1VELA

Mycobacterium smegmatis dps tetragonal form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
163
structure length
163
Chain Sequence
SFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQWFVRAHLESAGGQLTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords starvation-induced DNA protecting protein
publication title X-ray analysis of Mycobacterium smegmatis Dps and a comparative study involving other Dps and Dps-like molecules
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
total genus 65
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1velA00
1JTSA 3FSEA 3R2MA 2PYBA 2V2SA 4DZ0A 3UOIA 1L8HA 1LKOA 1Z6OA 1VEIA 4XKUA 4DE6A 2YJJA 1Z4AA 3PW1B 5LG8A 5D8XA 3GHQA 4RC6A 5GU3X 4KVRA 4ITWA 5JACA 5J8SA 1B71A 3IQ1A 1MOJA 4LPJA 3F38A 2RBDA 1UVHA 1TK6A 3BVIA 2CHIA 2VXXA 3QHCA 4LYUA 3E2CA 4M35A 4RC7B 2CF7A 2XKQA 3RAVA 1VELA 4TOGA 3PVTA 1LKPA 1YUZA 5D8YA 4LYXA 2BKCA 1VJXA 5FFDA 2BJYA 2YJKA 2XGWA 5LBHA 3SIDA 1JI4A 2FFXJ 3OJ5A 5FFCA 2OH3A 2C41A 2UX1A 2C2JA 4RC6B 3O7SA 4IWKA 3A68A 3BVEA 5GN8A 1RCCA 2V2OA 3H7GA 3PVYA 3FI6A 3O7RA 4PG0A 4M34A 2Z90A 2CLUA 4DYYA 2BK6A 2V2NA 3RD0A 4ZKHA 1VLGA 2FG8A 3R2KA 1VEQA 4CYBA 2Z5PA 4TOHA 4TOCA 3RBCA 2W0OA 2QF9A 4P18A 4DI0A 4EVCA 1OTKA 4CY9A 4M32A 1UMNA 1LKMA 4ZTTA 2Z6MA 3EZUA 1O9RA 4CMYA 1ZUJA 1S2ZA 3KA6A 1BFRA 3PWFA 5GU0X 4ZJKA 4QUWA 3ISEA 3KA3A 2CIHA 2FZFA 1RCIA 3R2HA 1GWGA 3ISFA 2VXIA 3IS8A 3ES3A 5CMQA 3SE1A 3FVBA 3QVDA 4IXKA 4LQHA 2V2IA 3E6RA 1MFRA 3F36A 5GU2X 5FFEA 1KRQA 2ZG7X 4TO9A 5D8RA 3GVYA 3U90A 4ZMCA 5FEJA 1NF4A 2FKZA 3Q4QA 4TODA 2D5KA 1RYTA 3WNWA 1QGHA 3BVKA 3MPSA 4Z3BA 3PWQC 3TA8A 4MUDA 1RCGA 3PW8C 4KVSA 2V2LA 2ZA7A 3R2RA 3EZ0A 3NOZX 4E6KA 3AJOA 3NP0X 2VZBA 3RGDA 1SQ3A 1YV1A 3SH6A 5FFBA 4CMYV 2QQYA 5D8PA 2XJNA 5ERKA 3KX9A 1NNQA 1JI5A 5AXSA 4TOEA 4ZL5A 1DATA 2IY4A 4Z5SA 3EGMA 5E1UA 4EVDA 1DVBA 2HTNA 1Z6OM 4TOAA 4LQVA 2ZG8X 1JGCA 3SHXA 1S3QA 2V2JA 4IWJA 3WVUA 3KXUA 3E1QA 1ZS3A 4EVEA 1NF6A 1S30A 4XKTA 5GU1X 1RCDA 1EUMA 2JD80 3A9QA 3HIUA 3KWOA 4MKUA 2V2MA 4Y08A 4CVRA 3PVTB 1IERA 1JREA 4DYUA 2WTLA 4RC5A 2CEIA 2XJOA 5D8QA 5D8SA 4ITTA 4XGSA 3KA8A 5C6FA 2XJMA 5CZUA 4ISMA 3Q4OA 3QD8A 4R42A 4KVQA 1JKVA 3F39A 3NP2X 3BVFA 4ISPA 2ZURX 4CVSA 5HJHA 2Y3QA 5GN8B 1RCEA 3R2LA 3OGHA 5JKLA 4DASA 3KA4A 3PVYB 4DYZA 2GS4A 3WVWA 4U3GA 3IS7A 3F34A 3E6SA 5K52A 3E1LA 3R2OA 1JYBA 3PVRA 4XKSA 2Z5RA 1JKUA 3AJQA 3PW1A 2GYDA 2HR5A 2F7NA 4OYNA 1FHAA 3PWQA 3AJPA 4AM5A 4LQJA 2JD60 5J8WA 3F33A 3QB9A 3PW8A 5J93A 4REUA 3E1MA 3AF9X 2C2UA 3AK8A 4TOBA 5ERJA 4ETRA 3E1NA 3KA9A 2IB0A 1H96A 4MY7A 3F35A 2CHPA 2FHAA 3E1OA 1NFVA 3E1JA 3F32A 1AEWA 1JIGA 4CVTA 4ML5A 5GOUA 4II4A 1F33A 4ERUA 2YW6A 2X170 4M33A 2FL0A 1TKOA 5JKLG 2JD70 3PVRB 2G4HA 3HL1A 5CMRA 2IU2A 1DPSA 4LQNA 3AF8X 5I4JA 3QHBA 4AM4A 1QYBA 5JKMA 5LG2A 4DYXA 3VNXA 1IESA 4MN9A 2ZG9X 4YKHA 1YUXA 2Z5QA 1HRSA 1J30A 1XZ1A 2WLUA 5LS9A 2V2RA 2V15A 1F30A 1XZ3A 4II4B 4ZKXA 3Q4RA 5J9VA 3QZ3A 2ZA8A 3BT5A 2V2PA 4PGIA 1BG7A 4ZLWA 3UNOA 2FJCA 4ZL6A 3ERZA 5HJFA 1N1QA 4TOFA 1O9IA 3F37A 2C2FA 3AF7X 1BCFA 2ITBA 4EVBA 1L8IA 5JKMG 3E1PA 3BVLA 1R03A 2ZA6A 3PZAA 4TW3A 5HQOA 3BKNA 2FG4A 2CLBA 2YW7A 4PGKA 3T9JA 3Q4NA 4A25A 4AM2A 3RE7A 2BW1A 3UOFA 1TKPA 5E2DA 4LPMA 4MJYA 2OC5A 2C6RA 3R2SA 2CN7A 2GYQA 4CVPA 5IX6A 4CYAA 5K53A 4RC5B 1LB3A 3GE4A 3WVVA 5D8OA 1TJOA 4ZKWA 1SOFA 2WLAA 4LPNA 4RC8A 5FFAA 3AK9A 4PG1A 4RC7A 2CN6A
chains in the Genus database with same CATH superfamily
1JTSA 3FSEA 3R2MA 2PYBA 2V2SA 4DZ0A 3UOIA 1L8HA 1LKOA 1Z6OA 2N02A 1VEIA 4XKUA 4DE6A 3DBYA 2YJJA 1Z4AA 4WJG4 3PW1B 5LG8A 5D8XA 3GHQA 4RC6A 5GU3X 4KVRA 4ITWA 5JACA 5J8SA 1B71A 3IQ1A 1MOJA 4LPJA 3F38A 2RBDA 1UVHA 1TK6A 2WWXB 3BVIA 2CHIA 2VXXA 3QHCA 5JDOB 4LYUA 3E2CA 4M35A 4RC7B 2CF7A 2XKQA 3RAVA 2G38B 1VELA 4TOGA 3PVTA 1LKPA 1YUZA 5D8YA 4LYXA 2BKCA 1VJXA 5FFDA 2BJYA 2YJKA 2XGWA 5LBHA 3SIDA 1JI4A 2FFXJ 3OJ5A 5FFCA 2OH3A 2C41A 2UX1A 2C2JA 4RC6B 3O7SA 4IWKA 3A68A 3BVEA 5GN8A 1RCCA 2V2OA 3H7GA 3PVYA 3FI6A 3O7RA 4PG0A 4M34A 2Z90A 2CLUA 4DYYA 2BK6A 2V2NA 4YXMA 3RD0A 4ZKHA 1VLGA 2FG8A 3R2KA 1VEQA 4CYBA 2Z5PA 4TOHA 4TOCA 3RBCA 2W0OA 2QF9A 4P18A 4DI0A 4EVCA 3C1ZA 1OTKA 4CY9A 4M32A 1UMNA 3FRRA 1LKMA 4ZTTA 2Z6MA 3EZUA 1O9RA 4CMYA 1ZUJA 1S2ZA 3KA6A 1BFRA 3PWFA 5GU0X 3GGYA 4ZJKA 4QUWA 3ISEA 3JZAB 3KA3A 2CIHA 3N6OA 2FZFA 1RCIA 3R2HA 1GWGA 3ISFA 2VXIA 3IS8A 3ES3A 5CMQA 3SE1A 3FVBA 3QVDA 4IXKA 4LQHA 2V2IA 3E6RA 1MFRA 3F36A 5GU2X 5FFEA 1KRQA 2ZG7X 4TO9A 5D8RA 3GVYA 3U90A 4ZMCA 5FEJA 1NF4A 2FKZA 3Q4QA 4TODA 2D5KA 1RYTA 3WNWA 1QGHA 3BVKA 3MPSA 4Z3BA 3PWQC 3TA8A 4MUDA 1RCGA 3PW8C 4KVSA 2V2LA 2ZA7A 3R2RA 3EZ0A 3NOZX 4E6KA 3AJOA 3NP0X 2VZBA 3RGDA 1SQ3A 1YV1A 3SH6A 5FFBA 4CMYV 2QQYA 5D8PA 2XJNA 5ERKA 2MGYA 3KX9A 1NNQA 1JI5A 5AXSA 4TOEA 4ZL5A 2V8UA 3C1YA 1DATA 2IY4A 4Z5SA 3EGMA 5E1UA 4EVDA 1DVBA 3FRSA 2HTNA 1Z6OM 4TOAA 4LQVA 2ZG8X 4X0JA 1JGCA 3SHXA 1S3QA 2V2JA 4IWJA 3WVUA 3KXUA 3E1QA 1ZS3A 4EVEA 1NF6A 1S30A 4XKTA 5GU1X 1RCDA 1EUMA 2JD80 3GGZA 2AR0A 3A9QA 3LKDA 3HIUA 3KWOA 3VV9A 4MKUA 2V2MA 4Y08A 3KHKA 4CVRA 3PVTB 1IERA 1JREA 4DYUA 2WTLA 4RC5A 2CEIA 2XJOA 5D8QA 5D8SA 4ITTA 4XGSA 3KA8A 5C6FA 3VVAA 2XJMA 5CZUA 4ISMA 3Q4OA 3QD8A 4R42A 4KVQA 1JKVA 3F39A 3NP2X 3BVFA 4ISPA 2ZURX 4CVSA 5HJHA 2Y3QA 3UFBA 5GN8B 1RCEA 3R2LA 3OGHA 5JKLA 4DASA 3KA4A 3PVYB 4DYZA 4W4KB 2GS4A 3WVWA 4E40A 4U3GA 3IS7A 3F34A 4YVZA 3D19A 3E6SA 5K52A 3E1LA 3R2OA 1JYBA 3PVRA 4XKSA 2Z5RA 1JKUA 3AJQA 3PW1A 2GYDA 2HR5A 2F7NA 4OYNA 1FHAA 2V8TA 3PWQA 3AJPA 4AM5A 4LQJA 2JD60 5J8WA 3F33A 3QB9A 3PW8A 5J93A 3C21A 4REUA 4W4LB 3E1MA 3AF9X 2C2UA 3AK8A 4TOBA 5ERJA 4ETRA 3E1NA 5JDOA 3KA9A 4MXPA 2IB0A 1H96A 4MY7A 3F35A 2CHPA 2FHAA 3E1OA 1NFVA 3E1JA 3F32A 1AEWA 1JIGA 4CVTA 4ML5A 5GOUA 4II4A 1F33A 4ERUA 2YW6A 2X170 4M33A 2FL0A 1TKOA 3V3KB 5JKLG 2JD70 3PVRB 2G4HA 3HL1A 5CMRA 2IU2A 1DPSA 4LQNA 3AF8X 5I4JA 3QHBA 4AM4A 3JZ9A 1QYBA 5JKMA 5LG2A 4DYXA 3VNXA 1IESA 4MN9A 2ZG9X 2OKCA 4YKHA 1YUXA 2Z5QA 3KDQA 1HRSA 1J30A 1XZ1A 2WLUA 3W54A 5LS9A 2V2RA 2V15A 1F30A 1XZ3A 4II4B 4ZKXA 4KXRB 3Q4RA 5J9VA 3QZ3A 2ZA8A 3BT5A 2V2PA 4PGIA 1BG7A 4ZLWA 3C23A 3UNOA 2FJCA 4ZL6A 3ERZA 5HJFA 1N1QA 4TOFA 1O9IA 3F37A 2C2FA 3AF7X 1BCFA 4YXJA 2ITBA 4EVBA 1L8IA 5JKMG 3E1PA 3BVLA 1R03A 2ZA6A 3PZAA 2CWLA 4TW3A 5HQOA 3BKNA 2FG4A 5HU6D 2CLBA 2YW7A 4PGKA 3T9JA 3Q4NA 4A25A 4AM2A 3RE7A 2BW1A 3UOFA 2Y44A 1TKPA 5E2DA 4LPMA 4MJYA 2OC5A 2C6RA 3R2SA 2CN7A 2GYQA 4CVPA 5IX6A 4CYAA 3L0MA 5K53A 4RC5B 1LB3A 3GE4A 3WVVA 3M6JA 5D8OA 1TJOA 4ZKWA 1SOFA 2WLAA 4LPNA 4RC8A 5FFAA 3AK9A 4PG1A 4RC7A 2CN6A
chains in the Genus database with same CATH topology
1JTSA 3FSEA 3R2MA 2PYBA 2V2SA 4DZ0A 3UOIA 1L8HA 1LKOA 1Z6OA 2N02A 1VEIA 4XKUA 4DE6A 3DBYA 2YJJA 1Z4AA 4WJG4 3PW1B 5LG8A 5D8XA 3GHQA 4RC6A 5GU3X 4KVRA 4ITWA 5JACA 5J8SA 1B71A 3IQ1A 1MOJA 4LPJA 3F38A 2RBDA 1UVHA 1TK6A 2WWXB 3BVIA 2CHIA 2VXXA 3QHCA 5JDOB 4LYUA 3E2CA 4M35A 4RC7B 2CF7A 2XKQA 3RAVA 2G38B 1VELA 4TOGA 3PVTA 1LKPA 1YUZA 5D8YA 4LYXA 2BKCA 1VJXA 5FFDA 2BJYA 2YJKA 2XGWA 5LBHA 3SIDA 1JI4A 2FFXJ 3OJ5A 5FFCA 2OH3A 2C41A 2UX1A 2C2JA 4RC6B 3O7SA 4IWKA 3A68A 3BVEA 5GN8A 1RCCA 2V2OA 3H7GA 3PVYA 3FI6A 3O7RA 4PG0A 4M34A 2Z90A 2CLUA 4DYYA 2BK6A 2V2NA 4YXMA 3RD0A 4ZKHA 1VLGA 2FG8A 3R2KA 1VEQA 4CYBA 2Z5PA 4TOHA 4TOCA 3RBCA 2W0OA 2QF9A 4P18A 4DI0A 4EVCA 3C1ZA 1OTKA 4CY9A 4M32A 1UMNA 3FRRA 1LKMA 4ZTTA 2Z6MA 3EZUA 1O9RA 4CMYA 1ZUJA 1S2ZA 3KA6A 1BFRA 3PWFA 5GU0X 3GGYA 4ZJKA 4QUWA 3ISEA 3JZAB 3KA3A 2CIHA 3N6OA 2FZFA 1RCIA 3R2HA 1GWGA 3ISFA 2VXIA 3IS8A 3ES3A 5CMQA 3SE1A 3FVBA 3QVDA 4IXKA 4LQHA 2V2IA 3E6RA 1MFRA 3F36A 5GU2X 5FFEA 1KRQA 2ZG7X 4TO9A 5D8RA 3GVYA 3U90A 4ZMCA 5FEJA 1NF4A 2FKZA 3Q4QA 4TODA 2D5KA 1RYTA 3WNWA 1QGHA 3BVKA 3MPSA 4Z3BA 3PWQC 3TA8A 4MUDA 1RCGA 3PW8C 4KVSA 2V2LA 2ZA7A 3R2RA 3EZ0A 3NOZX 4E6KA 3AJOA 3NP0X 2VZBA 3RGDA 1SQ3A 1YV1A 3SH6A 5FFBA 4CMYV 2QQYA 5D8PA 2XJNA 5ERKA 2MGYA 3KX9A 1NNQA 1JI5A 5AXSA 4TOEA 4ZL5A 2V8UA 3C1YA 1DATA 2IY4A 4Z5SA 3EGMA 5E1UA 4EVDA 1DVBA 3FRSA 2HTNA 1Z6OM 4TOAA 4LQVA 2ZG8X 4X0JA 1JGCA 3SHXA 1S3QA 2V2JA 4IWJA 3WVUA 3KXUA 3E1QA 1ZS3A 4EVEA 1NF6A 1S30A 4XKTA 5GU1X 1RCDA 1EUMA 2JD80 3GGZA 2AR0A 3A9QA 3LKDA 3HIUA 3KWOA 3VV9A 4MKUA 2V2MA 4Y08A 3KHKA 4CVRA 3PVTB 1IERA 1JREA 4DYUA 2WTLA 4RC5A 2CEIA 2XJOA 5D8QA 5D8SA 4ITTA 4XGSA 3KA8A 5C6FA 3VVAA 2XJMA 5CZUA 4ISMA 3Q4OA 3QD8A 4R42A 4KVQA 1JKVA 3F39A 3NP2X 3BVFA 4ISPA 2ZURX 4CVSA 5HJHA 2Y3QA 3UFBA 5GN8B 1RCEA 3R2LA 3OGHA 5JKLA 4DASA 3KA4A 3PVYB 4DYZA 4W4KB 2GS4A 3WVWA 4E40A 4U3GA 3IS7A 3F34A 4YVZA 3D19A 3E6SA 5K52A 3E1LA 3R2OA 1JYBA 3PVRA 4XKSA 2Z5RA 1JKUA 3AJQA 3PW1A 2GYDA 2HR5A 2F7NA 4OYNA 1FHAA 2V8TA 3PWQA 3AJPA 4AM5A 4LQJA 2JD60 5J8WA 3F33A 3QB9A 3PW8A 5J93A 3C21A 4REUA 4W4LB 3E1MA 3AF9X 2C2UA 3AK8A 4TOBA 5ERJA 4ETRA 3E1NA 5JDOA 3KA9A 4MXPA 2IB0A 1H96A 4MY7A 3F35A 2CHPA 2FHAA 3E1OA 1NFVA 3E1JA 3F32A 1AEWA 1JIGA 4CVTA 4ML5A 5GOUA 4II4A 1F33A 4ERUA 2YW6A 2X170 4M33A 2FL0A 1TKOA 3V3KB 5JKLG 2JD70 3PVRB 2G4HA 3HL1A 5CMRA 2IU2A 1DPSA 4LQNA 3AF8X 5I4JA 3QHBA 4AM4A 3JZ9A 1QYBA 5JKMA 5LG2A 4DYXA 3VNXA 1IESA 4MN9A 2ZG9X 2OKCA 4YKHA 1YUXA 2Z5QA 3KDQA 1HRSA 1J30A 1XZ1A 2WLUA 3W54A 5LS9A 2V2RA 2V15A 1F30A 1XZ3A 4II4B 4ZKXA 4KXRB 3Q4RA 5J9VA 3QZ3A 2ZA8A 3BT5A 2V2PA 4PGIA 1BG7A 4ZLWA 3C23A 3UNOA 2FJCA 4ZL6A 3ERZA 5HJFA 1N1QA 4TOFA 1O9IA 3F37A 2C2FA 3AF7X 1BCFA 4YXJA 2ITBA 4EVBA 1L8IA 5JKMG 3E1PA 3BVLA 1R03A 2ZA6A 3PZAA 2CWLA 4TW3A 5HQOA 3BKNA 2FG4A 5HU6D 2CLBA 2YW7A 4PGKA 3T9JA 3Q4NA 4A25A 4AM2A 3RE7A 2BW1A 3UOFA 2Y44A 1TKPA 5E2DA 4LPMA 4MJYA 2OC5A 2C6RA 3R2SA 2CN7A 2GYQA 4CVPA 5IX6A 4CYAA 3L0MA 5K53A 4RC5B 1LB3A 3GE4A 3WVVA 3M6JA 5D8OA 1TJOA 4ZKWA 1SOFA 2WLAA 4LPNA 4RC8A 5FFAA 3AK9A 4PG1A 4RC7A 2CN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTS A;  3FSE A;  3R2M A;  2PYB A;  2V2S A;  4DZ0 A;  3UOI A;  1L8H A;  1LKO A;  1Z6O A;  1VEI A;  4XKU A;  4DE6 A;  2YJJ A;  1Z4A A;  3PW1 B;  5LG8 A;  5D8X A;  3GHQ A;  4RC6 A;  5GU3 X;  4KVR A;  4ITW A;  5JAC A;  5J8S A;  1B71 A;  3IQ1 A;  1MOJ A;  4LPJ A;  3F38 A;  2RBD A;  1UVH A;  1TK6 A;  3BVI A;  2CHI A;  2VXX A;  3QHC A;  4LYU A;  3E2C A;  4M35 A;  4RC7 B;  2CF7 A;  2XKQ A;  3RAV A;  1VEL A;  4TOG A;  3PVT A;  1LKP A;  1YUZ A;  5D8Y A;  4LYX A;  2BKC A;  1VJX A;  5FFD A;  2BJY A;  2YJK A;  2XGW A;  5LBH A;  3SID A;  1JI4 A;  2FFX J;  3OJ5 A;  5FFC A;  2OH3 A;  2C41 A;  2UX1 A;  2C2J A;  4RC6 B;  3O7S A;  4IWK A;  3A68 A;  3BVE A;  5GN8 A;  1RCC A;  2V2O A;  3H7G A;  3PVY A;  3FI6 A;  3O7R A;  4PG0 A;  4M34 A;  2Z90 A;  2CLU A;  4DYY A;  2BK6 A;  2V2N A;  3RD0 A;  4ZKH A;  1VLG A;  2FG8 A;  3R2K A;  1VEQ A;  4CYB A;  2Z5P A;  4TOH A;  4TOC A;  3RBC A;  2W0O A;  2QF9 A;  4P18 A;  4DI0 A;  4EVC A;  1OTK A;  4CY9 A;  4M32 A;  1UMN A;  1LKM A;  4ZTT A;  2Z6M A;  3EZU A;  1O9R A;  4CMY A;  1ZUJ A;  1S2Z A;  3KA6 A;  1BFR A;  3PWF A;  5GU0 X;  4ZJK A;  4QUW A;  3ISE A;  3KA3 A;  2CIH A;  2FZF A;  1RCI A;  3R2H A;  1GWG A;  3ISF A;  2VXI A;  3IS8 A;  3ES3 A;  5CMQ A;  3SE1 A;  3FVB A;  3QVD A;  4IXK A;  4LQH A;  2V2I A;  3E6R A;  1MFR A;  3F36 A;  5GU2 X;  5FFE A;  1KRQ A;  2ZG7 X;  4TO9 A;  5D8R A;  3GVY A;  3U90 A;  4ZMC A;  5FEJ A;  1NF4 A;  2FKZ A;  3Q4Q A;  4TOD A;  2D5K A;  1RYT A;  3WNW A;  1QGH A;  3BVK A;  3MPS A;  4Z3B A;  3PWQ C;  3TA8 A;  4MUD A;  1RCG A;  3PW8 C;  4KVS A;  2V2L A;  2ZA7 A;  3R2R A;  3EZ0 A;  3NOZ X;  4E6K A;  3AJO A;  3NP0 X;  2VZB A;  3RGD A;  1SQ3 A;  1YV1 A;  3SH6 A;  5FFB A;  4CMY V;  2QQY A;  5D8P A;  2XJN A;  5ERK A;  3KX9 A;  1NNQ A;  1JI5 A;  5AXS A;  4TOE A;  4ZL5 A;  1DAT A;  2IY4 A;  4Z5S A;  3EGM A;  5E1U A;  4EVD A;  1DVB A;  2HTN A;  1Z6O M;  4TOA A;  4LQV A;  2ZG8 X;  1JGC A;  3SHX A;  1S3Q A;  2V2J A;  4IWJ A;  3WVU A;  3KXU A;  3E1Q A;  1ZS3 A;  4EVE A;  1NF6 A;  1S30 A;  4XKT A;  5GU1 X;  1RCD A;  1EUM A;  2JD8 0;  3A9Q A;  3HIU A;  3KWO A;  4MKU A;  2V2M A;  4Y08 A;  4CVR A;  3PVT B;  1IER A;  1JRE A;  4DYU A;  2WTL A;  4RC5 A;  2CEI A;  2XJO A;  5D8Q A;  5D8S A;  4ITT A;  4XGS A;  3KA8 A;  5C6F A;  2XJM A;  5CZU A;  4ISM A;  3Q4O A;  3QD8 A;  4R42 A;  4KVQ A;  1JKV A;  3F39 A;  3NP2 X;  3BVF A;  4ISP A;  2ZUR X;  4CVS A;  5HJH A;  2Y3Q A;  5GN8 B;  1RCE A;  3R2L A;  3OGH A;  5JKL A;  4DAS A;  3KA4 A;  3PVY B;  4DYZ A;  2GS4 A;  3WVW A;  4U3G A;  3IS7 A;  3F34 A;  3E6S A;  5K52 A;  3E1L A;  3R2O A;  1JYB A;  3PVR A;  4XKS A;  2Z5R A;  1JKU A;  3AJQ A;  3PW1 A;  2GYD A;  2HR5 A;  2F7N A;  4OYN A;  1FHA A;  3PWQ A;  3AJP A;  4AM5 A;  4LQJ A;  2JD6 0;  5J8W A;  3F33 A;  3QB9 A;  3PW8 A;  5J93 A;  4REU A;  3E1M A;  3AF9 X;  2C2U A;  3AK8 A;  4TOB A;  5ERJ A;  4ETR A;  3E1N A;  3KA9 A;  2IB0 A;  1H96 A;  4MY7 A;  3F35 A;  2CHP A;  2FHA A;  3E1O A;  1NFV A;  3E1J A;  3F32 A;  1AEW A;  1JIG A;  4CVT A;  4ML5 A;  5GOU A;  4II4 A;  1F33 A;  4ERU A;  2YW6 A;  2X17 0;  4M33 A;  2FL0 A;  1TKO A;  5JKL G;  2JD7 0;  3PVR B;  2G4H A;  3HL1 A;  5CMR A;  2IU2 A;  1DPS A;  4LQN A;  3AF8 X;  5I4J A;  3QHB A;  4AM4 A;  1QYB A;  5JKM A;  5LG2 A;  4DYX A;  3VNX A;  1IES A;  4MN9 A;  2ZG9 X;  4YKH A;  1YUX A;  2Z5Q A;  1HRS A;  1J30 A;  1XZ1 A;  2WLU A;  5LS9 A;  2V2R A;  2V15 A;  1F30 A;  1XZ3 A;  4II4 B;  4ZKX A;  3Q4R A;  5J9V A;  3QZ3 A;  2ZA8 A;  3BT5 A;  2V2P A;  4PGI A;  1BG7 A;  4ZLW A;  3UNO A;  2FJC A;  4ZL6 A;  3ERZ A;  5HJF A;  1N1Q A;  4TOF A;  1O9I A;  3F37 A;  2C2F A;  3AF7 X;  1BCF A;  2ITB A;  4EVB A;  1L8I A;  5JKM G;  3E1P A;  3BVL A;  1R03 A;  2ZA6 A;  3PZA A;  4TW3 A;  5HQO A;  3BKN A;  2FG4 A;  2CLB A;  2YW7 A;  4PGK A;  3T9J A;  3Q4N A;  4A25 A;  4AM2 A;  3RE7 A;  2BW1 A;  3UOF A;  1TKP A;  5E2D A;  4LPM A;  4MJY A;  2OC5 A;  2C6R A;  3R2S A;  2CN7 A;  2GYQ A;  4CVP A;  5IX6 A;  4CYA A;  5K53 A;  4RC5 B;  1LB3 A;  3GE4 A;  3WVV A;  5D8O A;  1TJO A;  4ZKW A;  1SOF A;  2WLA A;  4LPN A;  4RC8 A;  5FFA A;  3AK9 A;  4PG1 A;  4RC7 A;  2CN6 A; 
#chains in the Genus database with same CATH topology
 1JTS A;  3FSE A;  3R2M A;  2PYB A;  2V2S A;  4DZ0 A;  3UOI A;  1L8H A;  1LKO A;  1Z6O A;  2N02 A;  1VEI A;  4XKU A;  4DE6 A;  3DBY A;  2YJJ A;  1Z4A A;  4WJG 4;  3PW1 B;  5LG8 A;  5D8X A;  3GHQ A;  4RC6 A;  5GU3 X;  4KVR A;  4ITW A;  5JAC A;  5J8S A;  1B71 A;  3IQ1 A;  1MOJ A;  4LPJ A;  3F38 A;  2RBD A;  1UVH A;  1TK6 A;  2WWX B;  3BVI A;  2CHI A;  2VXX A;  3QHC A;  5JDO B;  4LYU A;  3E2C A;  4M35 A;  4RC7 B;  2CF7 A;  2XKQ A;  3RAV A;  2G38 B;  1VEL A;  4TOG A;  3PVT A;  1LKP A;  1YUZ A;  5D8Y A;  4LYX A;  2BKC A;  1VJX A;  5FFD A;  2BJY A;  2YJK A;  2XGW A;  5LBH A;  3SID A;  1JI4 A;  2FFX J;  3OJ5 A;  5FFC A;  2OH3 A;  2C41 A;  2UX1 A;  2C2J A;  4RC6 B;  3O7S A;  4IWK A;  3A68 A;  3BVE A;  5GN8 A;  1RCC A;  2V2O A;  3H7G A;  3PVY A;  3FI6 A;  3O7R A;  4PG0 A;  4M34 A;  2Z90 A;  2CLU A;  4DYY A;  2BK6 A;  2V2N A;  4YXM A;  3RD0 A;  4ZKH A;  1VLG A;  2FG8 A;  3R2K A;  1VEQ A;  4CYB A;  2Z5P A;  4TOH A;  4TOC A;  3RBC A;  2W0O A;  2QF9 A;  4P18 A;  4DI0 A;  4EVC A;  3C1Z A;  1OTK A;  4CY9 A;  4M32 A;  1UMN A;  3FRR A;  1LKM A;  4ZTT A;  2Z6M A;  3EZU A;  1O9R A;  4CMY A;  1ZUJ A;  1S2Z A;  3KA6 A;  1BFR A;  3PWF A;  5GU0 X;  3GGY A;  4ZJK A;  4QUW A;  3ISE A;  3JZA B;  3KA3 A;  2CIH A;  3N6O A;  2FZF A;  1RCI A;  3R2H A;  1GWG A;  3ISF A;  2VXI A;  3IS8 A;  3ES3 A;  5CMQ A;  3SE1 A;  3FVB A;  3QVD A;  4IXK A;  4LQH A;  2V2I A;  3E6R A;  1MFR A;  3F36 A;  5GU2 X;  5FFE A;  1KRQ A;  2ZG7 X;  4TO9 A;  5D8R A;  3GVY A;  3U90 A;  4ZMC A;  5FEJ A;  1NF4 A;  2FKZ A;  3Q4Q A;  4TOD A;  2D5K A;  1RYT A;  3WNW A;  1QGH A;  3BVK A;  3MPS A;  4Z3B A;  3PWQ C;  3TA8 A;  4MUD A;  1RCG A;  3PW8 C;  4KVS A;  2V2L A;  2ZA7 A;  3R2R A;  3EZ0 A;  3NOZ X;  4E6K A;  3AJO A;  3NP0 X;  2VZB A;  3RGD A;  1SQ3 A;  1YV1 A;  3SH6 A;  5FFB A;  4CMY V;  2QQY A;  5D8P A;  2XJN A;  5ERK A;  2MGY A;  3KX9 A;  1NNQ A;  1JI5 A;  5AXS A;  4TOE A;  4ZL5 A;  2V8U A;  3C1Y A;  1DAT A;  2IY4 A;  4Z5S A;  3EGM A;  5E1U A;  4EVD A;  1DVB A;  3FRS A;  2HTN A;  1Z6O M;  4TOA A;  4LQV A;  2ZG8 X;  4X0J A;  1JGC A;  3SHX A;  1S3Q A;  2V2J A;  4IWJ A;  3WVU A;  3KXU A;  3E1Q A;  1ZS3 A;  4EVE A;  1NF6 A;  1S30 A;  4XKT A;  5GU1 X;  1RCD A;  1EUM A;  2JD8 0;  3GGZ A;  2AR0 A;  3A9Q A;  3LKD A;  3HIU A;  3KWO A;  3VV9 A;  4MKU A;  2V2M A;  4Y08 A;  3KHK A;  4CVR A;  3PVT B;  1IER A;  1JRE A;  4DYU A;  2WTL A;  4RC5 A;  2CEI A;  2XJO A;  5D8Q A;  5D8S A;  4ITT A;  4XGS A;  3KA8 A;  5C6F A;  3VVA A;  2XJM A;  5CZU A;  4ISM A;  3Q4O A;  3QD8 A;  4R42 A;  4KVQ A;  1JKV A;  3F39 A;  3NP2 X;  3BVF A;  4ISP A;  2ZUR X;  4CVS A;  5HJH A;  2Y3Q A;  3UFB A;  5GN8 B;  1RCE A;  3R2L A;  3OGH A;  5JKL A;  4DAS A;  3KA4 A;  3PVY B;  4DYZ A;  4W4K B;  2GS4 A;  3WVW A;  4E40 A;  4U3G A;  3IS7 A;  3F34 A;  4YVZ A;  3D19 A;  3E6S A;  5K52 A;  3E1L A;  3R2O A;  1JYB A;  3PVR A;  4XKS A;  2Z5R A;  1JKU A;  3AJQ A;  3PW1 A;  2GYD A;  2HR5 A;  2F7N A;  4OYN A;  1FHA A;  2V8T A;  3PWQ A;  3AJP A;  4AM5 A;  4LQJ A;  2JD6 0;  5J8W A;  3F33 A;  3QB9 A;  3PW8 A;  5J93 A;  3C21 A;  4REU A;  4W4L B;  3E1M A;  3AF9 X;  2C2U A;  3AK8 A;  4TOB A;  5ERJ A;  4ETR A;  3E1N A;  5JDO A;  3KA9 A;  4MXP A;  2IB0 A;  1H96 A;  4MY7 A;  3F35 A;  2CHP A;  2FHA A;  3E1O A;  1NFV A;  3E1J A;  3F32 A;  1AEW A;  1JIG A;  4CVT A;  4ML5 A;  5GOU A;  4II4 A;  1F33 A;  4ERU A;  2YW6 A;  2X17 0;  4M33 A;  2FL0 A;  1TKO A;  3V3K B;  5JKL G;  2JD7 0;  3PVR B;  2G4H A;  3HL1 A;  5CMR A;  2IU2 A;  1DPS A;  4LQN A;  3AF8 X;  5I4J A;  3QHB A;  4AM4 A;  3JZ9 A;  1QYB A;  5JKM A;  5LG2 A;  4DYX A;  3VNX A;  1IES A;  4MN9 A;  2ZG9 X;  2OKC A;  4YKH A;  1YUX A;  2Z5Q A;  3KDQ A;  1HRS A;  1J30 A;  1XZ1 A;  2WLU A;  3W54 A;  5LS9 A;  2V2R A;  2V15 A;  1F30 A;  1XZ3 A;  4II4 B;  4ZKX A;  4KXR B;  3Q4R A;  5J9V A;  3QZ3 A;  2ZA8 A;  3BT5 A;  2V2P A;  4PGI A;  1BG7 A;  4ZLW A;  3C23 A;  3UNO A;  2FJC A;  4ZL6 A;  3ERZ A;  5HJF A;  1N1Q A;  4TOF A;  1O9I A;  3F37 A;  2C2F A;  3AF7 X;  1BCF A;  4YXJ A;  2ITB A;  4EVB A;  1L8I A;  5JKM G;  3E1P A;  3BVL A;  1R03 A;  2ZA6 A;  3PZA A;  2CWL A;  4TW3 A;  5HQO A;  3BKN A;  2FG4 A;  5HU6 D;  2CLB A;  2YW7 A;  4PGK A;  3T9J A;  3Q4N A;  4A25 A;  4AM2 A;  3RE7 A;  2BW1 A;  3UOF A;  2Y44 A;  1TKP A;  5E2D A;  4LPM A;  4MJY A;  2OC5 A;  2C6R A;  3R2S A;  2CN7 A;  2GYQ A;  4CVP A;  5IX6 A;  4CYA A;  3L0M A;  5K53 A;  4RC5 B;  1LB3 A;  3GE4 A;  3WVV A;  3M6J A;  5D8O A;  1TJO A;  4ZKW A;  1SOF A;  2WLA A;  4LPN A;  4RC8 A;  5FFA A;  3AK9 A;  4PG1 A;  4RC7 A;  2CN6 A; 
#chains in the Genus database with same CATH homology
 1JTS A;  3FSE A;  3R2M A;  2PYB A;  2V2S A;  4DZ0 A;  3UOI A;  1L8H A;  1LKO A;  1Z6O A;  2N02 A;  1VEI A;  4XKU A;  4DE6 A;  3DBY A;  2YJJ A;  1Z4A A;  4WJG 4;  3PW1 B;  5LG8 A;  5D8X A;  3GHQ A;  4RC6 A;  5GU3 X;  4KVR A;  4ITW A;  5JAC A;  5J8S A;  1B71 A;  3IQ1 A;  1MOJ A;  4LPJ A;  3F38 A;  2RBD A;  1UVH A;  1TK6 A;  2WWX B;  3BVI A;  2CHI A;  2VXX A;  3QHC A;  5JDO B;  4LYU A;  3E2C A;  4M35 A;  4RC7 B;  2CF7 A;  2XKQ A;  3RAV A;  2G38 B;  1VEL A;  4TOG A;  3PVT A;  1LKP A;  1YUZ A;  5D8Y A;  4LYX A;  2BKC A;  1VJX A;  5FFD A;  2BJY A;  2YJK A;  2XGW A;  5LBH A;  3SID A;  1JI4 A;  2FFX J;  3OJ5 A;  5FFC A;  2OH3 A;  2C41 A;  2UX1 A;  2C2J A;  4RC6 B;  3O7S A;  4IWK A;  3A68 A;  3BVE A;  5GN8 A;  1RCC A;  2V2O A;  3H7G A;  3PVY A;  3FI6 A;  3O7R A;  4PG0 A;  4M34 A;  2Z90 A;  2CLU A;  4DYY A;  2BK6 A;  2V2N A;  4YXM A;  3RD0 A;  4ZKH A;  1VLG A;  2FG8 A;  3R2K A;  1VEQ A;  4CYB A;  2Z5P A;  4TOH A;  4TOC A;  3RBC A;  2W0O A;  2QF9 A;  4P18 A;  4DI0 A;  4EVC A;  3C1Z A;  1OTK A;  4CY9 A;  4M32 A;  1UMN A;  3FRR A;  1LKM A;  4ZTT A;  2Z6M A;  3EZU A;  1O9R A;  4CMY A;  1ZUJ A;  1S2Z A;  3KA6 A;  1BFR A;  3PWF A;  5GU0 X;  3GGY A;  4ZJK A;  4QUW A;  3ISE A;  3JZA B;  3KA3 A;  2CIH A;  3N6O A;  2FZF A;  1RCI A;  3R2H A;  1GWG A;  3ISF A;  2VXI A;  3IS8 A;  3ES3 A;  5CMQ A;  3SE1 A;  3FVB A;  3QVD A;  4IXK A;  4LQH A;  2V2I A;  3E6R A;  1MFR A;  3F36 A;  5GU2 X;  5FFE A;  1KRQ A;  2ZG7 X;  4TO9 A;  5D8R A;  3GVY A;  3U90 A;  4ZMC A;  5FEJ A;  1NF4 A;  2FKZ A;  3Q4Q A;  4TOD A;  2D5K A;  1RYT A;  3WNW A;  1QGH A;  3BVK A;  3MPS A;  4Z3B A;  3PWQ C;  3TA8 A;  4MUD A;  1RCG A;  3PW8 C;  4KVS A;  2V2L A;  2ZA7 A;  3R2R A;  3EZ0 A;  3NOZ X;  4E6K A;  3AJO A;  3NP0 X;  2VZB A;  3RGD A;  1SQ3 A;  1YV1 A;  3SH6 A;  5FFB A;  4CMY V;  2QQY A;  5D8P A;  2XJN A;  5ERK A;  2MGY A;  3KX9 A;  1NNQ A;  1JI5 A;  5AXS A;  4TOE A;  4ZL5 A;  2V8U A;  3C1Y A;  1DAT A;  2IY4 A;  4Z5S A;  3EGM A;  5E1U A;  4EVD A;  1DVB A;  3FRS A;  2HTN A;  1Z6O M;  4TOA A;  4LQV A;  2ZG8 X;  4X0J A;  1JGC A;  3SHX A;  1S3Q A;  2V2J A;  4IWJ A;  3WVU A;  3KXU A;  3E1Q A;  1ZS3 A;  4EVE A;  1NF6 A;  1S30 A;  4XKT A;  5GU1 X;  1RCD A;  1EUM A;  2JD8 0;  3GGZ A;  2AR0 A;  3A9Q A;  3LKD A;  3HIU A;  3KWO A;  3VV9 A;  4MKU A;  2V2M A;  4Y08 A;  3KHK A;  4CVR A;  3PVT B;  1IER A;  1JRE A;  4DYU A;  2WTL A;  4RC5 A;  2CEI A;  2XJO A;  5D8Q A;  5D8S A;  4ITT A;  4XGS A;  3KA8 A;  5C6F A;  3VVA A;  2XJM A;  5CZU A;  4ISM A;  3Q4O A;  3QD8 A;  4R42 A;  4KVQ A;  1JKV A;  3F39 A;  3NP2 X;  3BVF A;  4ISP A;  2ZUR X;  4CVS A;  5HJH A;  2Y3Q A;  3UFB A;  5GN8 B;  1RCE A;  3R2L A;  3OGH A;  5JKL A;  4DAS A;  3KA4 A;  3PVY B;  4DYZ A;  4W4K B;  2GS4 A;  3WVW A;  4E40 A;  4U3G A;  3IS7 A;  3F34 A;  4YVZ A;  3D19 A;  3E6S A;  5K52 A;  3E1L A;  3R2O A;  1JYB A;  3PVR A;  4XKS A;  2Z5R A;  1JKU A;  3AJQ A;  3PW1 A;  2GYD A;  2HR5 A;  2F7N A;  4OYN A;  1FHA A;  2V8T A;  3PWQ A;  3AJP A;  4AM5 A;  4LQJ A;  2JD6 0;  5J8W A;  3F33 A;  3QB9 A;  3PW8 A;  5J93 A;  3C21 A;  4REU A;  4W4L B;  3E1M A;  3AF9 X;  2C2U A;  3AK8 A;  4TOB A;  5ERJ A;  4ETR A;  3E1N A;  5JDO A;  3KA9 A;  4MXP A;  2IB0 A;  1H96 A;  4MY7 A;  3F35 A;  2CHP A;  2FHA A;  3E1O A;  1NFV A;  3E1J A;  3F32 A;  1AEW A;  1JIG A;  4CVT A;  4ML5 A;  5GOU A;  4II4 A;  1F33 A;  4ERU A;  2YW6 A;  2X17 0;  4M33 A;  2FL0 A;  1TKO A;  3V3K B;  5JKL G;  2JD7 0;  3PVR B;  2G4H A;  3HL1 A;  5CMR A;  2IU2 A;  1DPS A;  4LQN A;  3AF8 X;  5I4J A;  3QHB A;  4AM4 A;  3JZ9 A;  1QYB A;  5JKM A;  5LG2 A;  4DYX A;  3VNX A;  1IES A;  4MN9 A;  2ZG9 X;  2OKC A;  4YKH A;  1YUX A;  2Z5Q A;  3KDQ A;  1HRS A;  1J30 A;  1XZ1 A;  2WLU A;  3W54 A;  5LS9 A;  2V2R A;  2V15 A;  1F30 A;  1XZ3 A;  4II4 B;  4ZKX A;  4KXR B;  3Q4R A;  5J9V A;  3QZ3 A;  2ZA8 A;  3BT5 A;  2V2P A;  4PGI A;  1BG7 A;  4ZLW A;  3C23 A;  3UNO A;  2FJC A;  4ZL6 A;  3ERZ A;  5HJF A;  1N1Q A;  4TOF A;  1O9I A;  3F37 A;  2C2F A;  3AF7 X;  1BCF A;  4YXJ A;  2ITB A;  4EVB A;  1L8I A;  5JKM G;  3E1P A;  3BVL A;  1R03 A;  2ZA6 A;  3PZA A;  2CWL A;  4TW3 A;  5HQO A;  3BKN A;  2FG4 A;  5HU6 D;  2CLB A;  2YW7 A;  4PGK A;  3T9J A;  3Q4N A;  4A25 A;  4AM2 A;  3RE7 A;  2BW1 A;  3UOF A;  2Y44 A;  1TKP A;  5E2D A;  4LPM A;  4MJY A;  2OC5 A;  2C6R A;  3R2S A;  2CN7 A;  2GYQ A;  4CVP A;  5IX6 A;  4CYA A;  3L0M A;  5K53 A;  4RC5 B;  1LB3 A;  3GE4 A;  3WVV A;  3M6J A;  5D8O A;  1TJO A;  4ZKW A;  1SOF A;  2WLA A;  4LPN A;  4RC8 A;  5FFA A;  3AK9 A;  4PG1 A;  4RC7 A;  2CN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...