3E6RA

Crystal structure of apo-ferritin from pseudo-nitzschia multiseries
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
159
structure length
159
Chain Sequence
SEELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSCAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVVSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin
publication title Ferritin is used for iron storage in bloom-forming marine pennate diatoms.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
total genus 69
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e6rA00
1F30A 3IQ1A 3R2OA 4RC5A 4ZTTA 5FFAA 4CMYA 2HTNA 4EVEA 3VNXA 5E1UA 3AF7X 5AXSA 4DYZA 3E1OA 3R2HA 2OC5A 2Z5RA 1AEWA 3KWOA 3GVYA 4RC8A 3KA3A 5GU1X 5J8SA 3SHXA 1ZS3A 1DVBA 1OTKA 2FFXJ 2HR5A 4PG0A 2WLUA 1L8IA 5D8YA 2YJKA 3NP2X 3Q4RA 3QD8A 1Z4AA 2OH3A 2ZA7A 5D8SA 2C2JA 1TKPA 4DYXA 3E6SA 3IS8A 3RAVA 1TJOA 1YV1A 2WLAA 2YJJA 4XKTA 3ISEA 3BVFA 3KX9A 3NOZX 3QHCA 3KA6A 2C6RA 4DI0A 5D8QA 3ERZA 3SE1A 1O9IA 4LPMA 3QVDA 2IU2A 5E2DA 4XGSA 4MN9A 4TO9A 2XKQA 3O7SA 1NF4A 2D5KA 4ZKHA 5GOUA 3BVEA 1SQ3A 4TOAA 1LKMA 1RCIA 5GU2X 3BVLA 1IESA 1UMNA 3E1NA 1H96A 3KA4A 3E1QA 2PYBA 1JKUA 1L8HA 2V2IA 3GHQA 5JKMA 2V2RA 5J93A 5LS9A 3BVIA 4TOHA 2GS4A 1DPSA 2FG8A 2YW7A 1JREA 4DYYA 3EZUA 4XKUA 5FFBA 1UVHA 3ES3A 4TOFA 3RBCA 2CEIA 1JI4A 4CVTA 2Z5QA 4U3GA 1TK6A 4TOGA 5JACA 2ITBA 4ETRA 1S2ZA 3UNOA 4ITWA 4ZL5A 4LQVA 5FFDA 4RC6B 1RCGA 5IX6A 2FL0A 5I4JA 3PZAA 1NNQA 4OYNA 4M35A 4ITTA 1BFRA 5LG2A 5D8RA 5LG8A 2ZG8X 3OGHA 2V15A 3WVWA 1GWGA 4EVBA 1BG7A 5FFCA 1JI5A 3FI6A 3KXUA 3F38A 3BT5A 4LPNA 1RCDA 2IB0A 4MKUA 5CMRA 4A25A 2Z5PA 4ZMCA 3BVKA 2BKCA 4CVSA 5J9VA 1RYTA 3Q4NA 1VELA 4AM4A 4Y08A 3WNWA 4ZL6A 2BK6A 1NFVA 1TKOA 4CMYV 3Q4QA 3MPSA 3AF9X 3PVTB 1QYBA 4RC6A 5GN8B 2CLUA 3F35A 1LB3A 4PG1A 2QF9A 3E1MA 2ZA6A 3AJQA 5HJFA 2WTLA 3AF8X 4LQHA 4MY7A 1FHAA 2FZFA 5JKMG 3E1LA 2CN7A 4AM2A 3PW8A 3RD0A 4R42A 4Z3BA 3E1JA 2VXXA 4KVSA 2CN6A 2ZG9X 3OJ5A 3WVVA 2V2JA 3E6RA 3QZ3A 1B71A 1JGCA 1NF6A 5JKLG 3IS7A 3AJPA 1JIGA 3PVTA 5GN8A 1VEQA 4CY9A 4DZ0A 3R2RA 5C6FA 4LQNA 1LKOA 4QUWA 1YUZA 4YKHA 1JTSA 3SH6A 1DATA 1F33A 4IWJA 5K53A 2C2UA 2GYQA 3PWQA 1RCCA 4KVQA 2ZA8A 5GU3X 4TOCA 1VEIA 4LYUA 4MJYA 1VLGA 4CYBA 2RBDA 4TOBA 3NP0X 2C41A 3FVBA 2V2OA 3UOIA 4ZLWA 2CIHA 2GYDA 4ZKXA 5LBHA 1VJXA 4EVDA 3EZ0A 5K52A 3FSEA 5J8WA 2V2PA 4IXKA 4E6KA 4DE6A 3PVRB 4P18A 1JYBA 3AK8A 2V2MA 1Z6OA 3UOFA 3H7GA 4DASA 1HRSA 3R2LA 2UX1A 4II4B 4PGIA 3Q4OA 4REUA 3GE4A 4ZKWA 4LYXA 1S30A 1O9RA 2YW6A 2XGWA 3HL1A 5CZUA 4EVCA 4KVRA 4AM5A 2XJOA 3E1PA 1MFRA 3AJOA 4ZJKA 5GU0X 5HJHA 3HIUA 3PVRA 3R2KA 3U90A 4LQJA 3RE7A 4ISPA 1S3QA 3RGDA 2CHIA 3PW1B 4ISMA 3PWFA 4TODA 3BKNA 4II4A 4PGKA 4M33A 2Y3QA 2IY4A 2BJYA 5D8OA 4Z5SA 4M32A 2FJCA 5D8XA 2Z6MA 1LKPA 2X170 1QGHA 3KA9A 4DYUA 3KA8A 5D8PA 4IWKA 2FHAA 4RC7B 3PW8C 3O7RA 4MUDA 3E2CA 4ML5A 1XZ3A 2ZURX 2BW1A 2QQYA 4LPJA 3F36A 4CVPA 1J30A 2G4HA 3F34A 5ERKA 3PW1A 2F7NA 1XZ1A 1SOFA 3EGMA 1YUXA 2VZBA 1N1QA 1MOJA 3F33A 1KRQA 4XKSA 3PVYB 3F32A 1R03A 2FKZA 2Z90A 4ERUA 3PWQC 5ERJA 2C2FA 4RC7A 1EUMA 3QHBA 3QB9A 4M34A 3ISFA 3F37A 1IERA 2ZG7X 3AK9A 2V2NA 2FG4A 3A9QA 2JD80 2CF7A 1RCEA 2W0OA 2V2SA 3R2SA 4RC5B 4CVRA 2VXIA 2XJMA 1JKVA 2CHPA 1ZUJA 1BCFA 3WVUA 5JKLA 4CYAA 3A68A 2JD60 5FEJA 5HQOA 3PVYA 5FFEA 3T9JA 2JD70 3R2MA 3TA8A 2CLBA 3SIDA 3F39A 2XJNA 5CMQA 4TW3A 4TOEA 2V2LA 1Z6OM
chains in the Genus database with same CATH superfamily
1F30A 3IQ1A 3R2OA 4RC5A 4ZTTA 5FFAA 3C21A 4CMYA 2HTNA 4EVEA 3VNXA 5E1UA 3AF7X 5AXSA 4DYZA 3E1OA 3R2HA 2OC5A 2Z5RA 1AEWA 3W54A 3KWOA 3GVYA 4RC8A 3KA3A 5GU1X 5J8SA 3SHXA 1ZS3A 1DVBA 1OTKA 2FFXJ 2HR5A 4PG0A 2WLUA 3C1ZA 1L8IA 3L0MA 5D8YA 2YJKA 3NP2X 3DBYA 3Q4RA 3QD8A 1Z4AA 2OH3A 2ZA7A 5D8SA 2C2JA 1TKPA 4DYXA 2MGYA 3E6SA 3IS8A 3RAVA 1TJOA 1YV1A 2WLAA 2YJJA 4XKTA 3ISEA 3C1YA 3BVFA 3KX9A 3NOZX 3QHCA 4X0JA 3KA6A 2C6RA 4DI0A 5D8QA 3ERZA 3SE1A 2Y44A 3JZ9A 1O9IA 4LPMA 3QVDA 2IU2A 3C23A 5E2DA 4XGSA 4MN9A 4TO9A 2XKQA 3O7SA 1NF4A 2D5KA 4ZKHA 5GOUA 3BVEA 1SQ3A 4TOAA 1LKMA 1RCIA 5GU2X 4E40A 3BVLA 1IESA 1UMNA 3E1NA 1H96A 3KA4A 3E1QA 2PYBA 1JKUA 1L8HA 2V2IA 3GHQA 5JKMA 2V2RA 5J93A 5LS9A 3BVIA 4TOHA 2GS4A 1DPSA 2FG8A 2YW7A 1JREA 3D19A 4DYYA 3EZUA 4XKUA 5FFBA 1UVHA 3JZAB 3FRRA 3ES3A 4TOFA 3RBCA 2CEIA 1JI4A 4CVTA 2Z5QA 4U3GA 1TK6A 4TOGA 5JACA 2ITBA 4ETRA 1S2ZA 3UNOA 4ITWA 4ZL5A 4LQVA 5FFDA 4RC6B 1RCGA 5IX6A 2FL0A 5I4JA 3PZAA 1NNQA 4OYNA 4M35A 4ITTA 1BFRA 5LG2A 5D8RA 5LG8A 2ZG8X 3OGHA 2V15A 3WVWA 1GWGA 4EVBA 1BG7A 5FFCA 1JI5A 3FI6A 3KXUA 3F38A 2G38B 3BT5A 4LPNA 1RCDA 2IB0A 4MKUA 5CMRA 4A25A 2Z5PA 4ZMCA 3BVKA 2BKCA 4CVSA 5J9VA 1RYTA 3Q4NA 1VELA 4AM4A 4Y08A 3WNWA 4ZL6A 2BK6A 1NFVA 2N02A 1TKOA 4KXRB 4CMYV 3Q4QA 3MPSA 3AF9X 3PVTB 1QYBA 4RC6A 5GN8B 2CLUA 3F35A 1LB3A 4PG1A 2QF9A 3E1MA 2ZA6A 3AJQA 5HJFA 2WTLA 3AF8X 4LQHA 4MY7A 1FHAA 2FZFA 5JKMG 3E1LA 3GGZA 2CN7A 2CWLA 4AM2A 3PW8A 3RD0A 4WJG4 4R42A 4Z3BA 3E1JA 2VXXA 3GGYA 3VV9A 4KVSA 2CN6A 2ZG9X 3OJ5A 3WVVA 2V2JA 3E6RA 3QZ3A 3VVAA 1B71A 2V8UA 1JGCA 1NF6A 5JKLG 3IS7A 3AJPA 1JIGA 3PVTA 5GN8A 1VEQA 4CY9A 4YVZA 4DZ0A 3R2RA 5C6FA 3LKDA 4LQNA 1LKOA 4QUWA 1YUZA 4YKHA 1JTSA 3SH6A 1DATA 1F33A 4IWJA 5JDOB 5K53A 2C2UA 2GYQA 3PWQA 4YXJA 1RCCA 4KVQA 2ZA8A 5GU3X 3N6OA 2WWXB 4TOCA 1VEIA 4LYUA 4MJYA 1VLGA 4CYBA 2RBDA 4TOBA 3NP0X 2C41A 3FVBA 2V2OA 3UOIA 4ZLWA 2CIHA 2GYDA 3V3KB 4ZKXA 5LBHA 1VJXA 2AR0A 4EVDA 3EZ0A 5K52A 3FSEA 5JDOA 5J8WA 4MXPA 2V2PA 4IXKA 4E6KA 4DE6A 3PVRB 4P18A 1JYBA 3AK8A 2V2MA 1Z6OA 3UOFA 3H7GA 4DASA 1HRSA 3R2LA 2UX1A 4II4B 4PGIA 3Q4OA 4REUA 3GE4A 4ZKWA 4LYXA 1S30A 1O9RA 2YW6A 2XGWA 3HL1A 5CZUA 4EVCA 4KVRA 3KDQA 4AM5A 2XJOA 3E1PA 1MFRA 3AJOA 4ZJKA 5GU0X 5HJHA 3HIUA 3PVRA 3R2KA 3U90A 4LQJA 3RE7A 4ISPA 1S3QA 3RGDA 3KHKA 2CHIA 3FRSA 3PW1B 4ISMA 3PWFA 4TODA 3BKNA 4II4A 4PGKA 4M33A 2Y3QA 2OKCA 2IY4A 2BJYA 5D8OA 4Z5SA 4M32A 2FJCA 5D8XA 2Z6MA 1LKPA 2X170 1QGHA 3KA9A 4DYUA 3KA8A 5D8PA 4IWKA 2FHAA 4RC7B 3PW8C 3O7RA 4MUDA 3E2CA 4ML5A 1XZ3A 2ZURX 2BW1A 2QQYA 4LPJA 3F36A 4CVPA 1J30A 2G4HA 3F34A 5ERKA 3PW1A 2F7NA 1XZ1A 1SOFA 3EGMA 1YUXA 2VZBA 1N1QA 1MOJA 4W4LB 3F33A 1KRQA 4W4KB 4XKSA 3PVYB 3F32A 1R03A 2FKZA 2Z90A 4ERUA 3PWQC 5ERJA 2C2FA 4RC7A 1EUMA 3QHBA 3QB9A 4M34A 3ISFA 3F37A 1IERA 2ZG7X 3AK9A 2V2NA 2FG4A 3A9QA 2JD80 2CF7A 1RCEA 2W0OA 2V2SA 3R2SA 4RC5B 4CVRA 2VXIA 2XJMA 1JKVA 3M6JA 2CHPA 1ZUJA 1BCFA 3WVUA 3UFBA 5JKLA 4CYAA 3A68A 2JD60 5FEJA 5HQOA 3PVYA 5FFEA 3T9JA 2JD70 3R2MA 2V8TA 3TA8A 2CLBA 3SIDA 3F39A 2XJNA 5CMQA 4TW3A 4TOEA 2V2LA 4YXMA 1Z6OM 5HU6D
chains in the Genus database with same CATH topology
1F30A 3IQ1A 3R2OA 4RC5A 4ZTTA 5FFAA 3C21A 4CMYA 2HTNA 4EVEA 3VNXA 5E1UA 3AF7X 5AXSA 4DYZA 3E1OA 3R2HA 2OC5A 2Z5RA 1AEWA 3W54A 3KWOA 3GVYA 4RC8A 3KA3A 5GU1X 5J8SA 3SHXA 1ZS3A 1DVBA 1OTKA 2FFXJ 2HR5A 4PG0A 2WLUA 3C1ZA 1L8IA 3L0MA 5D8YA 2YJKA 3NP2X 3DBYA 3Q4RA 3QD8A 1Z4AA 2OH3A 2ZA7A 5D8SA 2C2JA 1TKPA 4DYXA 2MGYA 3E6SA 3IS8A 3RAVA 1TJOA 1YV1A 2WLAA 2YJJA 4XKTA 3ISEA 3C1YA 3BVFA 3KX9A 3NOZX 3QHCA 4X0JA 3KA6A 2C6RA 4DI0A 5D8QA 3ERZA 3SE1A 2Y44A 3JZ9A 1O9IA 4LPMA 3QVDA 2IU2A 3C23A 5E2DA 4XGSA 4MN9A 4TO9A 2XKQA 3O7SA 1NF4A 2D5KA 4ZKHA 5GOUA 3BVEA 1SQ3A 4TOAA 1LKMA 1RCIA 5GU2X 4E40A 3BVLA 1IESA 1UMNA 3E1NA 1H96A 3KA4A 3E1QA 2PYBA 1JKUA 1L8HA 2V2IA 3GHQA 5JKMA 2V2RA 5J93A 5LS9A 3BVIA 4TOHA 2GS4A 1DPSA 2FG8A 2YW7A 1JREA 3D19A 4DYYA 3EZUA 4XKUA 5FFBA 1UVHA 3JZAB 3FRRA 3ES3A 4TOFA 3RBCA 2CEIA 1JI4A 4CVTA 2Z5QA 4U3GA 1TK6A 4TOGA 5JACA 2ITBA 4ETRA 1S2ZA 3UNOA 4ITWA 4ZL5A 4LQVA 5FFDA 4RC6B 1RCGA 5IX6A 2FL0A 5I4JA 3PZAA 1NNQA 4OYNA 4M35A 4ITTA 1BFRA 5LG2A 5D8RA 5LG8A 2ZG8X 3OGHA 2V15A 3WVWA 1GWGA 4EVBA 1BG7A 5FFCA 1JI5A 3FI6A 3KXUA 3F38A 2G38B 3BT5A 4LPNA 1RCDA 2IB0A 4MKUA 5CMRA 4A25A 2Z5PA 4ZMCA 3BVKA 2BKCA 4CVSA 5J9VA 1RYTA 3Q4NA 1VELA 4AM4A 4Y08A 3WNWA 4ZL6A 2BK6A 1NFVA 2N02A 1TKOA 4KXRB 4CMYV 3Q4QA 3MPSA 3AF9X 3PVTB 1QYBA 4RC6A 5GN8B 2CLUA 3F35A 1LB3A 4PG1A 2QF9A 3E1MA 2ZA6A 3AJQA 5HJFA 2WTLA 3AF8X 4LQHA 4MY7A 1FHAA 2FZFA 5JKMG 3E1LA 3GGZA 2CN7A 2CWLA 4AM2A 3PW8A 3RD0A 4WJG4 4R42A 4Z3BA 3E1JA 2VXXA 3GGYA 3VV9A 4KVSA 2CN6A 2ZG9X 3OJ5A 3WVVA 2V2JA 3E6RA 3QZ3A 3VVAA 1B71A 2V8UA 1JGCA 1NF6A 5JKLG 3IS7A 3AJPA 1JIGA 3PVTA 5GN8A 1VEQA 4CY9A 4YVZA 4DZ0A 3R2RA 5C6FA 3LKDA 4LQNA 1LKOA 4QUWA 1YUZA 4YKHA 1JTSA 3SH6A 1DATA 1F33A 4IWJA 5JDOB 5K53A 2C2UA 2GYQA 3PWQA 4YXJA 1RCCA 4KVQA 2ZA8A 5GU3X 3N6OA 2WWXB 4TOCA 1VEIA 4LYUA 4MJYA 1VLGA 4CYBA 2RBDA 4TOBA 3NP0X 2C41A 3FVBA 2V2OA 3UOIA 4ZLWA 2CIHA 2GYDA 3V3KB 4ZKXA 5LBHA 1VJXA 2AR0A 4EVDA 3EZ0A 5K52A 3FSEA 5JDOA 5J8WA 4MXPA 2V2PA 4IXKA 4E6KA 4DE6A 3PVRB 4P18A 1JYBA 3AK8A 2V2MA 1Z6OA 3UOFA 3H7GA 4DASA 1HRSA 3R2LA 2UX1A 4II4B 4PGIA 3Q4OA 4REUA 3GE4A 4ZKWA 4LYXA 1S30A 1O9RA 2YW6A 2XGWA 3HL1A 5CZUA 4EVCA 4KVRA 3KDQA 4AM5A 2XJOA 3E1PA 1MFRA 3AJOA 4ZJKA 5GU0X 5HJHA 3HIUA 3PVRA 3R2KA 3U90A 4LQJA 3RE7A 4ISPA 1S3QA 3RGDA 3KHKA 2CHIA 3FRSA 3PW1B 4ISMA 3PWFA 4TODA 3BKNA 4II4A 4PGKA 4M33A 2Y3QA 2OKCA 2IY4A 2BJYA 5D8OA 4Z5SA 4M32A 2FJCA 5D8XA 2Z6MA 1LKPA 2X170 1QGHA 3KA9A 4DYUA 3KA8A 5D8PA 4IWKA 2FHAA 4RC7B 3PW8C 3O7RA 4MUDA 3E2CA 4ML5A 1XZ3A 2ZURX 2BW1A 2QQYA 4LPJA 3F36A 4CVPA 1J30A 2G4HA 3F34A 5ERKA 3PW1A 2F7NA 1XZ1A 1SOFA 3EGMA 1YUXA 2VZBA 1N1QA 1MOJA 4W4LB 3F33A 1KRQA 4W4KB 4XKSA 3PVYB 3F32A 1R03A 2FKZA 2Z90A 4ERUA 3PWQC 5ERJA 2C2FA 4RC7A 1EUMA 3QHBA 3QB9A 4M34A 3ISFA 3F37A 1IERA 2ZG7X 3AK9A 2V2NA 2FG4A 3A9QA 2JD80 2CF7A 1RCEA 2W0OA 2V2SA 3R2SA 4RC5B 4CVRA 2VXIA 2XJMA 1JKVA 3M6JA 2CHPA 1ZUJA 1BCFA 3WVUA 3UFBA 5JKLA 4CYAA 3A68A 2JD60 5FEJA 5HQOA 3PVYA 5FFEA 3T9JA 2JD70 3R2MA 2V8TA 3TA8A 2CLBA 3SIDA 3F39A 2XJNA 5CMQA 4TW3A 4TOEA 2V2LA 4YXMA 1Z6OM 5HU6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F30 A;  3IQ1 A;  3R2O A;  4RC5 A;  4ZTT A;  5FFA A;  4CMY A;  2HTN A;  4EVE A;  3VNX A;  5E1U A;  3AF7 X;  5AXS A;  4DYZ A;  3E1O A;  3R2H A;  2OC5 A;  2Z5R A;  1AEW A;  3KWO A;  3GVY A;  4RC8 A;  3KA3 A;  5GU1 X;  5J8S A;  3SHX A;  1ZS3 A;  1DVB A;  1OTK A;  2FFX J;  2HR5 A;  4PG0 A;  2WLU A;  1L8I A;  5D8Y A;  2YJK A;  3NP2 X;  3Q4R A;  3QD8 A;  1Z4A A;  2OH3 A;  2ZA7 A;  5D8S A;  2C2J A;  1TKP A;  4DYX A;  3E6S A;  3IS8 A;  3RAV A;  1TJO A;  1YV1 A;  2WLA A;  2YJJ A;  4XKT A;  3ISE A;  3BVF A;  3KX9 A;  3NOZ X;  3QHC A;  3KA6 A;  2C6R A;  4DI0 A;  5D8Q A;  3ERZ A;  3SE1 A;  1O9I A;  4LPM A;  3QVD A;  2IU2 A;  5E2D A;  4XGS A;  4MN9 A;  4TO9 A;  2XKQ A;  3O7S A;  1NF4 A;  2D5K A;  4ZKH A;  5GOU A;  3BVE A;  1SQ3 A;  4TOA A;  1LKM A;  1RCI A;  5GU2 X;  3BVL A;  1IES A;  1UMN A;  3E1N A;  1H96 A;  3KA4 A;  3E1Q A;  2PYB A;  1JKU A;  1L8H A;  2V2I A;  3GHQ A;  5JKM A;  2V2R A;  5J93 A;  5LS9 A;  3BVI A;  4TOH A;  2GS4 A;  1DPS A;  2FG8 A;  2YW7 A;  1JRE A;  4DYY A;  3EZU A;  4XKU A;  5FFB A;  1UVH A;  3ES3 A;  4TOF A;  3RBC A;  2CEI A;  1JI4 A;  4CVT A;  2Z5Q A;  4U3G A;  1TK6 A;  4TOG A;  5JAC A;  2ITB A;  4ETR A;  1S2Z A;  3UNO A;  4ITW A;  4ZL5 A;  4LQV A;  5FFD A;  4RC6 B;  1RCG A;  5IX6 A;  2FL0 A;  5I4J A;  3PZA A;  1NNQ A;  4OYN A;  4M35 A;  4ITT A;  1BFR A;  5LG2 A;  5D8R A;  5LG8 A;  2ZG8 X;  3OGH A;  2V15 A;  3WVW A;  1GWG A;  4EVB A;  1BG7 A;  5FFC A;  1JI5 A;  3FI6 A;  3KXU A;  3F38 A;  3BT5 A;  4LPN A;  1RCD A;  2IB0 A;  4MKU A;  5CMR A;  4A25 A;  2Z5P A;  4ZMC A;  3BVK A;  2BKC A;  4CVS A;  5J9V A;  1RYT A;  3Q4N A;  1VEL A;  4AM4 A;  4Y08 A;  3WNW A;  4ZL6 A;  2BK6 A;  1NFV A;  1TKO A;  4CMY V;  3Q4Q A;  3MPS A;  3AF9 X;  3PVT B;  1QYB A;  4RC6 A;  5GN8 B;  2CLU A;  3F35 A;  1LB3 A;  4PG1 A;  2QF9 A;  3E1M A;  2ZA6 A;  3AJQ A;  5HJF A;  2WTL A;  3AF8 X;  4LQH A;  4MY7 A;  1FHA A;  2FZF A;  5JKM G;  3E1L A;  2CN7 A;  4AM2 A;  3PW8 A;  3RD0 A;  4R42 A;  4Z3B A;  3E1J A;  2VXX A;  4KVS A;  2CN6 A;  2ZG9 X;  3OJ5 A;  3WVV A;  2V2J A;  3E6R A;  3QZ3 A;  1B71 A;  1JGC A;  1NF6 A;  5JKL G;  3IS7 A;  3AJP A;  1JIG A;  3PVT A;  5GN8 A;  1VEQ A;  4CY9 A;  4DZ0 A;  3R2R A;  5C6F A;  4LQN A;  1LKO A;  4QUW A;  1YUZ A;  4YKH A;  1JTS A;  3SH6 A;  1DAT A;  1F33 A;  4IWJ A;  5K53 A;  2C2U A;  2GYQ A;  3PWQ A;  1RCC A;  4KVQ A;  2ZA8 A;  5GU3 X;  4TOC A;  1VEI A;  4LYU A;  4MJY A;  1VLG A;  4CYB A;  2RBD A;  4TOB A;  3NP0 X;  2C41 A;  3FVB A;  2V2O A;  3UOI A;  4ZLW A;  2CIH A;  2GYD A;  4ZKX A;  5LBH A;  1VJX A;  4EVD A;  3EZ0 A;  5K52 A;  3FSE A;  5J8W A;  2V2P A;  4IXK A;  4E6K A;  4DE6 A;  3PVR B;  4P18 A;  1JYB A;  3AK8 A;  2V2M A;  1Z6O A;  3UOF A;  3H7G A;  4DAS A;  1HRS A;  3R2L A;  2UX1 A;  4II4 B;  4PGI A;  3Q4O A;  4REU A;  3GE4 A;  4ZKW A;  4LYX A;  1S30 A;  1O9R A;  2YW6 A;  2XGW A;  3HL1 A;  5CZU A;  4EVC A;  4KVR A;  4AM5 A;  2XJO A;  3E1P A;  1MFR A;  3AJO A;  4ZJK A;  5GU0 X;  5HJH A;  3HIU A;  3PVR A;  3R2K A;  3U90 A;  4LQJ A;  3RE7 A;  4ISP A;  1S3Q A;  3RGD A;  2CHI A;  3PW1 B;  4ISM A;  3PWF A;  4TOD A;  3BKN A;  4II4 A;  4PGK A;  4M33 A;  2Y3Q A;  2IY4 A;  2BJY A;  5D8O A;  4Z5S A;  4M32 A;  2FJC A;  5D8X A;  2Z6M A;  1LKP A;  2X17 0;  1QGH A;  3KA9 A;  4DYU A;  3KA8 A;  5D8P A;  4IWK A;  2FHA A;  4RC7 B;  3PW8 C;  3O7R A;  4MUD A;  3E2C A;  4ML5 A;  1XZ3 A;  2ZUR X;  2BW1 A;  2QQY A;  4LPJ A;  3F36 A;  4CVP A;  1J30 A;  2G4H A;  3F34 A;  5ERK A;  3PW1 A;  2F7N A;  1XZ1 A;  1SOF A;  3EGM A;  1YUX A;  2VZB A;  1N1Q A;  1MOJ A;  3F33 A;  1KRQ A;  4XKS A;  3PVY B;  3F32 A;  1R03 A;  2FKZ A;  2Z90 A;  4ERU A;  3PWQ C;  5ERJ A;  2C2F A;  4RC7 A;  1EUM A;  3QHB A;  3QB9 A;  4M34 A;  3ISF A;  3F37 A;  1IER A;  2ZG7 X;  3AK9 A;  2V2N A;  2FG4 A;  3A9Q A;  2JD8 0;  2CF7 A;  1RCE A;  2W0O A;  2V2S A;  3R2S A;  4RC5 B;  4CVR A;  2VXI A;  2XJM A;  1JKV A;  2CHP A;  1ZUJ A;  1BCF A;  3WVU A;  5JKL A;  4CYA A;  3A68 A;  2JD6 0;  5FEJ A;  5HQO A;  3PVY A;  5FFE A;  3T9J A;  2JD7 0;  3R2M A;  3TA8 A;  2CLB A;  3SID A;  3F39 A;  2XJN A;  5CMQ A;  4TW3 A;  4TOE A;  2V2L A;  1Z6O M; 
#chains in the Genus database with same CATH topology
 1F30 A;  3IQ1 A;  3R2O A;  4RC5 A;  4ZTT A;  5FFA A;  3C21 A;  4CMY A;  2HTN A;  4EVE A;  3VNX A;  5E1U A;  3AF7 X;  5AXS A;  4DYZ A;  3E1O A;  3R2H A;  2OC5 A;  2Z5R A;  1AEW A;  3W54 A;  3KWO A;  3GVY A;  4RC8 A;  3KA3 A;  5GU1 X;  5J8S A;  3SHX A;  1ZS3 A;  1DVB A;  1OTK A;  2FFX J;  2HR5 A;  4PG0 A;  2WLU A;  3C1Z A;  1L8I A;  3L0M A;  5D8Y A;  2YJK A;  3NP2 X;  3DBY A;  3Q4R A;  3QD8 A;  1Z4A A;  2OH3 A;  2ZA7 A;  5D8S A;  2C2J A;  1TKP A;  4DYX A;  2MGY A;  3E6S A;  3IS8 A;  3RAV A;  1TJO A;  1YV1 A;  2WLA A;  2YJJ A;  4XKT A;  3ISE A;  3C1Y A;  3BVF A;  3KX9 A;  3NOZ X;  3QHC A;  4X0J A;  3KA6 A;  2C6R A;  4DI0 A;  5D8Q A;  3ERZ A;  3SE1 A;  2Y44 A;  3JZ9 A;  1O9I A;  4LPM A;  3QVD A;  2IU2 A;  3C23 A;  5E2D A;  4XGS A;  4MN9 A;  4TO9 A;  2XKQ A;  3O7S A;  1NF4 A;  2D5K A;  4ZKH A;  5GOU A;  3BVE A;  1SQ3 A;  4TOA A;  1LKM A;  1RCI A;  5GU2 X;  4E40 A;  3BVL A;  1IES A;  1UMN A;  3E1N A;  1H96 A;  3KA4 A;  3E1Q A;  2PYB A;  1JKU A;  1L8H A;  2V2I A;  3GHQ A;  5JKM A;  2V2R A;  5J93 A;  5LS9 A;  3BVI A;  4TOH A;  2GS4 A;  1DPS A;  2FG8 A;  2YW7 A;  1JRE A;  3D19 A;  4DYY A;  3EZU A;  4XKU A;  5FFB A;  1UVH A;  3JZA B;  3FRR A;  3ES3 A;  4TOF A;  3RBC A;  2CEI A;  1JI4 A;  4CVT A;  2Z5Q A;  4U3G A;  1TK6 A;  4TOG A;  5JAC A;  2ITB A;  4ETR A;  1S2Z A;  3UNO A;  4ITW A;  4ZL5 A;  4LQV A;  5FFD A;  4RC6 B;  1RCG A;  5IX6 A;  2FL0 A;  5I4J A;  3PZA A;  1NNQ A;  4OYN A;  4M35 A;  4ITT A;  1BFR A;  5LG2 A;  5D8R A;  5LG8 A;  2ZG8 X;  3OGH A;  2V15 A;  3WVW A;  1GWG A;  4EVB A;  1BG7 A;  5FFC A;  1JI5 A;  3FI6 A;  3KXU A;  3F38 A;  2G38 B;  3BT5 A;  4LPN A;  1RCD A;  2IB0 A;  4MKU A;  5CMR A;  4A25 A;  2Z5P A;  4ZMC A;  3BVK A;  2BKC A;  4CVS A;  5J9V A;  1RYT A;  3Q4N A;  1VEL A;  4AM4 A;  4Y08 A;  3WNW A;  4ZL6 A;  2BK6 A;  1NFV A;  2N02 A;  1TKO A;  4KXR B;  4CMY V;  3Q4Q A;  3MPS A;  3AF9 X;  3PVT B;  1QYB A;  4RC6 A;  5GN8 B;  2CLU A;  3F35 A;  1LB3 A;  4PG1 A;  2QF9 A;  3E1M A;  2ZA6 A;  3AJQ A;  5HJF A;  2WTL A;  3AF8 X;  4LQH A;  4MY7 A;  1FHA A;  2FZF A;  5JKM G;  3E1L A;  3GGZ A;  2CN7 A;  2CWL A;  4AM2 A;  3PW8 A;  3RD0 A;  4WJG 4;  4R42 A;  4Z3B A;  3E1J A;  2VXX A;  3GGY A;  3VV9 A;  4KVS A;  2CN6 A;  2ZG9 X;  3OJ5 A;  3WVV A;  2V2J A;  3E6R A;  3QZ3 A;  3VVA A;  1B71 A;  2V8U A;  1JGC A;  1NF6 A;  5JKL G;  3IS7 A;  3AJP A;  1JIG A;  3PVT A;  5GN8 A;  1VEQ A;  4CY9 A;  4YVZ A;  4DZ0 A;  3R2R A;  5C6F A;  3LKD A;  4LQN A;  1LKO A;  4QUW A;  1YUZ A;  4YKH A;  1JTS A;  3SH6 A;  1DAT A;  1F33 A;  4IWJ A;  5JDO B;  5K53 A;  2C2U A;  2GYQ A;  3PWQ A;  4YXJ A;  1RCC A;  4KVQ A;  2ZA8 A;  5GU3 X;  3N6O A;  2WWX B;  4TOC A;  1VEI A;  4LYU A;  4MJY A;  1VLG A;  4CYB A;  2RBD A;  4TOB A;  3NP0 X;  2C41 A;  3FVB A;  2V2O A;  3UOI A;  4ZLW A;  2CIH A;  2GYD A;  3V3K B;  4ZKX A;  5LBH A;  1VJX A;  2AR0 A;  4EVD A;  3EZ0 A;  5K52 A;  3FSE A;  5JDO A;  5J8W A;  4MXP A;  2V2P A;  4IXK A;  4E6K A;  4DE6 A;  3PVR B;  4P18 A;  1JYB A;  3AK8 A;  2V2M A;  1Z6O A;  3UOF A;  3H7G A;  4DAS A;  1HRS A;  3R2L A;  2UX1 A;  4II4 B;  4PGI A;  3Q4O A;  4REU A;  3GE4 A;  4ZKW A;  4LYX A;  1S30 A;  1O9R A;  2YW6 A;  2XGW A;  3HL1 A;  5CZU A;  4EVC A;  4KVR A;  3KDQ A;  4AM5 A;  2XJO A;  3E1P A;  1MFR A;  3AJO A;  4ZJK A;  5GU0 X;  5HJH A;  3HIU A;  3PVR A;  3R2K A;  3U90 A;  4LQJ A;  3RE7 A;  4ISP A;  1S3Q A;  3RGD A;  3KHK A;  2CHI A;  3FRS A;  3PW1 B;  4ISM A;  3PWF A;  4TOD A;  3BKN A;  4II4 A;  4PGK A;  4M33 A;  2Y3Q A;  2OKC A;  2IY4 A;  2BJY A;  5D8O A;  4Z5S A;  4M32 A;  2FJC A;  5D8X A;  2Z6M A;  1LKP A;  2X17 0;  1QGH A;  3KA9 A;  4DYU A;  3KA8 A;  5D8P A;  4IWK A;  2FHA A;  4RC7 B;  3PW8 C;  3O7R A;  4MUD A;  3E2C A;  4ML5 A;  1XZ3 A;  2ZUR X;  2BW1 A;  2QQY A;  4LPJ A;  3F36 A;  4CVP A;  1J30 A;  2G4H A;  3F34 A;  5ERK A;  3PW1 A;  2F7N A;  1XZ1 A;  1SOF A;  3EGM A;  1YUX A;  2VZB A;  1N1Q A;  1MOJ A;  4W4L B;  3F33 A;  1KRQ A;  4W4K B;  4XKS A;  3PVY B;  3F32 A;  1R03 A;  2FKZ A;  2Z90 A;  4ERU A;  3PWQ C;  5ERJ A;  2C2F A;  4RC7 A;  1EUM A;  3QHB A;  3QB9 A;  4M34 A;  3ISF A;  3F37 A;  1IER A;  2ZG7 X;  3AK9 A;  2V2N A;  2FG4 A;  3A9Q A;  2JD8 0;  2CF7 A;  1RCE A;  2W0O A;  2V2S A;  3R2S A;  4RC5 B;  4CVR A;  2VXI A;  2XJM A;  1JKV A;  3M6J A;  2CHP A;  1ZUJ A;  1BCF A;  3WVU A;  3UFB A;  5JKL A;  4CYA A;  3A68 A;  2JD6 0;  5FEJ A;  5HQO A;  3PVY A;  5FFE A;  3T9J A;  2JD7 0;  3R2M A;  2V8T A;  3TA8 A;  2CLB A;  3SID A;  3F39 A;  2XJN A;  5CMQ A;  4TW3 A;  4TOE A;  2V2L A;  4YXM A;  1Z6O M;  5HU6 D; 
#chains in the Genus database with same CATH homology
 1F30 A;  3IQ1 A;  3R2O A;  4RC5 A;  4ZTT A;  5FFA A;  3C21 A;  4CMY A;  2HTN A;  4EVE A;  3VNX A;  5E1U A;  3AF7 X;  5AXS A;  4DYZ A;  3E1O A;  3R2H A;  2OC5 A;  2Z5R A;  1AEW A;  3W54 A;  3KWO A;  3GVY A;  4RC8 A;  3KA3 A;  5GU1 X;  5J8S A;  3SHX A;  1ZS3 A;  1DVB A;  1OTK A;  2FFX J;  2HR5 A;  4PG0 A;  2WLU A;  3C1Z A;  1L8I A;  3L0M A;  5D8Y A;  2YJK A;  3NP2 X;  3DBY A;  3Q4R A;  3QD8 A;  1Z4A A;  2OH3 A;  2ZA7 A;  5D8S A;  2C2J A;  1TKP A;  4DYX A;  2MGY A;  3E6S A;  3IS8 A;  3RAV A;  1TJO A;  1YV1 A;  2WLA A;  2YJJ A;  4XKT A;  3ISE A;  3C1Y A;  3BVF A;  3KX9 A;  3NOZ X;  3QHC A;  4X0J A;  3KA6 A;  2C6R A;  4DI0 A;  5D8Q A;  3ERZ A;  3SE1 A;  2Y44 A;  3JZ9 A;  1O9I A;  4LPM A;  3QVD A;  2IU2 A;  3C23 A;  5E2D A;  4XGS A;  4MN9 A;  4TO9 A;  2XKQ A;  3O7S A;  1NF4 A;  2D5K A;  4ZKH A;  5GOU A;  3BVE A;  1SQ3 A;  4TOA A;  1LKM A;  1RCI A;  5GU2 X;  4E40 A;  3BVL A;  1IES A;  1UMN A;  3E1N A;  1H96 A;  3KA4 A;  3E1Q A;  2PYB A;  1JKU A;  1L8H A;  2V2I A;  3GHQ A;  5JKM A;  2V2R A;  5J93 A;  5LS9 A;  3BVI A;  4TOH A;  2GS4 A;  1DPS A;  2FG8 A;  2YW7 A;  1JRE A;  3D19 A;  4DYY A;  3EZU A;  4XKU A;  5FFB A;  1UVH A;  3JZA B;  3FRR A;  3ES3 A;  4TOF A;  3RBC A;  2CEI A;  1JI4 A;  4CVT A;  2Z5Q A;  4U3G A;  1TK6 A;  4TOG A;  5JAC A;  2ITB A;  4ETR A;  1S2Z A;  3UNO A;  4ITW A;  4ZL5 A;  4LQV A;  5FFD A;  4RC6 B;  1RCG A;  5IX6 A;  2FL0 A;  5I4J A;  3PZA A;  1NNQ A;  4OYN A;  4M35 A;  4ITT A;  1BFR A;  5LG2 A;  5D8R A;  5LG8 A;  2ZG8 X;  3OGH A;  2V15 A;  3WVW A;  1GWG A;  4EVB A;  1BG7 A;  5FFC A;  1JI5 A;  3FI6 A;  3KXU A;  3F38 A;  2G38 B;  3BT5 A;  4LPN A;  1RCD A;  2IB0 A;  4MKU A;  5CMR A;  4A25 A;  2Z5P A;  4ZMC A;  3BVK A;  2BKC A;  4CVS A;  5J9V A;  1RYT A;  3Q4N A;  1VEL A;  4AM4 A;  4Y08 A;  3WNW A;  4ZL6 A;  2BK6 A;  1NFV A;  2N02 A;  1TKO A;  4KXR B;  4CMY V;  3Q4Q A;  3MPS A;  3AF9 X;  3PVT B;  1QYB A;  4RC6 A;  5GN8 B;  2CLU A;  3F35 A;  1LB3 A;  4PG1 A;  2QF9 A;  3E1M A;  2ZA6 A;  3AJQ A;  5HJF A;  2WTL A;  3AF8 X;  4LQH A;  4MY7 A;  1FHA A;  2FZF A;  5JKM G;  3E1L A;  3GGZ A;  2CN7 A;  2CWL A;  4AM2 A;  3PW8 A;  3RD0 A;  4WJG 4;  4R42 A;  4Z3B A;  3E1J A;  2VXX A;  3GGY A;  3VV9 A;  4KVS A;  2CN6 A;  2ZG9 X;  3OJ5 A;  3WVV A;  2V2J A;  3E6R A;  3QZ3 A;  3VVA A;  1B71 A;  2V8U A;  1JGC A;  1NF6 A;  5JKL G;  3IS7 A;  3AJP A;  1JIG A;  3PVT A;  5GN8 A;  1VEQ A;  4CY9 A;  4YVZ A;  4DZ0 A;  3R2R A;  5C6F A;  3LKD A;  4LQN A;  1LKO A;  4QUW A;  1YUZ A;  4YKH A;  1JTS A;  3SH6 A;  1DAT A;  1F33 A;  4IWJ A;  5JDO B;  5K53 A;  2C2U A;  2GYQ A;  3PWQ A;  4YXJ A;  1RCC A;  4KVQ A;  2ZA8 A;  5GU3 X;  3N6O A;  2WWX B;  4TOC A;  1VEI A;  4LYU A;  4MJY A;  1VLG A;  4CYB A;  2RBD A;  4TOB A;  3NP0 X;  2C41 A;  3FVB A;  2V2O A;  3UOI A;  4ZLW A;  2CIH A;  2GYD A;  3V3K B;  4ZKX A;  5LBH A;  1VJX A;  2AR0 A;  4EVD A;  3EZ0 A;  5K52 A;  3FSE A;  5JDO A;  5J8W A;  4MXP A;  2V2P A;  4IXK A;  4E6K A;  4DE6 A;  3PVR B;  4P18 A;  1JYB A;  3AK8 A;  2V2M A;  1Z6O A;  3UOF A;  3H7G A;  4DAS A;  1HRS A;  3R2L A;  2UX1 A;  4II4 B;  4PGI A;  3Q4O A;  4REU A;  3GE4 A;  4ZKW A;  4LYX A;  1S30 A;  1O9R A;  2YW6 A;  2XGW A;  3HL1 A;  5CZU A;  4EVC A;  4KVR A;  3KDQ A;  4AM5 A;  2XJO A;  3E1P A;  1MFR A;  3AJO A;  4ZJK A;  5GU0 X;  5HJH A;  3HIU A;  3PVR A;  3R2K A;  3U90 A;  4LQJ A;  3RE7 A;  4ISP A;  1S3Q A;  3RGD A;  3KHK A;  2CHI A;  3FRS A;  3PW1 B;  4ISM A;  3PWF A;  4TOD A;  3BKN A;  4II4 A;  4PGK A;  4M33 A;  2Y3Q A;  2OKC A;  2IY4 A;  2BJY A;  5D8O A;  4Z5S A;  4M32 A;  2FJC A;  5D8X A;  2Z6M A;  1LKP A;  2X17 0;  1QGH A;  3KA9 A;  4DYU A;  3KA8 A;  5D8P A;  4IWK A;  2FHA A;  4RC7 B;  3PW8 C;  3O7R A;  4MUD A;  3E2C A;  4ML5 A;  1XZ3 A;  2ZUR X;  2BW1 A;  2QQY A;  4LPJ A;  3F36 A;  4CVP A;  1J30 A;  2G4H A;  3F34 A;  5ERK A;  3PW1 A;  2F7N A;  1XZ1 A;  1SOF A;  3EGM A;  1YUX A;  2VZB A;  1N1Q A;  1MOJ A;  4W4L B;  3F33 A;  1KRQ A;  4W4K B;  4XKS A;  3PVY B;  3F32 A;  1R03 A;  2FKZ A;  2Z90 A;  4ERU A;  3PWQ C;  5ERJ A;  2C2F A;  4RC7 A;  1EUM A;  3QHB A;  3QB9 A;  4M34 A;  3ISF A;  3F37 A;  1IER A;  2ZG7 X;  3AK9 A;  2V2N A;  2FG4 A;  3A9Q A;  2JD8 0;  2CF7 A;  1RCE A;  2W0O A;  2V2S A;  3R2S A;  4RC5 B;  4CVR A;  2VXI A;  2XJM A;  1JKV A;  3M6J A;  2CHP A;  1ZUJ A;  1BCF A;  3WVU A;  3UFB A;  5JKL A;  4CYA A;  3A68 A;  2JD6 0;  5FEJ A;  5HQO A;  3PVY A;  5FFE A;  3T9J A;  2JD7 0;  3R2M A;  2V8T A;  3TA8 A;  2CLB A;  3SID A;  3F39 A;  2XJN A;  5CMQ A;  4TW3 A;  4TOE A;  2V2L A;  4YXM A;  1Z6O M;  5HU6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...