1DPSA

The crystal structure of dps, a ferritin homolog that binds and protects dna
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
159
structure length
159
Chain Sequence
SKATNLLYTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAKDDDTADILTAASRDLDKFLWFIECNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DPS
publication title The crystal structure of Dps, a ferritin homolog that binds and protects DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 1998-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1dpsA00
2YJKA 1RCIA 2JD80 2V2IA 2FHAA 3QB9A 1JIGA 1TKPA 4XKSA 3KA4A 1F33A 1DPSA 3E2CA 1IESA 3R2MA 2WTLA 3OGHA 3F34A 2X170 1S30A 3FVBA 1BCFA 5JKMG 4R42A 5GN8B 2BW1A 4EVCA 1J30A 2WLUA 1UVHA 3AJOA 3O7SA 1NNQA 1VLGA 5IX6A 3RD0A 2ZG8X 2V2LA 3GHQA 3FSEA 2Y3QA 2XGWA 3PZAA 4LYXA 2C41A 5HQOA 4MUDA 2V2NA 3SHXA 3AJQA 5C6FA 1QGHA 3R2HA 5JKLG 1O9IA 3Q4RA 3WVVA 4DYUA 3ISFA 2FFXJ 2RBDA 4U3GA 2G4HA 4PGKA 1NF4A 5GU1X 2Z5PA 4TOHA 2VXIA 4ETRA 4CMYA 1RYTA 4LQJA 3ERZA 1JYBA 2CLUA 4EVEA 1RCGA 3PVRA 2YW7A 1VEIA 2V2RA 2V2PA 3BVLA 5I4JA 4TOCA 4ZTTA 3R2SA 2XJOA 3BVIA 3PW8A 3Q4QA 1MOJA 4CY9A 3R2LA 4IXKA 3GVYA 3AF7X 5LG2A 5FFEA 4RC7A 4A25A 1LKMA 4EVBA 1RCDA 4DYYA 3A9QA 4ZKXA 3QZ3A 4II4B 2ITBA 1NFVA 3KXUA 5J93A 4DZ0A 2CIHA 2UX1A 4EVDA 5AXSA 3U90A 3R2KA 4DYZA 4TOAA 2CHIA 4TW3A 5CMRA 3FI6A 4AM2A 2ZG9X 3NP0X 4LPJA 1TKOA 5D8XA 2C2JA 1Z6OM 4QUWA 1R03A 4LPNA 4M33A 4ITWA 5JKMA 5FFDA 1VJXA 4TOGA 1Z6OA 1JI5A 2D5KA 3SIDA 3RGDA 1SQ3A 3SE1A 1JKVA 4DASA 1HRSA 1F30A 5JACA 2QF9A 4Z5SA 5GU0X 1YUZA 4Z3BA 3R2OA 4ZJKA 4KVQA 4M35A 1JTSA 3E1LA 3MPSA 1TK6A 1GWGA 2Z90A 3PVYA 5LBHA 3E6RA 5JKLA 2FG4A 3F32A 3QHCA 4YKHA 4AM5A 3E1OA 2C6RA 5FFCA 4RC6A 3AK9A 3HIUA 3BVFA 1BFRA 2VXXA 3T9JA 2CEIA 2C2UA 4XKTA 4TOFA 5J8WA 5ERKA 1L8HA 3PW8C 4MN9A 2HTNA 5E1UA 3WVUA 2IB0A 3QVDA 3F35A 4REUA 4CVSA 5FEJA 3UNOA 4ZLWA 4LQVA 1SOFA 2CLBA 2V15A 1BG7A 2V2OA 3BVEA 2BJYA 3VNXA 5LG8A 5ERJA 1QYBA 1OTKA 4CVPA 5CMQA 3BKNA 2CN7A 2FG8A 3PVTB 2CN6A 1YUXA 3KA9A 3ES3A 4PGIA 2YW6A 3KX9A 3QHBA 2ZA8A 4DYXA 5D8QA 2XJNA 4OYNA 2Z5RA 3PW1B 3UOFA 4TODA 3RBCA 2QQYA 4LQNA 3PVRB 2CHPA 3KA3A 1RCCA 4Y08A 3E1NA 2JD70 2V2MA 3QD8A 4RC5A 1EUMA 1JI4A 4LPMA 4M32A 3E1MA 3E1QA 1ZS3A 5FFBA 4ISPA 1KRQA 2BK6A 1NF6A 3RAVA 5J9VA 3F33A 4E6KA 1XZ1A 5D8PA 4KVRA 4M34A 2FJCA 4RC7B 4ZKWA 4TO9A 1ZUJA 2W0OA 3OJ5A 1O9RA 1LKOA 3E1JA 2F7NA 2Z6MA 5D8YA 4LQHA 3GE4A 5GU2X 4ZMCA 1Z4AA 2FZFA 2YJJA 5GN8A 1VEQA 4ZL6A 4TOEA 3KA8A 5CZUA 3KWOA 3IS7A 5E2DA 3IS8A 3F37A 3NP2X 4IWJA 4CYAA 4TOBA 3UOIA 3EGMA 3PWQA 2FKZA 1DATA 4XKUA 4ML5A 5J8SA 5K53A 3KA6A 3F39A 1YV1A 1S2ZA 2JD60 2XJMA 2XKQA 4CMYV 3BT5A 3NOZX 2ZA7A 3Q4NA 1JREA 5GU3X 2HR5A 1DVBA 3EZUA 5FFAA 1VELA 1S3QA 2CF7A 2PYBA 3PVYB 2FL0A 1AEWA 4CYBA 3PVTA 2IY4A 2ZG7X 4RC6B 3BVKA 1JGCA 1RCEA 2WLAA 3WVWA 4RC8A 3R2RA 3F36A 2OC5A 4AM4A 3EZ0A 4DE6A 3AJPA 3PW1A 1L8IA 3HL1A 3H7GA 1JKUA 4II4A 3E6SA 5HJFA 5K52A 2Z5QA 1H96A 2GS4A 3Q4OA 3AK8A 4PG0A 1FHAA 2VZBA 1LKPA 2GYQA 1MFRA 1TJOA 1UMNA 2IU2A 4MJYA 3TA8A 3RE7A 1B71A 3O7RA 3PWFA 1IERA 4ISMA 4ITTA 2V2SA 4ZKHA 4KVSA 4CVRA 3F38A 3AF8X 5D8RA 3IQ1A 4MKUA 4XGSA 5LS9A 2GYDA 4PG1A 4DI0A 2ZA6A 3SH6A 2C2FA 3PWQC 3A68A 1LB3A 4P18A 5HJHA 2V2JA 5D8SA 3ISEA 2BKCA 1N1QA 5GOUA 4CVTA 4RC5B 3WNWA 4ERUA 4ZL5A 1XZ3A 2ZURX 3AF9X 4IWKA 3E1PA 4LYUA 2OH3A 5D8OA 4MY7A
chains in the Genus database with same CATH superfamily
2YJKA 1RCIA 2JD80 2V2IA 2FHAA 3QB9A 1JIGA 1TKPA 4XKSA 3KA4A 1F33A 1DPSA 3E2CA 1IESA 3R2MA 2WTLA 3OGHA 3F34A 2X170 1S30A 3FVBA 1BCFA 5JKMG 4R42A 5GN8B 2BW1A 4EVCA 4W4LB 1J30A 2WLUA 1UVHA 3AJOA 3O7SA 1NNQA 1VLGA 3LKDA 5IX6A 3RD0A 2ZG8X 2V2LA 3GHQA 3FSEA 2Y3QA 3N6OA 2XGWA 3PZAA 4LYXA 2C41A 5HQOA 4MUDA 2V2NA 3SHXA 3AJQA 5C6FA 1QGHA 3JZ9A 3R2HA 5JKLG 1O9IA 3Q4RA 3WVVA 4DYUA 3ISFA 2FFXJ 2RBDA 4U3GA 2G4HA 4PGKA 1NF4A 5GU1X 2Z5PA 4TOHA 2VXIA 4ETRA 4CMYA 1RYTA 4LQJA 2MGYA 3UFBA 3ERZA 1JYBA 3C1ZA 4X0JA 2CLUA 4EVEA 1RCGA 3PVRA 2YW7A 1VEIA 2V2RA 2V2PA 3BVLA 5I4JA 4TOCA 4ZTTA 3R2SA 2XJOA 3BVIA 3PW8A 3Q4QA 1MOJA 3VV9A 4CY9A 3R2LA 4IXKA 3GVYA 3AF7X 5LG2A 5FFEA 4RC7A 4A25A 3GGZA 1LKMA 4EVBA 1RCDA 4DYYA 3A9QA 4ZKXA 3QZ3A 4II4B 2ITBA 1NFVA 3KXUA 5J93A 4DZ0A 2CIHA 2UX1A 4EVDA 5AXSA 4WJG4 3U90A 3R2KA 4DYZA 4TOAA 2CHIA 4TW3A 3W54A 5CMRA 3FI6A 4AM2A 2ZG9X 5JDOB 3NP0X 4LPJA 1TKOA 5D8XA 2C2JA 1Z6OM 4QUWA 1R03A 4LPNA 4M33A 2G38B 4ITWA 5JKMA 5FFDA 1VJXA 4TOGA 1Z6OA 4E40A 1JI5A 2D5KA 4MY7A 3SIDA 3RGDA 3KDQA 1SQ3A 3SE1A 1JKVA 4DASA 1HRSA 1F30A 5JACA 2QF9A 4Z5SA 5GU0X 1YUZA 4Z3BA 3R2OA 4ZJKA 4KVQA 4M35A 1JTSA 3E1LA 3MPSA 1TK6A 1GWGA 3DBYA 2Z90A 3PVYA 5LBHA 3E6RA 5JKLA 2FG4A 3F32A 3QHCA 4YKHA 4AM5A 3E1OA 2C6RA 5FFCA 4RC6A 3AK9A 3HIUA 3BVFA 1BFRA 4KXRB 2VXXA 3T9JA 2CEIA 2C2UA 4XKTA 4TOFA 5J8WA 5ERKA 1L8HA 3PW8C 2V8TA 4MN9A 2HTNA 5E1UA 3WVUA 2IB0A 3QVDA 3D19A 3F35A 4REUA 4CVSA 3FRRA 5FEJA 3UNOA 4ZLWA 4LQVA 1SOFA 2CLBA 2V15A 1BG7A 2V2OA 3BVEA 2BJYA 3FRSA 3VNXA 5LG8A 5ERJA 1QYBA 1OTKA 4CVPA 5CMQA 3BKNA 2CN7A 2FG8A 3PVTB 3VVAA 2CN6A 1YUXA 3KA9A 3ES3A 4PGIA 2YW6A 3KX9A 3QHBA 2ZA8A 4DYXA 4MXPA 5D8QA 2XJNA 4OYNA 2Z5RA 3PW1B 3UOFA 4TODA 3RBCA 2QQYA 3M6JA 3V3KB 4LQNA 3PVRB 2CHPA 3KA3A 1RCCA 4Y08A 3E1NA 2JD70 2V2MA 3QD8A 4RC5A 1EUMA 1JI4A 4LPMA 4M32A 3E1MA 3E1QA 1ZS3A 5FFBA 4ISPA 1KRQA 2BK6A 1NF6A 3RAVA 5J9VA 3F33A 4E6KA 1XZ1A 5D8PA 4KVRA 4M34A 2Y44A 2FJCA 4RC7B 4ZKWA 4TO9A 1ZUJA 2W0OA 3OJ5A 1O9RA 1LKOA 3E1JA 2F7NA 2Z6MA 5D8YA 4LQHA 3GE4A 4YVZA 5GU2X 2AR0A 4ZMCA 1Z4AA 2FZFA 2YJJA 5GN8A 1VEQA 4ZL6A 4TOEA 3KA8A 5CZUA 3KWOA 3IS7A 5E2DA 3IS8A 3JZAB 3F37A 3NP2X 4IWJA 4CYAA 4TOBA 3UOIA 3C21A 3EGMA 3PWQA 2FKZA 1DATA 4XKUA 4ML5A 5J8SA 5K53A 3KA6A 3F39A 1YV1A 1S2ZA 4YXMA 2JD60 2XJMA 2XKQA 4CMYV 3BT5A 3NOZX 2ZA7A 3Q4NA 1JREA 3L0MA 2N02A 5GU3X 5HU6D 2HR5A 1DVBA 3EZUA 5FFAA 1VELA 1S3QA 2OKCA 2CF7A 2PYBA 3GGYA 3KHKA 2FL0A 3PVYB 1AEWA 4CYBA 3PVTA 2IY4A 2ZG7X 4RC6B 3BVKA 2WWXB 1JGCA 1RCEA 2WLAA 3WVWA 4RC8A 3R2RA 3F36A 4W4KB 2OC5A 3C23A 4AM4A 3EZ0A 4DE6A 3AJPA 3PW1A 1L8IA 3HL1A 3H7GA 1JKUA 4II4A 3E6SA 5HJFA 5K52A 2Z5QA 2GS4A 3Q4OA 3AK8A 4PG0A 1FHAA 2VZBA 1LKPA 2GYQA 1MFRA 1TJOA 1UMNA 2IU2A 4MJYA 3TA8A 3RE7A 5JDOA 1B71A 3O7RA 2V8UA 3PWFA 1IERA 4ISMA 4ITTA 2V2SA 4ZKHA 4KVSA 4CVRA 3F38A 4YXJA 2CWLA 3AF8X 5D8RA 3IQ1A 4MKUA 4XGSA 5LS9A 2GYDA 4PG1A 4DI0A 2ZA6A 3SH6A 2C2FA 3PWQC 3A68A 1LB3A 4P18A 5HJHA 3C1YA 2V2JA 5D8SA 3ISEA 2BKCA 1N1QA 5GOUA 4CVTA 4RC5B 3WNWA 4ERUA 4ZL5A 1XZ3A 2ZURX 3AF9X 4IWKA 3E1PA 4LYUA 2OH3A 5D8OA 1H96A
chains in the Genus database with same CATH topology
2YJKA 1RCIA 2JD80 2V2IA 2FHAA 3QB9A 1JIGA 1TKPA 4XKSA 3KA4A 1F33A 1DPSA 3E2CA 1IESA 3R2MA 2WTLA 3OGHA 3F34A 2X170 1S30A 3FVBA 1BCFA 5JKMG 4R42A 5GN8B 2BW1A 4EVCA 4W4LB 1J30A 2WLUA 1UVHA 3AJOA 3O7SA 1NNQA 1VLGA 3LKDA 5IX6A 3RD0A 2ZG8X 2V2LA 3GHQA 3FSEA 2Y3QA 3N6OA 2XGWA 3PZAA 4LYXA 2C41A 5HQOA 4MUDA 2V2NA 3SHXA 3AJQA 5C6FA 1QGHA 3JZ9A 3R2HA 5JKLG 1O9IA 3Q4RA 3WVVA 4DYUA 3ISFA 2FFXJ 2RBDA 4U3GA 2G4HA 4PGKA 1NF4A 5GU1X 2Z5PA 4TOHA 2VXIA 4ETRA 4CMYA 1RYTA 4LQJA 2MGYA 3UFBA 3ERZA 1JYBA 3C1ZA 4X0JA 2CLUA 4EVEA 1RCGA 3PVRA 2YW7A 1VEIA 2V2RA 2V2PA 3BVLA 5I4JA 4TOCA 4ZTTA 3R2SA 2XJOA 3BVIA 3PW8A 3Q4QA 1MOJA 3VV9A 4CY9A 3R2LA 4IXKA 3GVYA 3AF7X 5LG2A 5FFEA 4RC7A 4A25A 3GGZA 1LKMA 4EVBA 1RCDA 4DYYA 3A9QA 4ZKXA 3QZ3A 4II4B 2ITBA 1NFVA 3KXUA 5J93A 4DZ0A 2CIHA 2UX1A 4EVDA 5AXSA 4WJG4 3U90A 3R2KA 4DYZA 4TOAA 2CHIA 4TW3A 3W54A 5CMRA 3FI6A 4AM2A 2ZG9X 5JDOB 3NP0X 4LPJA 1TKOA 5D8XA 2C2JA 1Z6OM 4QUWA 1R03A 4LPNA 4M33A 2G38B 4ITWA 5JKMA 5FFDA 1VJXA 4TOGA 1Z6OA 4E40A 1JI5A 2D5KA 4MY7A 3SIDA 3RGDA 3KDQA 1SQ3A 3SE1A 1JKVA 4DASA 1HRSA 1F30A 5JACA 2QF9A 4Z5SA 5GU0X 1YUZA 4Z3BA 3R2OA 4ZJKA 4KVQA 4M35A 1JTSA 3E1LA 3MPSA 1TK6A 1GWGA 3DBYA 2Z90A 3PVYA 5LBHA 3E6RA 5JKLA 2FG4A 3F32A 3QHCA 4YKHA 4AM5A 3E1OA 2C6RA 5FFCA 4RC6A 3AK9A 3HIUA 3BVFA 1BFRA 4KXRB 2VXXA 3T9JA 2CEIA 2C2UA 4XKTA 4TOFA 5J8WA 5ERKA 1L8HA 3PW8C 2V8TA 4MN9A 2HTNA 5E1UA 3WVUA 2IB0A 3QVDA 3D19A 3F35A 4REUA 4CVSA 3FRRA 5FEJA 3UNOA 4ZLWA 4LQVA 1SOFA 2CLBA 2V15A 1BG7A 2V2OA 3BVEA 2BJYA 3FRSA 3VNXA 5LG8A 5ERJA 1QYBA 1OTKA 4CVPA 5CMQA 3BKNA 2CN7A 2FG8A 3PVTB 3VVAA 2CN6A 1YUXA 3KA9A 3ES3A 4PGIA 2YW6A 3KX9A 3QHBA 2ZA8A 4DYXA 4MXPA 5D8QA 2XJNA 4OYNA 2Z5RA 3PW1B 3UOFA 4TODA 3RBCA 2QQYA 3M6JA 3V3KB 4LQNA 3PVRB 2CHPA 3KA3A 1RCCA 4Y08A 3E1NA 2JD70 2V2MA 3QD8A 4RC5A 1EUMA 1JI4A 4LPMA 4M32A 3E1MA 3E1QA 1ZS3A 5FFBA 4ISPA 1KRQA 2BK6A 1NF6A 3RAVA 5J9VA 3F33A 4E6KA 1XZ1A 5D8PA 4KVRA 4M34A 2Y44A 2FJCA 4RC7B 4ZKWA 4TO9A 1ZUJA 2W0OA 3OJ5A 1O9RA 1LKOA 3E1JA 2F7NA 2Z6MA 5D8YA 4LQHA 3GE4A 4YVZA 5GU2X 2AR0A 4ZMCA 1Z4AA 2FZFA 2YJJA 5GN8A 1VEQA 4ZL6A 4TOEA 3KA8A 5CZUA 3KWOA 3IS7A 5E2DA 3IS8A 3JZAB 3F37A 3NP2X 4IWJA 4CYAA 4TOBA 3UOIA 3C21A 3EGMA 3PWQA 2FKZA 1DATA 4XKUA 4ML5A 5J8SA 5K53A 3KA6A 3F39A 1YV1A 1S2ZA 4YXMA 2JD60 2XJMA 2XKQA 4CMYV 3BT5A 3NOZX 2ZA7A 3Q4NA 1JREA 3L0MA 2N02A 5GU3X 5HU6D 2HR5A 1DVBA 3EZUA 5FFAA 1VELA 1S3QA 2OKCA 2CF7A 2PYBA 3GGYA 3KHKA 2FL0A 3PVYB 1AEWA 4CYBA 3PVTA 2IY4A 2ZG7X 4RC6B 3BVKA 2WWXB 1JGCA 1RCEA 2WLAA 3WVWA 4RC8A 3R2RA 3F36A 4W4KB 2OC5A 3C23A 4AM4A 3EZ0A 4DE6A 3AJPA 3PW1A 1L8IA 3HL1A 3H7GA 1JKUA 4II4A 3E6SA 5HJFA 5K52A 2Z5QA 2GS4A 3Q4OA 3AK8A 4PG0A 1FHAA 2VZBA 1LKPA 2GYQA 1MFRA 1TJOA 1UMNA 2IU2A 4MJYA 3TA8A 3RE7A 5JDOA 1B71A 3O7RA 2V8UA 3PWFA 1IERA 4ISMA 4ITTA 2V2SA 4ZKHA 4KVSA 4CVRA 3F38A 4YXJA 2CWLA 3AF8X 5D8RA 3IQ1A 4MKUA 4XGSA 5LS9A 2GYDA 4PG1A 4DI0A 2ZA6A 3SH6A 2C2FA 3PWQC 3A68A 1LB3A 4P18A 5HJHA 3C1YA 2V2JA 5D8SA 3ISEA 2BKCA 1N1QA 5GOUA 4CVTA 4RC5B 3WNWA 4ERUA 4ZL5A 1XZ3A 2ZURX 3AF9X 4IWKA 3E1PA 4LYUA 2OH3A 5D8OA 1H96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJK A;  1RCI A;  2JD8 0;  2V2I A;  2FHA A;  3QB9 A;  1JIG A;  1TKP A;  4XKS A;  3KA4 A;  1F33 A;  1DPS A;  3E2C A;  1IES A;  3R2M A;  2WTL A;  3OGH A;  3F34 A;  2X17 0;  1S30 A;  3FVB A;  1BCF A;  5JKM G;  4R42 A;  5GN8 B;  2BW1 A;  4EVC A;  1J30 A;  2WLU A;  1UVH A;  3AJO A;  3O7S A;  1NNQ A;  1VLG A;  5IX6 A;  3RD0 A;  2ZG8 X;  2V2L A;  3GHQ A;  3FSE A;  2Y3Q A;  2XGW A;  3PZA A;  4LYX A;  2C41 A;  5HQO A;  4MUD A;  2V2N A;  3SHX A;  3AJQ A;  5C6F A;  1QGH A;  3R2H A;  5JKL G;  1O9I A;  3Q4R A;  3WVV A;  4DYU A;  3ISF A;  2FFX J;  2RBD A;  4U3G A;  2G4H A;  4PGK A;  1NF4 A;  5GU1 X;  2Z5P A;  4TOH A;  2VXI A;  4ETR A;  4CMY A;  1RYT A;  4LQJ A;  3ERZ A;  1JYB A;  2CLU A;  4EVE A;  1RCG A;  3PVR A;  2YW7 A;  1VEI A;  2V2R A;  2V2P A;  3BVL A;  5I4J A;  4TOC A;  4ZTT A;  3R2S A;  2XJO A;  3BVI A;  3PW8 A;  3Q4Q A;  1MOJ A;  4CY9 A;  3R2L A;  4IXK A;  3GVY A;  3AF7 X;  5LG2 A;  5FFE A;  4RC7 A;  4A25 A;  1LKM A;  4EVB A;  1RCD A;  4DYY A;  3A9Q A;  4ZKX A;  3QZ3 A;  4II4 B;  2ITB A;  1NFV A;  3KXU A;  5J93 A;  4DZ0 A;  2CIH A;  2UX1 A;  4EVD A;  5AXS A;  3U90 A;  3R2K A;  4DYZ A;  4TOA A;  2CHI A;  4TW3 A;  5CMR A;  3FI6 A;  4AM2 A;  2ZG9 X;  3NP0 X;  4LPJ A;  1TKO A;  5D8X A;  2C2J A;  1Z6O M;  4QUW A;  1R03 A;  4LPN A;  4M33 A;  4ITW A;  5JKM A;  5FFD A;  1VJX A;  4TOG A;  1Z6O A;  1JI5 A;  2D5K A;  3SID A;  3RGD A;  1SQ3 A;  3SE1 A;  1JKV A;  4DAS A;  1HRS A;  1F30 A;  5JAC A;  2QF9 A;  4Z5S A;  5GU0 X;  1YUZ A;  4Z3B A;  3R2O A;  4ZJK A;  4KVQ A;  4M35 A;  1JTS A;  3E1L A;  3MPS A;  1TK6 A;  1GWG A;  2Z90 A;  3PVY A;  5LBH A;  3E6R A;  5JKL A;  2FG4 A;  3F32 A;  3QHC A;  4YKH A;  4AM5 A;  3E1O A;  2C6R A;  5FFC A;  4RC6 A;  3AK9 A;  3HIU A;  3BVF A;  1BFR A;  2VXX A;  3T9J A;  2CEI A;  2C2U A;  4XKT A;  4TOF A;  5J8W A;  5ERK A;  1L8H A;  3PW8 C;  4MN9 A;  2HTN A;  5E1U A;  3WVU A;  2IB0 A;  3QVD A;  3F35 A;  4REU A;  4CVS A;  5FEJ A;  3UNO A;  4ZLW A;  4LQV A;  1SOF A;  2CLB A;  2V15 A;  1BG7 A;  2V2O A;  3BVE A;  2BJY A;  3VNX A;  5LG8 A;  5ERJ A;  1QYB A;  1OTK A;  4CVP A;  5CMQ A;  3BKN A;  2CN7 A;  2FG8 A;  3PVT B;  2CN6 A;  1YUX A;  3KA9 A;  3ES3 A;  4PGI A;  2YW6 A;  3KX9 A;  3QHB A;  2ZA8 A;  4DYX A;  5D8Q A;  2XJN A;  4OYN A;  2Z5R A;  3PW1 B;  3UOF A;  4TOD A;  3RBC A;  2QQY A;  4LQN A;  3PVR B;  2CHP A;  3KA3 A;  1RCC A;  4Y08 A;  3E1N A;  2JD7 0;  2V2M A;  3QD8 A;  4RC5 A;  1EUM A;  1JI4 A;  4LPM A;  4M32 A;  3E1M A;  3E1Q A;  1ZS3 A;  5FFB A;  4ISP A;  1KRQ A;  2BK6 A;  1NF6 A;  3RAV A;  5J9V A;  3F33 A;  4E6K A;  1XZ1 A;  5D8P A;  4KVR A;  4M34 A;  2FJC A;  4RC7 B;  4ZKW A;  4TO9 A;  1ZUJ A;  2W0O A;  3OJ5 A;  1O9R A;  1LKO A;  3E1J A;  2F7N A;  2Z6M A;  5D8Y A;  4LQH A;  3GE4 A;  5GU2 X;  4ZMC A;  1Z4A A;  2FZF A;  2YJJ A;  5GN8 A;  1VEQ A;  4ZL6 A;  4TOE A;  3KA8 A;  5CZU A;  3KWO A;  3IS7 A;  5E2D A;  3IS8 A;  3F37 A;  3NP2 X;  4IWJ A;  4CYA A;  4TOB A;  3UOI A;  3EGM A;  3PWQ A;  2FKZ A;  1DAT A;  4XKU A;  4ML5 A;  5J8S A;  5K53 A;  3KA6 A;  3F39 A;  1YV1 A;  1S2Z A;  2JD6 0;  2XJM A;  2XKQ A;  4CMY V;  3BT5 A;  3NOZ X;  2ZA7 A;  3Q4N A;  1JRE A;  5GU3 X;  2HR5 A;  1DVB A;  3EZU A;  5FFA A;  1VEL A;  1S3Q A;  2CF7 A;  2PYB A;  3PVY B;  2FL0 A;  1AEW A;  4CYB A;  3PVT A;  2IY4 A;  2ZG7 X;  4RC6 B;  3BVK A;  1JGC A;  1RCE A;  2WLA A;  3WVW A;  4RC8 A;  3R2R A;  3F36 A;  2OC5 A;  4AM4 A;  3EZ0 A;  4DE6 A;  3AJP A;  3PW1 A;  1L8I A;  3HL1 A;  3H7G A;  1JKU A;  4II4 A;  3E6S A;  5HJF A;  5K52 A;  2Z5Q A;  1H96 A;  2GS4 A;  3Q4O A;  3AK8 A;  4PG0 A;  1FHA A;  2VZB A;  1LKP A;  2GYQ A;  1MFR A;  1TJO A;  1UMN A;  2IU2 A;  4MJY A;  3TA8 A;  3RE7 A;  1B71 A;  3O7R A;  3PWF A;  1IER A;  4ISM A;  4ITT A;  2V2S A;  4ZKH A;  4KVS A;  4CVR A;  3F38 A;  3AF8 X;  5D8R A;  3IQ1 A;  4MKU A;  4XGS A;  5LS9 A;  2GYD A;  4PG1 A;  4DI0 A;  2ZA6 A;  3SH6 A;  2C2F A;  3PWQ C;  3A68 A;  1LB3 A;  4P18 A;  5HJH A;  2V2J A;  5D8S A;  3ISE A;  2BKC A;  1N1Q A;  5GOU A;  4CVT A;  4RC5 B;  3WNW A;  4ERU A;  4ZL5 A;  1XZ3 A;  2ZUR X;  3AF9 X;  4IWK A;  3E1P A;  4LYU A;  2OH3 A;  5D8O A;  4MY7 A; 
#chains in the Genus database with same CATH topology
 2YJK A;  1RCI A;  2JD8 0;  2V2I A;  2FHA A;  3QB9 A;  1JIG A;  1TKP A;  4XKS A;  3KA4 A;  1F33 A;  1DPS A;  3E2C A;  1IES A;  3R2M A;  2WTL A;  3OGH A;  3F34 A;  2X17 0;  1S30 A;  3FVB A;  1BCF A;  5JKM G;  4R42 A;  5GN8 B;  2BW1 A;  4EVC A;  4W4L B;  1J30 A;  2WLU A;  1UVH A;  3AJO A;  3O7S A;  1NNQ A;  1VLG A;  3LKD A;  5IX6 A;  3RD0 A;  2ZG8 X;  2V2L A;  3GHQ A;  3FSE A;  2Y3Q A;  3N6O A;  2XGW A;  3PZA A;  4LYX A;  2C41 A;  5HQO A;  4MUD A;  2V2N A;  3SHX A;  3AJQ A;  5C6F A;  1QGH A;  3JZ9 A;  3R2H A;  5JKL G;  1O9I A;  3Q4R A;  3WVV A;  4DYU A;  3ISF A;  2FFX J;  2RBD A;  4U3G A;  2G4H A;  4PGK A;  1NF4 A;  5GU1 X;  2Z5P A;  4TOH A;  2VXI A;  4ETR A;  4CMY A;  1RYT A;  4LQJ A;  2MGY A;  3UFB A;  3ERZ A;  1JYB A;  3C1Z A;  4X0J A;  2CLU A;  4EVE A;  1RCG A;  3PVR A;  2YW7 A;  1VEI A;  2V2R A;  2V2P A;  3BVL A;  5I4J A;  4TOC A;  4ZTT A;  3R2S A;  2XJO A;  3BVI A;  3PW8 A;  3Q4Q A;  1MOJ A;  3VV9 A;  4CY9 A;  3R2L A;  4IXK A;  3GVY A;  3AF7 X;  5LG2 A;  5FFE A;  4RC7 A;  4A25 A;  3GGZ A;  1LKM A;  4EVB A;  1RCD A;  4DYY A;  3A9Q A;  4ZKX A;  3QZ3 A;  4II4 B;  2ITB A;  1NFV A;  3KXU A;  5J93 A;  4DZ0 A;  2CIH A;  2UX1 A;  4EVD A;  5AXS A;  4WJG 4;  3U90 A;  3R2K A;  4DYZ A;  4TOA A;  2CHI A;  4TW3 A;  3W54 A;  5CMR A;  3FI6 A;  4AM2 A;  2ZG9 X;  5JDO B;  3NP0 X;  4LPJ A;  1TKO A;  5D8X A;  2C2J A;  1Z6O M;  4QUW A;  1R03 A;  4LPN A;  4M33 A;  2G38 B;  4ITW A;  5JKM A;  5FFD A;  1VJX A;  4TOG A;  1Z6O A;  4E40 A;  1JI5 A;  2D5K A;  4MY7 A;  3SID A;  3RGD A;  3KDQ A;  1SQ3 A;  3SE1 A;  1JKV A;  4DAS A;  1HRS A;  1F30 A;  5JAC A;  2QF9 A;  4Z5S A;  5GU0 X;  1YUZ A;  4Z3B A;  3R2O A;  4ZJK A;  4KVQ A;  4M35 A;  1JTS A;  3E1L A;  3MPS A;  1TK6 A;  1GWG A;  3DBY A;  2Z90 A;  3PVY A;  5LBH A;  3E6R A;  5JKL A;  2FG4 A;  3F32 A;  3QHC A;  4YKH A;  4AM5 A;  3E1O A;  2C6R A;  5FFC A;  4RC6 A;  3AK9 A;  3HIU A;  3BVF A;  1BFR A;  4KXR B;  2VXX A;  3T9J A;  2CEI A;  2C2U A;  4XKT A;  4TOF A;  5J8W A;  5ERK A;  1L8H A;  3PW8 C;  2V8T A;  4MN9 A;  2HTN A;  5E1U A;  3WVU A;  2IB0 A;  3QVD A;  3D19 A;  3F35 A;  4REU A;  4CVS A;  3FRR A;  5FEJ A;  3UNO A;  4ZLW A;  4LQV A;  1SOF A;  2CLB A;  2V15 A;  1BG7 A;  2V2O A;  3BVE A;  2BJY A;  3FRS A;  3VNX A;  5LG8 A;  5ERJ A;  1QYB A;  1OTK A;  4CVP A;  5CMQ A;  3BKN A;  2CN7 A;  2FG8 A;  3PVT B;  3VVA A;  2CN6 A;  1YUX A;  3KA9 A;  3ES3 A;  4PGI A;  2YW6 A;  3KX9 A;  3QHB A;  2ZA8 A;  4DYX A;  4MXP A;  5D8Q A;  2XJN A;  4OYN A;  2Z5R A;  3PW1 B;  3UOF A;  4TOD A;  3RBC A;  2QQY A;  3M6J A;  3V3K B;  4LQN A;  3PVR B;  2CHP A;  3KA3 A;  1RCC A;  4Y08 A;  3E1N A;  2JD7 0;  2V2M A;  3QD8 A;  4RC5 A;  1EUM A;  1JI4 A;  4LPM A;  4M32 A;  3E1M A;  3E1Q A;  1ZS3 A;  5FFB A;  4ISP A;  1KRQ A;  2BK6 A;  1NF6 A;  3RAV A;  5J9V A;  3F33 A;  4E6K A;  1XZ1 A;  5D8P A;  4KVR A;  4M34 A;  2Y44 A;  2FJC A;  4RC7 B;  4ZKW A;  4TO9 A;  1ZUJ A;  2W0O A;  3OJ5 A;  1O9R A;  1LKO A;  3E1J A;  2F7N A;  2Z6M A;  5D8Y A;  4LQH A;  3GE4 A;  4YVZ A;  5GU2 X;  2AR0 A;  4ZMC A;  1Z4A A;  2FZF A;  2YJJ A;  5GN8 A;  1VEQ A;  4ZL6 A;  4TOE A;  3KA8 A;  5CZU A;  3KWO A;  3IS7 A;  5E2D A;  3IS8 A;  3JZA B;  3F37 A;  3NP2 X;  4IWJ A;  4CYA A;  4TOB A;  3UOI A;  3C21 A;  3EGM A;  3PWQ A;  2FKZ A;  1DAT A;  4XKU A;  4ML5 A;  5J8S A;  5K53 A;  3KA6 A;  3F39 A;  1YV1 A;  1S2Z A;  4YXM A;  2JD6 0;  2XJM A;  2XKQ A;  4CMY V;  3BT5 A;  3NOZ X;  2ZA7 A;  3Q4N A;  1JRE A;  3L0M A;  2N02 A;  5GU3 X;  5HU6 D;  2HR5 A;  1DVB A;  3EZU A;  5FFA A;  1VEL A;  1S3Q A;  2OKC A;  2CF7 A;  2PYB A;  3GGY A;  3KHK A;  2FL0 A;  3PVY B;  1AEW A;  4CYB A;  3PVT A;  2IY4 A;  2ZG7 X;  4RC6 B;  3BVK A;  2WWX B;  1JGC A;  1RCE A;  2WLA A;  3WVW A;  4RC8 A;  3R2R A;  3F36 A;  4W4K B;  2OC5 A;  3C23 A;  4AM4 A;  3EZ0 A;  4DE6 A;  3AJP A;  3PW1 A;  1L8I A;  3HL1 A;  3H7G A;  1JKU A;  4II4 A;  3E6S A;  5HJF A;  5K52 A;  2Z5Q A;  2GS4 A;  3Q4O A;  3AK8 A;  4PG0 A;  1FHA A;  2VZB A;  1LKP A;  2GYQ A;  1MFR A;  1TJO A;  1UMN A;  2IU2 A;  4MJY A;  3TA8 A;  3RE7 A;  5JDO A;  1B71 A;  3O7R A;  2V8U A;  3PWF A;  1IER A;  4ISM A;  4ITT A;  2V2S A;  4ZKH A;  4KVS A;  4CVR A;  3F38 A;  4YXJ A;  2CWL A;  3AF8 X;  5D8R A;  3IQ1 A;  4MKU A;  4XGS A;  5LS9 A;  2GYD A;  4PG1 A;  4DI0 A;  2ZA6 A;  3SH6 A;  2C2F A;  3PWQ C;  3A68 A;  1LB3 A;  4P18 A;  5HJH A;  3C1Y A;  2V2J A;  5D8S A;  3ISE A;  2BKC A;  1N1Q A;  5GOU A;  4CVT A;  4RC5 B;  3WNW A;  4ERU A;  4ZL5 A;  1XZ3 A;  2ZUR X;  3AF9 X;  4IWK A;  3E1P A;  4LYU A;  2OH3 A;  5D8O A;  1H96 A; 
#chains in the Genus database with same CATH homology
 2YJK A;  1RCI A;  2JD8 0;  2V2I A;  2FHA A;  3QB9 A;  1JIG A;  1TKP A;  4XKS A;  3KA4 A;  1F33 A;  1DPS A;  3E2C A;  1IES A;  3R2M A;  2WTL A;  3OGH A;  3F34 A;  2X17 0;  1S30 A;  3FVB A;  1BCF A;  5JKM G;  4R42 A;  5GN8 B;  2BW1 A;  4EVC A;  4W4L B;  1J30 A;  2WLU A;  1UVH A;  3AJO A;  3O7S A;  1NNQ A;  1VLG A;  3LKD A;  5IX6 A;  3RD0 A;  2ZG8 X;  2V2L A;  3GHQ A;  3FSE A;  2Y3Q A;  3N6O A;  2XGW A;  3PZA A;  4LYX A;  2C41 A;  5HQO A;  4MUD A;  2V2N A;  3SHX A;  3AJQ A;  5C6F A;  1QGH A;  3JZ9 A;  3R2H A;  5JKL G;  1O9I A;  3Q4R A;  3WVV A;  4DYU A;  3ISF A;  2FFX J;  2RBD A;  4U3G A;  2G4H A;  4PGK A;  1NF4 A;  5GU1 X;  2Z5P A;  4TOH A;  2VXI A;  4ETR A;  4CMY A;  1RYT A;  4LQJ A;  2MGY A;  3UFB A;  3ERZ A;  1JYB A;  3C1Z A;  4X0J A;  2CLU A;  4EVE A;  1RCG A;  3PVR A;  2YW7 A;  1VEI A;  2V2R A;  2V2P A;  3BVL A;  5I4J A;  4TOC A;  4ZTT A;  3R2S A;  2XJO A;  3BVI A;  3PW8 A;  3Q4Q A;  1MOJ A;  3VV9 A;  4CY9 A;  3R2L A;  4IXK A;  3GVY A;  3AF7 X;  5LG2 A;  5FFE A;  4RC7 A;  4A25 A;  3GGZ A;  1LKM A;  4EVB A;  1RCD A;  4DYY A;  3A9Q A;  4ZKX A;  3QZ3 A;  4II4 B;  2ITB A;  1NFV A;  3KXU A;  5J93 A;  4DZ0 A;  2CIH A;  2UX1 A;  4EVD A;  5AXS A;  4WJG 4;  3U90 A;  3R2K A;  4DYZ A;  4TOA A;  2CHI A;  4TW3 A;  3W54 A;  5CMR A;  3FI6 A;  4AM2 A;  2ZG9 X;  5JDO B;  3NP0 X;  4LPJ A;  1TKO A;  5D8X A;  2C2J A;  1Z6O M;  4QUW A;  1R03 A;  4LPN A;  4M33 A;  2G38 B;  4ITW A;  5JKM A;  5FFD A;  1VJX A;  4TOG A;  1Z6O A;  4E40 A;  1JI5 A;  2D5K A;  4MY7 A;  3SID A;  3RGD A;  3KDQ A;  1SQ3 A;  3SE1 A;  1JKV A;  4DAS A;  1HRS A;  1F30 A;  5JAC A;  2QF9 A;  4Z5S A;  5GU0 X;  1YUZ A;  4Z3B A;  3R2O A;  4ZJK A;  4KVQ A;  4M35 A;  1JTS A;  3E1L A;  3MPS A;  1TK6 A;  1GWG A;  3DBY A;  2Z90 A;  3PVY A;  5LBH A;  3E6R A;  5JKL A;  2FG4 A;  3F32 A;  3QHC A;  4YKH A;  4AM5 A;  3E1O A;  2C6R A;  5FFC A;  4RC6 A;  3AK9 A;  3HIU A;  3BVF A;  1BFR A;  4KXR B;  2VXX A;  3T9J A;  2CEI A;  2C2U A;  4XKT A;  4TOF A;  5J8W A;  5ERK A;  1L8H A;  3PW8 C;  2V8T A;  4MN9 A;  2HTN A;  5E1U A;  3WVU A;  2IB0 A;  3QVD A;  3D19 A;  3F35 A;  4REU A;  4CVS A;  3FRR A;  5FEJ A;  3UNO A;  4ZLW A;  4LQV A;  1SOF A;  2CLB A;  2V15 A;  1BG7 A;  2V2O A;  3BVE A;  2BJY A;  3FRS A;  3VNX A;  5LG8 A;  5ERJ A;  1QYB A;  1OTK A;  4CVP A;  5CMQ A;  3BKN A;  2CN7 A;  2FG8 A;  3PVT B;  3VVA A;  2CN6 A;  1YUX A;  3KA9 A;  3ES3 A;  4PGI A;  2YW6 A;  3KX9 A;  3QHB A;  2ZA8 A;  4DYX A;  4MXP A;  5D8Q A;  2XJN A;  4OYN A;  2Z5R A;  3PW1 B;  3UOF A;  4TOD A;  3RBC A;  2QQY A;  3M6J A;  3V3K B;  4LQN A;  3PVR B;  2CHP A;  3KA3 A;  1RCC A;  4Y08 A;  3E1N A;  2JD7 0;  2V2M A;  3QD8 A;  4RC5 A;  1EUM A;  1JI4 A;  4LPM A;  4M32 A;  3E1M A;  3E1Q A;  1ZS3 A;  5FFB A;  4ISP A;  1KRQ A;  2BK6 A;  1NF6 A;  3RAV A;  5J9V A;  3F33 A;  4E6K A;  1XZ1 A;  5D8P A;  4KVR A;  4M34 A;  2Y44 A;  2FJC A;  4RC7 B;  4ZKW A;  4TO9 A;  1ZUJ A;  2W0O A;  3OJ5 A;  1O9R A;  1LKO A;  3E1J A;  2F7N A;  2Z6M A;  5D8Y A;  4LQH A;  3GE4 A;  4YVZ A;  5GU2 X;  2AR0 A;  4ZMC A;  1Z4A A;  2FZF A;  2YJJ A;  5GN8 A;  1VEQ A;  4ZL6 A;  4TOE A;  3KA8 A;  5CZU A;  3KWO A;  3IS7 A;  5E2D A;  3IS8 A;  3JZA B;  3F37 A;  3NP2 X;  4IWJ A;  4CYA A;  4TOB A;  3UOI A;  3C21 A;  3EGM A;  3PWQ A;  2FKZ A;  1DAT A;  4XKU A;  4ML5 A;  5J8S A;  5K53 A;  3KA6 A;  3F39 A;  1YV1 A;  1S2Z A;  4YXM A;  2JD6 0;  2XJM A;  2XKQ A;  4CMY V;  3BT5 A;  3NOZ X;  2ZA7 A;  3Q4N A;  1JRE A;  3L0M A;  2N02 A;  5GU3 X;  5HU6 D;  2HR5 A;  1DVB A;  3EZU A;  5FFA A;  1VEL A;  1S3Q A;  2OKC A;  2CF7 A;  2PYB A;  3GGY A;  3KHK A;  2FL0 A;  3PVY B;  1AEW A;  4CYB A;  3PVT A;  2IY4 A;  2ZG7 X;  4RC6 B;  3BVK A;  2WWX B;  1JGC A;  1RCE A;  2WLA A;  3WVW A;  4RC8 A;  3R2R A;  3F36 A;  4W4K B;  2OC5 A;  3C23 A;  4AM4 A;  3EZ0 A;  4DE6 A;  3AJP A;  3PW1 A;  1L8I A;  3HL1 A;  3H7G A;  1JKU A;  4II4 A;  3E6S A;  5HJF A;  5K52 A;  2Z5Q A;  2GS4 A;  3Q4O A;  3AK8 A;  4PG0 A;  1FHA A;  2VZB A;  1LKP A;  2GYQ A;  1MFR A;  1TJO A;  1UMN A;  2IU2 A;  4MJY A;  3TA8 A;  3RE7 A;  5JDO A;  1B71 A;  3O7R A;  2V8U A;  3PWF A;  1IER A;  4ISM A;  4ITT A;  2V2S A;  4ZKH A;  4KVS A;  4CVR A;  3F38 A;  4YXJ A;  2CWL A;  3AF8 X;  5D8R A;  3IQ1 A;  4MKU A;  4XGS A;  5LS9 A;  2GYD A;  4PG1 A;  4DI0 A;  2ZA6 A;  3SH6 A;  2C2F A;  3PWQ C;  3A68 A;  1LB3 A;  4P18 A;  5HJH A;  3C1Y A;  2V2J A;  5D8S A;  3ISE A;  2BKC A;  1N1Q A;  5GOU A;  4CVT A;  4RC5 B;  3WNW A;  4ERU A;  4ZL5 A;  1XZ3 A;  2ZUR X;  3AF9 X;  4IWK A;  3E1P A;  4LYU A;  2OH3 A;  5D8O A;  1H96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...