F36 A;  3AF9 X;  4CVT A;  3IQ1 A;  2HR5 A;  4DYU A;  2YW6 A;  1YV1 A;  4IWJ A;  3GE4 A;  1YUZ A;  3RGD A;  1JI5 A;  3PWF A;  4XGS A;  5IX6 A;  2Z5P A;  1LKO A;  3KWO A;  4ZJK A;  4ZMC A;  2JD8 0;  5HQO A;  1RCE A;  1XZ3 A;  3KA6 A;  2YW7 A;  4ZKW A;  2BJY A;  1MOJ A;  3QZ3 A;  4MN9 A;  4LQH A;  4Z5S A;  1NF4 A;  5LBH A;  5D8P A;  5D8Q A;  3AK9 A;  3IS8 A;  2OH3 A;  4ZL6 A;  3EGM A;  4CVS A;  1XZ1 A;  3T9J A;  5GN8 B;  2XJN A;  5J8S A;  2V2L A;  3PVY B;  1RCC A;  2GS4 A;  2FJC A;  2ZA6 A;  3EZ0 A;  1OTK A;  1EUM A;  3KXU A;  2UX1 A;  2G4H A;  3FVB A;  2D5K A;  3R2O A;  3WNW A;  2CHI A;  1DVB A;  2FFX J;  1TK6 A;  2V2M A;  3KA9 A;  3PVT B;  2FZF A;  4DYZ A;  3AK8 A;  2V2S A;  1JTS A;  3RE7 A;  3E1L A;  1JKU A;  4CYA A;  4ERU A;  3WVU A;  3GHQ A;  4KVS A;  3QB9 A;  1TJO A;  3RD0 A;  3F37 A;  1JRE A;  2HTN A;  5ERK A;  5JAC A;  1YUX A;  1ZUJ A;  4LYU A;  3KA8 A;  4M32 A;  3E1J A;  2C2U A;  4ZTT A;  5GU1 X;  4LQJ A;  2CLU A;  5J9V A;  5JKM A;  3HIU A;  3E1N A;  3Q4O A;  4ITW A;  3ISE A;  3E1O A;  3BVF A;  2IU2 A;  1SQ3 A;  2Y3Q A;  4PGK A;  4ZKX A;  3RAV A;  1VEI A;  2FKZ A;  4XKT A;  3BVI A; 
#chains in the Genus database with same CATH topology
 4DAS A;  2ZG8 X;  2WLU A;  3QVD A;  1JKV A;  4IXK A;  3Q4R A;  2XKQ A;  4MY7 A;  2ZA8 A;  5CMQ A;  3N6O A;  3VVA A;  1LKM A;  4CVR A;  1TKO A;  3C1Y A;  4Y08 A;  3R2M A;  3PW1 A;  4YKH A;  4OYN A;  4A25 A;  3R2K A;  2VZB A;  3KX9 A;  5D8R A;  4LYX A;  5J8W A;  4U3G A;  2OC5 A;  4RC8 A;  4ZL5 A;  5FEJ A;  4ISP A;  4TOH A;  5K53 A;  3MPS A;  4E6K A;  1NFV A;  5D8O A;  3E2C A;  3C21 A;  1Z4A A;  3F33 A;  3Q4N A;  2V2I A;  3UOF A;  3KA4 A;  2FG8 A;  4RC7 A;  3AF7 X;  2V2P A;  2XJM A;  1O9R A;  3R2R A;  2X17 0;  4TOA A;  3EZU A;  4CY9 A;  2CN7 A;  4LPM A;  4TO9 A;  3QD8 A;  3A9Q A;  2VXX A;  5E1U A;  1F33 A;  2F7N A;  3PVR B;  1NF6 A;  3SID A;  1BG7 A;  4CYB A;  3SE1 A;  1AEW A;  3BT5 A;  1JGC A;  1N1Q A;  4ZKH A;  3C23 A;  1JIG A;  3L0M A;  5D8X A;  4RC6 B;  2V8U A;  2G38 B;  3A68 A;  3O7S A;  5LS9 A;  4II4 B;  5E2D A;  3SH6 A;  5FFC A;  2WLA A;  3BVL A;  1O9I A;  1L8H A;  4ZLW A;  4YXM A;  3F32 A;  4LPN A;  4YXJ A;  4PG0 A;  2RBD A;  4CMY V;  4MKU A;  4AM2 A;  1F30 A;  2WTL A;  5FFD A;  4XKS A;  5J93 A;  4REU A;  1JYB A;  5JKM G;  1RYT A;  2ZA7 A;  1IES A;  4DYX A;  5I4J A;  5LG8 A;  3O7R A;  2WWX B;  3E6R A;  3WVV A;  5FFA A;  2BK6 A;  1Z6O M;  4KVR A;  5CMR A;  3PW1 B;  4RC5 A;  2CIH A;  3F38 A;  5GN8 A;  1DAT A;  3PZA A;  3R2S A;  3PVY A;  4AM4 A;  3ES3 A;  3F39 A;  4YVZ A;  2ITB A;  5CZU A;  1HRS A;  4W4L B;  3F34 A;  5GU3 X;  3U90 A;  4M35 A;  2GYQ A;  2V2J A;  2YJK A;  1R03 A;  5C6F A;  4LPJ A;  3TA8 A;  2GYD A;  3VNX A;  3PWQ A;  4TOB A;  3PW8 A;  3AJQ A;  3KA3 A;  4P18 A;  2XGW A;  3VV9 A;  2BKC A;  1IER A;  3R2H A;  1LKP A;  5JKL A;  3UFB A;  2ZG7 X;  1RCI A;  3FSE A;  3SHX A;  3E6S A;  1JI4 A;  3KDQ A;  4ISM A;  4XKU A;  4M34 A;  4KXR B;  3AJP A;  3NP0 X;  3Q4Q A;  2CF7 A;  1BCF A;  3GGY A;  1UVH A;  2JD6 0;  4EVE A;  3UOI A;  3QHB A;  1Z6O A;  3NOZ X;  2Z6M A;  5ERJ A;  5JDO A;  2ZUR X;  3FI6 A;  4PGI A;  2CLB A;  2Z5Q A;  3AJO A;  1S30 A;  2CEI A;  4R42 A;  4WJG 4;  2IY4 A;  4IWK A;  2QF9 A;  2CN6 A;  1ZS3 A;  1VEQ A;  1UMN A;  1VEL A;  5HU6 D;  2V2N A;  3PWQ C;  1DPS A;  3ISF A;  4DYY A;  3PW8 C;  4TOG A;  2C2F A;  1H96 A;  2BW1 A;  2V2O A;  5FFE A;  4E40 A;  4DZ0 A;  2MGY A;  2Z5R A;  3BKN A;  3E1Q A;  2ZG9 X;  1MFR A;  4CMY A;  2XJO A;  2V2R A;  1S2Z A;  2C6R A;  3RBC A;  3R2L A;  2JD7 0;  4LQN A;  1TKP A;  2C41 A;  4KVQ A;  1BFR A;  3E1M A;  4RC5 B;  2PYB A;  1RCD A;  1KRQ A;  4TOF A;  4MXP A;  4M33 A;  2W0O A;  3GVY A;  1S3Q A;  4TOD A;  3BVK A;  3HL1 A;  5GU2 X;  1L8I A;  3UNO A;  3IS7 A;  4Z3B A;  1B71 A;  1FHA A;  2FG4 A;  4EVB A;  4CVP A;  4MUD A;  3AF8 X;  3E1P A;  1VJX A;  3V3K B;  4MJY A;  5GU0 X;  2V15 A;  1VLG A;  4TOE A;  2FL0 A;  4AM5 A;  2OKC A;  3OJ5 A;  3FRR A;  3BVE A;  4EVD A;  4EVC A;  2N02 A;  3H7G A;  3GGZ A;  5D8S A;  3PVR A;  5AXS A;  5HJH A;  3WVW A;  4LQV A;  1NNQ A;  2IB0 A;  1RCG A;  1J30 A;  4W4K B;  4TW3 A;  3OGH A;  4RC6 A;  3KHK A;  1SOF A;  2YJJ A;  4PG1 A;  3PVT A;  4TOC A;  1QGH A;  4II4 A;  2VXI A;  3C1Z A;  5GOU A;  5LG2 A;  2QQY A;  4X0J A;  5JKL G;  4RC7 B;  4ML5 A;  5D8Y A;  4QUW A;  2Z90 A;  1LB3 A;  3ERZ A;  3QHC A;  3LKD A;  4DI0 A;  5K52 A;  2CHP A;  4ITT A;  2FHA A;  1GWG A;  4DE6 A;  4ETR A;  5FFB A;  1QYB A;  3NP2 X;  3F35 A;  2C2J A;  5HJF A;  3F36 A;  3AF9 X;  4CVT A;  3IQ1 A;  2HR5 A;  4DYU A;  2YW6 A;  1YV1 A;  4IWJ A;  3W54 A;  3GE4 A;  1YUZ A;  3RGD A;  1JI5 A;  3PWF A;  4XGS A;  5IX6 A;  2Z5P A;  1LKO A;  3KWO A;  4ZJK A;  2Y44 A;  2V8T A;  4ZMC A;  2JD8 0;  5HQO A;  1RCE A;  1XZ3 A;  3KA6 A;  2YW7 A;  4ZKW A;  2BJY A;  3JZ9 A;  1MOJ A;  3QZ3 A;  4MN9 A;  4LQH A;  4Z5S A;  1NF4 A;  5LBH A;  5D8P A;  5D8Q A;  3AK9 A;  3IS8 A;  2OH3 A;  4ZL6 A;  3EGM A;  4CVS A;  1XZ1 A;  3T9J A;  5GN8 B;  2XJN A;  5J8S A;  2V2L A;  3PVY B;  1RCC A;  2GS4 A;  2FJC A;  2ZA6 A;  3EZ0 A;  1OTK A;  1EUM A;  2AR0 A;  3KXU A;  2UX1 A;  2G4H A;  3FVB A;  2CWL A;  2D5K A;  3R2O A;  3WNW A;  2CHI A;  1DVB A;  2FFX J;  1TK6 A;  2V2M A;  3KA9 A;  3PVT B;  2FZF A;  3JZA B;  4DYZ A;  3AK8 A;  2V2S A;  1JTS A;  3RE7 A;  3E1L A;  1JKU A;  3D19 A;  4CYA A;  4ERU A;  3WVU A;  3GHQ A;  4KVS A;  3QB9 A;  1TJO A;  3RD0 A;  3F37 A;  1JRE A;  3FRS A;  2HTN A;  5ERK A;  5JAC A;  1YUX A;  3M6J A;  1ZUJ A;  4LYU A;  3KA8 A;  4M32 A;  3E1J A;  2C2U A;  4ZTT A;  5GU1 X;  4LQJ A;  2CLU A;  3DBY A;  5J9V A;  5JKM A;  3HIU A;  3E1N A;  3Q4O A;  4ITW A;  3ISE A;  3E1O A;  3BVF A;  2IU2 A;  1SQ3 A;  5JDO B;  2Y3Q A;  4PGK A;  4ZKX A;  3RAV A;  1VEI A;  2FKZ A;  4XKT A;  3BVI A; 
#chains in the Genus database with same CATH homology
 4DAS A;  2ZG8 X;  2WLU A;  3QVD A;  1JKV A;  4IXK A;  3Q4R A;  2XKQ A;  4MY7 A;  2ZA8 A;  5CMQ A;  3N6O A;  3VVA A;  1LKM A;  4CVR A;  1TKO A;  3C1Y A;  4Y08 A;  3R2M A;  3PW1 A;  4YKH A;  4OYN A;  4A25 A;  3R2K A;  2VZB A;  3KX9 A;  5D8R A;  4LYX A;  5J8W A;  4U3G A;  2OC5 A;  4RC8 A;  4ZL5 A;  5FEJ A;  4ISP A;  4TOH A;  5K53 A;  3MPS A;  4E6K A;  1NFV A;  5D8O A;  3E2C A;  3C21 A;  1Z4A A;  3F33 A;  3Q4N A;  2V2I A;  3UOF A;  3KA4 A;  2FG8 A;  4RC7 A;  3AF7 X;  2V2P A;  2XJM A;  1O9R A;  3R2R A;  2X17 0;  4TOA A;  3EZU A;  4CY9 A;  2CN7 A;  4LPM A;  4TO9 A;  3QD8 A;  3A9Q A;  2VXX A;  5E1U A;  1F33 A;  2F7N A;  3PVR B;  1NF6 A;  3SID A;  1BG7 A;  4CYB A;  3SE1 A;  1AEW A;  3BT5 A;  1JGC A;  1N1Q A;  4ZKH A;  3C23 A;  1JIG A;  3L0M A;  5D8X A;  4RC6 B;  2V8U A;  2G38 B;  3A68 A;  3O7S A;  5LS9 A;  4II4 B;  5E2D A;  3SH6 A;  5FFC A;  2WLA A;  3BVL A;  1O9I A;  1L8H A;  4ZLW A;  4YXM A;  3F32 A;  4LPN A;  4YXJ A;  4PG0 A;  2RBD A;  4CMY V;  4MKU A;  4AM2 A;  1F30 A;  2WTL A;  5FFD A;  4XKS A;  5J93 A;  4REU A;  1JYB A;  5JKM G;  1RYT A;  2ZA7 A;  1IES A;  4DYX A;  5I4J A;  5LG8 A;  3O7R A;  2WWX B;  3E6R A;  3WVV A;  5FFA A;  2BK6 A;  1Z6O M;  4KVR A;  5CMR A;  3PW1 B;  4RC5 A;  2CIH A;  3F38 A;  5GN8 A;  1DAT A;  3PZA A;  3R2S A;  3PVY A;  4AM4 A;  3ES3 A;  3F39 A;  4YVZ A;  2ITB A;  5CZU A;  1HRS A;  4W4L B;  3F34 A;  5GU3 X;  3U90 A;  4M35 A;  2GYQ A;  2V2J A;  2YJK A;  1R03 A;  5C6F A;  4LPJ A;  3TA8 A;  2GYD A;  3VNX A;  3PWQ A;  4TOB A;  3PW8 A;  3AJQ A;  3KA3 A;  4P18 A;  2XGW A;  3VV9 A;  2BKC A;  1IER A;  3R2H A;  1LKP A;  5JKL A;  3UFB A;  2ZG7 X;  1RCI A;  3FSE A;  3SHX A;  3E6S A;  1JI4 A;  3KDQ A;  4ISM A;  4XKU A;  4M34 A;  4KXR B;  3AJP A;  3NP0 X;  3Q4Q A;  2CF7 A;  1BCF A;  3GGY A;  1UVH A;  2JD6 0;  4EVE A;  3UOI A;  3QHB A;  1Z6O A;  3NOZ X;  2Z6M A;  5ERJ A;  5JDO A;  2ZUR X;  3FI6 A;  4PGI A;  2CLB A;  2Z5Q A;  3AJO A;  1S30 A;  2CEI A;  4R42 A;  4WJG 4;  2IY4 A;  4IWK A;  2QF9 A;  2CN6 A;  1ZS3 A;  1VEQ A;  1UMN A;  1VEL A;  5HU6 D;  2V2N A;  3PWQ C;  1DPS A;  3ISF A;  4DYY A;  3PW8 C;  4TOG A;  2C2F A;  1H96 A;  2BW1 A;  2V2O A;  5FFE A;  4E40 A;  4DZ0 A;  2MGY A;  2Z5R A;  3BKN A;  3E1Q A;  2ZG9 X;  1MFR A;  4CMY A;  2XJO A;  2V2R A;  1S2Z A;  2C6R A;  3RBC A;  3R2L A;  2JD7 0;  4LQN A;  1TKP A;  2C41 A;  4KVQ A;  1BFR A;  3E1M A;  4RC5 B;  2PYB A;  1RCD A;  1KRQ A;  4TOF A;  4MXP A;  4M33 A;  2W0O A;  3GVY A;  1S3Q A;  4TOD A;  3BVK A;  3HL1 A;  5GU2 X;  1L8I A;  3UNO A;  3IS7 A;  4Z3B A;  1B71 A;  1FHA A;  2FG4 A;  4EVB A;  4CVP A;  4MUD A;  3AF8 X;  3E1P A;  1VJX A;  3V3K B;  4MJY A;  5GU0 X;  2V15 A;  1VLG A;  4TOE A;  2FL0 A;  4AM5 A;  2OKC A;  3OJ5 A;  3FRR A;  3BVE A;  4EVD A;  4EVC A;  2N02 A;  3H7G A;  3GGZ A;  5D8S A;  3PVR A;  5AXS A;  5HJH A;  3WVW A;  4LQV A;  1NNQ A;  2IB0 A;  1RCG A;  1J30 A;  4W4K B;  4TW3 A;  3OGH A;  4RC6 A;  3KHK A;  1SOF A;  2YJJ A;  4PG1 A;  3PVT A;  4TOC A;  1QGH A;  4II4 A;  2VXI A;  3C1Z A;  5GOU A;  5LG2 A;  2QQY A;  4X0J A;  5JKL G;  4RC7 B;  4ML5 A;  5D8Y A;  4QUW A;  2Z90 A;  1LB3 A;  3ERZ A;  3QHC A;  3LKD A;  4DI0 A;  5K52 A;  2CHP A;  4ITT A;  2FHA A;  1GWG A;  4DE6 A;  4ETR A;  5FFB A;  1QYB A;  3NP2 X;  3F35 A;  2C2J A;  5HJF A;  3F36 A;  3AF9 X;  4CVT A;  3IQ1 A;  2HR5 A;  4DYU A;  2YW6 A;  1YV1 A;  4IWJ A;  3W54 A;  3GE4 A;  1YUZ A;  3RGD A;  1JI5 A;  3PWF A;  4XGS A;  5IX6 A;  2Z5P A;  1LKO A;  3KWO A;  4ZJK A;  2Y44 A;  2V8T A;  4ZMC A;  2JD8 0;  5HQO A;  1RCE A;  1XZ3 A;  3KA6 A;  2YW7 A;  4ZKW A;  2BJY A;  3JZ9 A;  1MOJ A;  3QZ3 A;  4MN9 A;  4LQH A;  4Z5S A;  1NF4 A;  5LBH A;  5D8P A;  5D8Q A;  3AK9 A;  3IS8 A;  2OH3 A;  4ZL6 A;  3EGM A;  4CVS A;  1XZ1 A;  3T9J A;  5GN8 B;  2XJN A;  5J8S A;  2V2L A;  3PVY B;  1RCC A;  2GS4 A;  2FJC A;  2ZA6 A;  3EZ0 A;  1OTK A;  1EUM A;  2AR0 A;  3KXU A;  2UX1 A;  2G4H A;  3FVB A;  2CWL A;  2D5K A;  3R2O A;  3WNW A;  2CHI A;  1DVB A;  2FFX J;  1TK6 A;  2V2M A;  3KA9 A;  3PVT B;  2FZF A;  3JZA B;  4DYZ A;  3AK8 A;  2V2S A;  1JTS A;  3RE7 A;  3E1L A;  1JKU A;  3D19 A;  4CYA A;  4ERU A;  3WVU A;  3GHQ A;  4KVS A;  3QB9 A;  1TJO A;  3RD0 A;  3F37 A;  1JRE A;  3FRS A;  2HTN A;  5ERK A;  5JAC A;  1YUX A;  3M6J A;  1ZUJ A;  4LYU A;  3KA8 A;  4M32 A;  3E1J A;  2C2U A;  4ZTT A;  5GU1 X;  4LQJ A;  2CLU A;  3DBY A;  5J9V A;  5JKM A;  3HIU A;  3E1N A;  3Q4O A;  4ITW A;  3ISE A;  3E1O A;  3BVF A;  2IU2 A;  1SQ3 A;  5JDO B;  2Y3Q A;  4PGK A;  4ZKX A;  3RAV A;  1VEI A;  2FKZ A;  4XKT A;  3BVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...