2BK6A

The x-ray crystal structure of the listeria innocua h31g dps mutant.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
150
structure length
150
Chain Sequence
VDTKEFLNHQVANLNVFTVKIHQIGWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTLELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron oxidation and storage
molecule keywords NON-HEME IRON-CONTAINING FERRITIN
publication title The unusual intersubunit ferroxidase center of Listeria innocua Dps is required for hydrogen peroxide detoxification but not for iron uptake. A study with site-specific mutants.
pubmed doi rcsb
source organism Listeria innocua
total genus 64
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2bk6A00
3Q4RA 1Z6OA 3RAVA 1FHAA 1LKPA 3AJOA 4AM5A 2ZG7X 2XGWA 4A25A 3E2CA 2ZA8A 2WTLA 2IU2A 2CLUA 3ISEA 2Z6MA 2VXXA 1JYBA 1BCFA 3PVRA 5J9VA 2ZG9X 3PW8A 1AEWA 1NF4A 1SOFA 1DPSA 3PZAA 4IWKA 4CVRA 1JI5A 3ISFA 1ZS3A 3ES3A 2X170 5CMQA 4CMYA 2YJKA 5J93A 1XZ1A 2CHPA 3GVYA 4ERUA 5D8PA 4P18A 5LG8A 2YJJA 1DVBA 3F39A 2BW1A 4KVSA 3KXUA 1S2ZA 1LKOA 4CVTA 2YW7A 1VJXA 4CVPA 5D8SA 2XJOA 3WVWA 2BKCA 5JACA 4DYZA 2V2LA 2V2NA 4RC6B 1QGHA 3R2HA 3BVLA 3R2MA 5GN8A 2GYQA 5IX6A 2HTNA 2V2MA 4Y08A 4DI0A 1NFVA 2ZA6A 2C2UA 3AF8X 4RC5B 4TOEA 4XGSA 3Q4QA 5AXSA 3BVEA 3KA4A 4R42A 3WNWA 3AJPA 5ERJA 4XKUA 4MUDA 4ZJKA 1YV1A 3QHBA 4PGIA 1VELA 3KA6A 2GYDA 3PWQA 5JKLG 4EVCA 1O9IA 3KWOA 2G4HA 4ZMCA 3PVRB 4LQNA 3GE4A 3OGHA 5FFAA 4CVSA 3R2KA 5J8WA 2C41A 4MJYA 1ZUJA 1JI4A 4II4A 3KA9A 3A9QA 3SHXA 4RC5A 3Q4OA 2FHAA 5JKMG 1SQ3A 2ZURX 4EVEA 4XKTA 5FFCA 1RCIA 3F32A 5GU1X 3T9JA 1H96A 2V15A 2JD60 1RCGA 3R2OA 5D8XA 4TW3A 2CIHA 1JREA 3E1NA 4ITWA 3BT5A 4ZTTA 1LB3A 5J8SA 3E1QA 4LQHA 2C2JA 4TOBA 3OJ5A 3E6SA 4EVBA 2V2IA 4CYBA 3VNXA 5GN8B 2V2OA 5GU2X 3NOZX 5E1UA 5FFEA 4ZL5A 1GWGA 4LQVA 4M35A 3SE1A 4CYAA 5FFBA 2WLAA 5C6FA 1LKMA 3SH6A 5D8YA 3H7GA 4OYNA 5I4JA 2VZBA 3RBCA 4LYUA 3PVYB 4PG1A 3WVVA 1N1QA 1F33A 3F36A 3BKNA 3NP2X 3RGDA 1JKUA 4AM2A 2BJYA 2ITBA 5FEJA 5GU3X 3AF9X 5FFDA 2QF9A 2OC5A 1YUXA 1MFRA 1TK6A 1Z6OM 4II4B 4KVQA 1XZ3A 3F37A 4E6KA 4TOFA 1JGCA 1B71A 3ERZA 3AJQA 1TKPA 3F38A 4ISPA 5ERKA 1Z4AA 4RC8A 2WLUA 1L8IA 4MN9A 4ZKHA 3AK9A 2V2JA 4AM4A 1JTSA 4TOHA 3E6RA 4LPNA 1VLGA 1O9RA 4DYXA 4U3GA 1RCDA 3F35A 2PYBA 4DASA 2HR5A 3PVYA 3O7RA 1NNQA 1IESA 2CEIA 3FVBA 4LPJA 3UOIA 5K52A 4ZLWA 3F34A 4ETRA 2FZFA 3BVIA 4TOCA 3KA8A 4LYXA 2FJCA 3IS7A 4DZ0A 3R2LA 3HIUA 3PW8C 2Y3QA 1S3QA 4TOGA 3RE7A 3QZ3A 4IXKA 2Z90A 2FL0A 2XJMA 1BG7A 2V2SA 4RC7A 2BK6A 1S30A 3HL1A 4ZKXA 2C2FA 2XJNA 4MY7A 2Z5RA 4XKSA 4LPMA 2V2PA 3PWFA 4TOAA 3E1LA 3EGMA 3GHQA 3RD0A 4QUWA 4PG0A 3R2SA 2CN6A 5LBHA 1BFRA 5GOUA 2VXIA 2Z5QA 3E1PA 3FI6A 3PVTA 5HQOA 1VEIA 2D5KA 1JIGA 1RCCA 2JD70 3QB9A 5CMRA 4M33A 3SIDA 5JKLA 3O7SA 2YW6A 4MKUA 4CMYV 1UVHA 3IQ1A 2FG8A 2ZG8X 3PW1A 2QQYA 2XKQA 4CY9A 2V2RA 3EZUA 1TJOA 5JKMA 1KRQA 5CZUA 3WVUA 2F7NA 3AK8A 3EZ0A 3PWQC 4DYUA 4Z5SA 3IS8A 4ZL6A 2FFXJ 5D8QA 1NF6A 4REUA 3Q4NA 2JD80 5K53A 1TKOA 2CF7A 3E1MA 3UOFA 3FSEA 5D8OA 5LS9A 3E1OA 3QHCA 2ZA7A 2FKZA 1OTKA 4TODA 4RC7B 4DYYA 4Z3BA 2FG4A 2UX1A 1L8HA 3MPSA 3QD8A 3BVFA 2CLBA 4IWJA 2IB0A 1UMNA 4DE6A 2RBDA 1DATA 3KX9A 1IERA 3UNOA 3NP0X 5GU0X 3F33A 3TA8A 3PVTB 3U90A 2OH3A 5D8RA 1HRSA 4ISMA 1EUMA 4ML5A 1F30A 3KA3A 5HJFA 1J30A 2Z5PA 4KVRA 4LQJA 4PGKA 4RC6A 1JKVA 1R03A 3BVKA 1QYBA 3AF7X 1MOJA 4M34A 4ITTA 1RCEA 3A68A 1RYTA 1VEQA 2IY4A 2GS4A 1YUZA 4TO9A 3E1JA 4YKHA 4EVDA 2W0OA 2C6RA 3PW1B 3R2RA 2CHIA 2CN7A 5E2DA 5LG2A 3QVDA 4ZKWA 4M32A 5HJHA
chains in the Genus database with same CATH superfamily
3Q4RA 1Z6OA 3RAVA 1FHAA 1LKPA 3AJOA 4AM5A 2ZG7X 2XGWA 4A25A 3E2CA 3V3KB 2ZA8A 2WTLA 2IU2A 2CLUA 3ISEA 2Z6MA 2VXXA 1JYBA 1BCFA 3PVRA 4MXPA 5J9VA 2ZG9X 3PW8A 1AEWA 4X0JA 1NF4A 1SOFA 1DPSA 3PZAA 4IWKA 4CVRA 3KHKA 1JI5A 3ISFA 1ZS3A 3ES3A 2X170 5CMQA 4CMYA 2YJKA 5J93A 2V8UA 1XZ1A 2CHPA 3GVYA 3JZ9A 4ERUA 5D8PA 4P18A 5LG8A 2YJJA 2MGYA 1DVBA 3F39A 2BW1A 4KVSA 3KXUA 1S2ZA 1LKOA 4CVTA 2YW7A 1VJXA 4CVPA 5D8SA 2XJOA 3WVWA 2BKCA 5JACA 4DYZA 2V2LA 2V2NA 3VVAA 4RC6B 1QGHA 3R2HA 3BVLA 3R2MA 5GN8A 2GYQA 5IX6A 2HTNA 2V2MA 4Y08A 4DI0A 1NFVA 2ZA6A 2C2UA 3AF8X 4RC5B 4TOEA 4XGSA 3Q4QA 5AXSA 3BVEA 3M6JA 3KA4A 4R42A 3WNWA 3AJPA 5ERJA 4XKUA 4MUDA 4ZJKA 1YV1A 3QHBA 4PGIA 3GGYA 1VELA 3KA6A 2GYDA 3PWQA 5JKLG 4EVCA 1O9IA 3KWOA 2G4HA 4ZMCA 5HU6D 3PVRB 4LQNA 3GE4A 3UFBA 3FRSA 3OGHA 5FFAA 4CVSA 4YXJA 3C23A 3R2KA 5J8WA 2C41A 4MJYA 1ZUJA 1JI4A 3C1ZA 4II4A 3KA9A 3A9QA 3SHXA 4RC5A 3Q4OA 2FHAA 5JKMG 2V8TA 1SQ3A 2ZURX 4EVEA 4XKTA 5FFCA 1RCIA 3F32A 5GU1X 3T9JA 1H96A 2V15A 2JD60 1RCGA 3R2OA 5D8XA 3N6OA 4TW3A 2CIHA 1JREA 2CWLA 3E1NA 4ITWA 3BT5A 4ZTTA 3C1YA 1LB3A 5J8SA 3E1QA 4LQHA 2C2JA 4TOBA 3OJ5A 3E6SA 4EVBA 3W54A 2V2IA 4CYBA 3VNXA 5GN8B 2V2OA 5GU2X 2Y44A 3NOZX 5E1UA 5FFEA 4ZL5A 3JZAB 1GWGA 4LQVA 4M35A 3SE1A 4CYAA 5FFBA 2WLAA 5C6FA 1LKMA 3SH6A 5D8YA 2WWXB 3H7GA 4OYNA 5I4JA 2VZBA 3RBCA 4LYUA 3PVYB 4PG1A 3WVVA 1N1QA 1F33A 3F36A 3BKNA 3NP2X 3RGDA 1JKUA 3FRRA 2BJYA 2ITBA 4AM2A 5FEJA 5GU3X 3AF9X 5FFDA 2QF9A 2OC5A 1YUXA 1MFRA 3L0MA 1TK6A 1Z6OM 4II4B 4KVQA 1XZ3A 3F37A 4E6KA 4TOFA 1JGCA 4W4LB 3C21A 1B71A 3ERZA 3AJQA 1TKPA 3F38A 4ISPA 5ERKA 1Z4AA 4RC8A 2WLUA 1L8IA 2OKCA 4MN9A 4ZKHA 3AK9A 2V2JA 4AM4A 1JTSA 4TOHA 3E6RA 4LPNA 1VLGA 1O9RA 4DYXA 4U3GA 1RCDA 3F35A 2PYBA 4WJG4 4DASA 2HR5A 3PVYA 3O7RA 1NNQA 4YVZA 1IESA 2CEIA 3FVBA 4LPJA 3UOIA 5K52A 4ZLWA 3F34A 3KDQA 4ETRA 2FZFA 3BVIA 4TOCA 3KA8A 4LYXA 2FJCA 4E40A 3IS7A 4DZ0A 3GGZA 3LKDA 3HIUA 3R2LA 3PW8C 2Y3QA 1S3QA 4TOGA 3RE7A 3QZ3A 4IXKA 2Z90A 2FL0A 4KXRB 2XJMA 1BG7A 2V2SA 4RC7A 2BK6A 1S30A 3HL1A 4ZKXA 2C2FA 2XJNA 4MY7A 2Z5RA 4XKSA 4LPMA 2V2PA 3PWFA 4YXMA 4TOAA 3E1LA 3EGMA 3GHQA 3RD0A 4QUWA 4PG0A 3R2SA 2CN6A 5LBHA 1BFRA 5GOUA 2VXIA 2Z5QA 3E1PA 3FI6A 3PVTA 3D19A 5HQOA 1VEIA 2D5KA 1JIGA 1RCCA 2JD70 3QB9A 5CMRA 4M33A 3SIDA 5JKLA 3O7SA 2YW6A 4MKUA 2G38B 4CMYV 1UVHA 3IQ1A 2FG8A 2ZG8X 3PW1A 2QQYA 2XKQA 2AR0A 2N02A 4CY9A 2V2RA 3EZUA 1TJOA 5JKMA 1KRQA 5CZUA 3WVUA 2F7NA 3DBYA 3AK8A 3EZ0A 3PWQC 4DYUA 4Z5SA 3IS8A 4ZL6A 2FFXJ 5D8QA 1NF6A 4REUA 3Q4NA 2JD80 5K53A 1TKOA 2CF7A 3E1MA 3UOFA 3FSEA 5D8OA 5LS9A 3E1OA 3QHCA 2ZA7A 2FKZA 5JDOB 1OTKA 4TODA 4RC7B 4DYYA 4Z3BA 2FG4A 2UX1A 1L8HA 3MPSA 3QD8A 4W4KB 3BVFA 2CLBA 4IWJA 2IB0A 1UMNA 4DE6A 2RBDA 1DATA 3KX9A 1IERA 3UNOA 3NP0X 3VV9A 5GU0X 3F33A 3TA8A 3PVTB 3U90A 2OH3A 5D8RA 1HRSA 4ISMA 1EUMA 4ML5A 1F30A 3KA3A 5HJFA 1J30A 2Z5PA 5JDOA 4KVRA 4LQJA 4PGKA 4RC6A 1JKVA 1R03A 3BVKA 1QYBA 3AF7X 1MOJA 4M34A 4ITTA 1RCEA 3A68A 1RYTA 1VEQA 2IY4A 2GS4A 1YUZA 4TO9A 3E1JA 4YKHA 4EVDA 2W0OA 2C6RA 3PW1B 3R2RA 2CHIA 2CN7A 5E2DA 5LG2A 3QVDA 4ZKWA 4M32A 5HJHA
chains in the Genus database with same CATH topology
3Q4RA 1Z6OA 3RAVA 1FHAA 1LKPA 3AJOA 4AM5A 2ZG7X 2XGWA 4A25A 3E2CA 3V3KB 2ZA8A 2WTLA 2IU2A 2CLUA 3ISEA 2Z6MA 2VXXA 1JYBA 1BCFA 3PVRA 4MXPA 5J9VA 2ZG9X 3PW8A 1AEWA 4X0JA 1NF4A 1SOFA 1DPSA 3PZAA 4IWKA 4CVRA 3KHKA 1JI5A 3ISFA 1ZS3A 3ES3A 2X170 5CMQA 4CMYA 2YJKA 5J93A 2V8UA 1XZ1A 2CHPA 3GVYA 3JZ9A 4ERUA 5D8PA 4P18A 5LG8A 2YJJA 2MGYA 1DVBA 3F39A 2BW1A 4KVSA 3KXUA 1S2ZA 1LKOA 4CVTA 2YW7A 1VJXA 4CVPA 5D8SA 2XJOA 3WVWA 2BKCA 5JACA 4DYZA 2V2LA 2V2NA 3VVAA 4RC6B 1QGHA 3R2HA 3BVLA 3R2MA 5GN8A 2GYQA 5IX6A 2HTNA 2V2MA 4Y08A 4DI0A 1NFVA 2ZA6A 2C2UA 3AF8X 4RC5B 4TOEA 4XGSA 3Q4QA 5AXSA 3BVEA 3M6JA 3KA4A 4R42A 3WNWA 3AJPA 5ERJA 4XKUA 4MUDA 4ZJKA 1YV1A 3QHBA 4PGIA 3GGYA 1VELA 3KA6A 2GYDA 3PWQA 5JKLG 4EVCA 1O9IA 3KWOA 2G4HA 4ZMCA 5HU6D 3PVRB 4LQNA 3GE4A 3UFBA 3FRSA 3OGHA 5FFAA 4CVSA 4YXJA 3C23A 3R2KA 5J8WA 2C41A 4MJYA 1ZUJA 1JI4A 3C1ZA 4II4A 3KA9A 3A9QA 3SHXA 4RC5A 3Q4OA 2FHAA 5JKMG 2V8TA 1SQ3A 2ZURX 4EVEA 4XKTA 5FFCA 1RCIA 3F32A 5GU1X 3T9JA 1H96A 2V15A 2JD60 1RCGA 3R2OA 5D8XA 3N6OA 4TW3A 2CIHA 1JREA 2CWLA 3E1NA 4ITWA 3BT5A 4ZTTA 3C1YA 1LB3A 5J8SA 3E1QA 4LQHA 2C2JA 4TOBA 3OJ5A 3E6SA 4EVBA 3W54A 2V2IA 4CYBA 3VNXA 5GN8B 2V2OA 5GU2X 2Y44A 3NOZX 5E1UA 5FFEA 4ZL5A 3JZAB 1GWGA 4LQVA 4M35A 3SE1A 4CYAA 5FFBA 2WLAA 5C6FA 1LKMA 3SH6A 5D8YA 2WWXB 3H7GA 4OYNA 5I4JA 2VZBA 3RBCA 4LYUA 3PVYB 4PG1A 3WVVA 1N1QA 1F33A 3F36A 3BKNA 3NP2X 3RGDA 1JKUA 3FRRA 2BJYA 2ITBA 4AM2A 5FEJA 5GU3X 3AF9X 5FFDA 2QF9A 2OC5A 1YUXA 1MFRA 3L0MA 1TK6A 1Z6OM 4II4B 4KVQA 1XZ3A 3F37A 4E6KA 4TOFA 1JGCA 4W4LB 3C21A 1B71A 3ERZA 3AJQA 1TKPA 3F38A 4ISPA 5ERKA 1Z4AA 4RC8A 2WLUA 1L8IA 2OKCA 4MN9A 4ZKHA 3AK9A 2V2JA 4AM4A 1JTSA 4TOHA 3E6RA 4LPNA 1VLGA 1O9RA 4DYXA 4U3GA 1RCDA 3F35A 2PYBA 4WJG4 4DASA 2HR5A 3PVYA 3O7RA 1NNQA 4YVZA 1IESA 2CEIA 3FVBA 4LPJA 3UOIA 5K52A 4ZLWA 3F34A 3KDQA 4ETRA 2FZFA 3BVIA 4TOCA 3KA8A 4LYXA 2FJCA 4E40A 3IS7A 4DZ0A 3GGZA 3LKDA 3HIUA 3R2LA 3PW8C 2Y3QA 1S3QA 4TOGA 3RE7A 3QZ3A 4IXKA 2Z90A 2FL0A 4KXRB 2XJMA 1BG7A 2V2SA 4RC7A 2BK6A 1S30A 3HL1A 4ZKXA 2C2FA 2XJNA 4MY7A 2Z5RA 4XKSA 4LPMA 2V2PA 3PWFA 4YXMA 4TOAA 3E1LA 3EGMA 3GHQA 3RD0A 4QUWA 4PG0A 3R2SA 2CN6A 5LBHA 1BFRA 5GOUA 2VXIA 2Z5QA 3E1PA 3FI6A 3PVTA 3D19A 5HQOA 1VEIA 2D5KA 1JIGA 1RCCA 2JD70 3QB9A 5CMRA 4M33A 3SIDA 5JKLA 3O7SA 2YW6A 4MKUA 2G38B 4CMYV 1UVHA 3IQ1A 2FG8A 2ZG8X 3PW1A 2QQYA 2XKQA 2AR0A 2N02A 4CY9A 2V2RA 3EZUA 1TJOA 5JKMA 1KRQA 5CZUA 3WVUA 2F7NA 3DBYA 3AK8A 3EZ0A 3PWQC 4DYUA 4Z5SA 3IS8A 4ZL6A 2FFXJ 5D8QA 1NF6A 4REUA 3Q4NA 2JD80 5K53A 1TKOA 2CF7A 3E1MA 3UOFA 3FSEA 5D8OA 5LS9A 3E1OA 3QHCA 2ZA7A 2FKZA 5JDOB 1OTKA 4TODA 4RC7B 4DYYA 4Z3BA 2FG4A 2UX1A 1L8HA 3MPSA 3QD8A 4W4KB 3BVFA 2CLBA 4IWJA 2IB0A 1UMNA 4DE6A 2RBDA 1DATA 3KX9A 1IERA 3UNOA 3NP0X 3VV9A 5GU0X 3F33A 3TA8A 3PVTB 3U90A 2OH3A 5D8RA 1HRSA 4ISMA 1EUMA 4ML5A 1F30A 3KA3A 5HJFA 1J30A 2Z5PA 5JDOA 4KVRA 4LQJA 4PGKA 4RC6A 1JKVA 1R03A 3BVKA 1QYBA 3AF7X 1MOJA 4M34A 4ITTA 1RCEA 3A68A 1RYTA 1VEQA 2IY4A 2GS4A 1YUZA 4TO9A 3E1JA 4YKHA 4EVDA 2W0OA 2C6RA 3PW1B 3R2RA 2CHIA 2CN7A 5E2DA 5LG2A 3QVDA 4ZKWA 4M32A 5HJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4R A;  1Z6O A;  3RAV A;  1FHA A;  1LKP A;  3AJO A;  4AM5 A;  2ZG7 X;  2XGW A;  4A25 A;  3E2C A;  2ZA8 A;  2WTL A;  2IU2 A;  2CLU A;  3ISE A;  2Z6M A;  2VXX A;  1JYB A;  1BCF A;  3PVR A;  5J9V A;  2ZG9 X;  3PW8 A;  1AEW A;  1NF4 A;  1SOF A;  1DPS A;  3PZA A;  4IWK A;  4CVR A;  1JI5 A;  3ISF A;  1ZS3 A;  3ES3 A;  2X17 0;  5CMQ A;  4CMY A;  2YJK A;  5J93 A;  1XZ1 A;  2CHP A;  3GVY A;  4ERU A;  5D8P A;  4P18 A;  5LG8 A;  2YJJ A;  1DVB A;  3F39 A;  2BW1 A;  4KVS A;  3KXU A;  1S2Z A;  1LKO A;  4CVT A;  2YW7 A;  1VJX A;  4CVP A;  5D8S A;  2XJO A;  3WVW A;  2BKC A;  5JAC A;  4DYZ A;  2V2L A;  2V2N A;  4RC6 B;  1QGH A;  3R2H A;  3BVL A;  3R2M A;  5GN8 A;  2GYQ A;  5IX6 A;  2HTN A;  2V2M A;  4Y08 A;  4DI0 A;  1NFV A;  2ZA6 A;  2C2U A;  3AF8 X;  4RC5 B;  4TOE A;  4XGS A;  3Q4Q A;  5AXS A;  3BVE A;  3KA4 A;  4R42 A;  3WNW A;  3AJP A;  5ERJ A;  4XKU A;  4MUD A;  4ZJK A;  1YV1 A;  3QHB A;  4PGI A;  1VEL A;  3KA6 A;  2GYD A;  3PWQ A;  5JKL G;  4EVC A;  1O9I A;  3KWO A;  2G4H A;  4ZMC A;  3PVR B;  4LQN A;  3GE4 A;  3OGH A;  5FFA A;  4CVS A;  3R2K A;  5J8W A;  2C41 A;  4MJY A;  1ZUJ A;  1JI4 A;  4II4 A;  3KA9 A;  3A9Q A;  3SHX A;  4RC5 A;  3Q4O A;  2FHA A;  5JKM G;  1SQ3 A;  2ZUR X;  4EVE A;  4XKT A;  5FFC A;  1RCI A;  3F32 A;  5GU1 X;  3T9J A;  1H96 A;  2V15 A;  2JD6 0;  1RCG A;  3R2O A;  5D8X A;  4TW3 A;  2CIH A;  1JRE A;  3E1N A;  4ITW A;  3BT5 A;  4ZTT A;  1LB3 A;  5J8S A;  3E1Q A;  4LQH A;  2C2J A;  4TOB A;  3OJ5 A;  3E6S A;  4EVB A;  2V2I A;  4CYB A;  3VNX A;  5GN8 B;  2V2O A;  5GU2 X;  3NOZ X;  5E1U A;  5FFE A;  4ZL5 A;  1GWG A;  4LQV A;  4M35 A;  3SE1 A;  4CYA A;  5FFB A;  2WLA A;  5C6F A;  1LKM A;  3SH6 A;  5D8Y A;  3H7G A;  4OYN A;  5I4J A;  2VZB A;  3RBC A;  4LYU A;  3PVY B;  4PG1 A;  3WVV A;  1N1Q A;  1F33 A;  3F36 A;  3BKN A;  3NP2 X;  3RGD A;  1JKU A;  4AM2 A;  2BJY A;  2ITB A;  5FEJ A;  5GU3 X;  3AF9 X;  5FFD A;  2QF9 A;  2OC5 A;  1YUX A;  1MFR A;  1TK6 A;  1Z6O M;  4II4 B;  4KVQ A;  1XZ3 A;  3F37 A;  4E6K A;  4TOF A;  1JGC A;  1B71 A;  3ERZ A;  3AJQ A;  1TKP A;  3F38 A;  4ISP A;  5ERK A;  1Z4A A;  4RC8 A;  2WLU A;  1L8I A;  4MN9 A;  4ZKH A;  3AK9 A;  2V2J A;  4AM4 A;  1JTS A;  4TOH A;  3E6R A;  4LPN A;  1VLG A;  1O9R A;  4DYX A;  4U3G A;  1RCD A;  3F35 A;  2PYB A;  4DAS A;  2HR5 A;  3PVY A;  3O7R A;  1NNQ A;  1IES A;  2CEI A;  3FVB A;  4LPJ A;  3UOI A;  5K52 A;  4ZLW A;  3F34 A;  4ETR A;  2FZF A;  3BVI A;  4TOC A;  3KA8 A;  4LYX A;  2FJC A;  3IS7 A;  4DZ0 A;  3R2L A;  3HIU A;  3PW8 C;  2Y3Q A;  1S3Q A;  4TOG A;  3RE7 A;  3QZ3 A;  4IXK A;  2Z90 A;  2FL0 A;  2XJM A;  1BG7 A;  2V2S A;  4RC7 A;  2BK6 A;  1S30 A;  3HL1 A;  4ZKX A;  2C2F A;  2XJN A;  4MY7 A;  2Z5R A;  4XKS A;  4LPM A;  2V2P A;  3PWF A;  4TOA A;  3E1L A;  3EGM A;  3GHQ A;  3RD0 A;  4QUW A;  4PG0 A;  3R2S A;  2CN6 A;  5LBH A;  1BFR A;  5GOU A;  2VXI A;  2Z5Q A;  3E1P A;  3FI6 A;  3PVT A;  5HQO A;  1VEI A;  2D5K A;  1JIG A;  1RCC A;  2JD7 0;  3QB9 A;  5CMR A;  4M33 A;  3SID A;  5JKL A;  3O7S A;  2YW6 A;  4MKU A;  4CMY V;  1UVH A;  3IQ1 A;  2FG8 A;  2ZG8 X;  3PW1 A;  2QQY A;  2XKQ A;  4CY9 A;  2V2R A;  3EZU A;  1TJO A;  5JKM A;  1KRQ A;  5CZU A;  3WVU A;  2F7N A;  3AK8 A;  3EZ0 A;  3PWQ C;  4DYU A;  4Z5S A;  3IS8 A;  4ZL6 A;  2FFX J;  5D8Q A;  1NF6 A;  4REU A;  3Q4N A;  2JD8 0;  5K53 A;  1TKO A;  2CF7 A;  3E1M A;  3UOF A;  3FSE A;  5D8O A;  5LS9 A;  3E1O A;  3QHC A;  2ZA7 A;  2FKZ A;  1OTK A;  4TOD A;  4RC7 B;  4DYY A;  4Z3B A;  2FG4 A;  2UX1 A;  1L8H A;  3MPS A;  3QD8 A;  3BVF A;  2CLB A;  4IWJ A;  2IB0 A;  1UMN A;  4DE6 A;  2RBD A;  1DAT A;  3KX9 A;  1IER A;  3UNO A;  3NP0 X;  5GU0 X;  3F33 A;  3TA8 A;  3PVT B;  3U90 A;  2OH3 A;  5D8R A;  1HRS A;  4ISM A;  1EUM A;  4ML5 A;  1F30 A;  3KA3 A;  5HJF A;  1J30 A;  2Z5P A;  4KVR A;  4LQJ A;  4PGK A;  4RC6 A;  1JKV A;  1R03 A;  3BVK A;  1QYB A;  3AF7 X;  1MOJ A;  4M34 A;  4ITT A;  1RCE A;  3A68 A;  1RYT A;  1VEQ A;  2IY4 A;  2GS4 A;  1YUZ A;  4TO9 A;  3E1J A;  4YKH A;  4EVD A;  2W0O A;  2C6R A;  3PW1 B;  3R2R A;  2CHI A;  2CN7 A;  5E2D A;  5LG2 A;  3QVD A;  4ZKW A;  4M32 A;  5HJH A; 
#chains in the Genus database with same CATH topology
 3Q4R A;  1Z6O A;  3RAV A;  1FHA A;  1LKP A;  3AJO A;  4AM5 A;  2ZG7 X;  2XGW A;  4A25 A;  3E2C A;  3V3K B;  2ZA8 A;  2WTL A;  2IU2 A;  2CLU A;  3ISE A;  2Z6M A;  2VXX A;  1JYB A;  1BCF A;  3PVR A;  4MXP A;  5J9V A;  2ZG9 X;  3PW8 A;  1AEW A;  4X0J A;  1NF4 A;  1SOF A;  1DPS A;  3PZA A;  4IWK A;  4CVR A;  3KHK A;  1JI5 A;  3ISF A;  1ZS3 A;  3ES3 A;  2X17 0;  5CMQ A;  4CMY A;  2YJK A;  5J93 A;  2V8U A;  1XZ1 A;  2CHP A;  3GVY A;  3JZ9 A;  4ERU A;  5D8P A;  4P18 A;  5LG8 A;  2YJJ A;  2MGY A;  1DVB A;  3F39 A;  2BW1 A;  4KVS A;  3KXU A;  1S2Z A;  1LKO A;  4CVT A;  2YW7 A;  1VJX A;  4CVP A;  5D8S A;  2XJO A;  3WVW A;  2BKC A;  5JAC A;  4DYZ A;  2V2L A;  2V2N A;  3VVA A;  4RC6 B;  1QGH A;  3R2H A;  3BVL A;  3R2M A;  5GN8 A;  2GYQ A;  5IX6 A;  2HTN A;  2V2M A;  4Y08 A;  4DI0 A;  1NFV A;  2ZA6 A;  2C2U A;  3AF8 X;  4RC5 B;  4TOE A;  4XGS A;  3Q4Q A;  5AXS A;  3BVE A;  3M6J A;  3KA4 A;  4R42 A;  3WNW A;  3AJP A;  5ERJ A;  4XKU A;  4MUD A;  4ZJK A;  1YV1 A;  3QHB A;  4PGI A;  3GGY A;  1VEL A;  3KA6 A;  2GYD A;  3PWQ A;  5JKL G;  4EVC A;  1O9I A;  3KWO A;  2G4H A;  4ZMC A;  5HU6 D;  3PVR B;  4LQN A;  3GE4 A;  3UFB A;  3FRS A;  3OGH A;  5FFA A;  4CVS A;  4YXJ A;  3C23 A;  3R2K A;  5J8W A;  2C41 A;  4MJY A;  1ZUJ A;  1JI4 A;  3C1Z A;  4II4 A;  3KA9 A;  3A9Q A;  3SHX A;  4RC5 A;  3Q4O A;  2FHA A;  5JKM G;  2V8T A;  1SQ3 A;  2ZUR X;  4EVE A;  4XKT A;  5FFC A;  1RCI A;  3F32 A;  5GU1 X;  3T9J A;  1H96 A;  2V15 A;  2JD6 0;  1RCG A;  3R2O A;  5D8X A;  3N6O A;  4TW3 A;  2CIH A;  1JRE A;  2CWL A;  3E1N A;  4ITW A;  3BT5 A;  4ZTT A;  3C1Y A;  1LB3 A;  5J8S A;  3E1Q A;  4LQH A;  2C2J A;  4TOB A;  3OJ5 A;  3E6S A;  4EVB A;  3W54 A;  2V2I A;  4CYB A;  3VNX A;  5GN8 B;  2V2O A;  5GU2 X;  2Y44 A;  3NOZ X;  5E1U A;  5FFE A;  4ZL5 A;  3JZA B;  1GWG A;  4LQV A;  4M35 A;  3SE1 A;  4CYA A;  5FFB A;  2WLA A;  5C6F A;  1LKM A;  3SH6 A;  5D8Y A;  2WWX B;  3H7G A;  4OYN A;  5I4J A;  2VZB A;  3RBC A;  4LYU A;  3PVY B;  4PG1 A;  3WVV A;  1N1Q A;  1F33 A;  3F36 A;  3BKN A;  3NP2 X;  3RGD A;  1JKU A;  3FRR A;  2BJY A;  2ITB A;  4AM2 A;  5FEJ A;  5GU3 X;  3AF9 X;  5FFD A;  2QF9 A;  2OC5 A;  1YUX A;  1MFR A;  3L0M A;  1TK6 A;  1Z6O M;  4II4 B;  4KVQ A;  1XZ3 A;  3F37 A;  4E6K A;  4TOF A;  1JGC A;  4W4L B;  3C21 A;  1B71 A;  3ERZ A;  3AJQ A;  1TKP A;  3F38 A;  4ISP A;  5ERK A;  1Z4A A;  4RC8 A;  2WLU A;  1L8I A;  2OKC A;  4MN9 A;  4ZKH A;  3AK9 A;  2V2J A;  4AM4 A;  1JTS A;  4TOH A;  3E6R A;  4LPN A;  1VLG A;  1O9R A;  4DYX A;  4U3G A;  1RCD A;  3F35 A;  2PYB A;  4WJG 4;  4DAS A;  2HR5 A;  3PVY A;  3O7R A;  1NNQ A;  4YVZ A;  1IES A;  2CEI A;  3FVB A;  4LPJ A;  3UOI A;  5K52 A;  4ZLW A;  3F34 A;  3KDQ A;  4ETR A;  2FZF A;  3BVI A;  4TOC A;  3KA8 A;  4LYX A;  2FJC A;  4E40 A;  3IS7 A;  4DZ0 A;  3GGZ A;  3LKD A;  3HIU A;  3R2L A;  3PW8 C;  2Y3Q A;  1S3Q A;  4TOG A;  3RE7 A;  3QZ3 A;  4IXK A;  2Z90 A;  2FL0 A;  4KXR B;  2XJM A;  1BG7 A;  2V2S A;  4RC7 A;  2BK6 A;  1S30 A;  3HL1 A;  4ZKX A;  2C2F A;  2XJN A;  4MY7 A;  2Z5R A;  4XKS A;  4LPM A;  2V2P A;  3PWF A;  4YXM A;  4TOA A;  3E1L A;  3EGM A;  3GHQ A;  3RD0 A;  4QUW A;  4PG0 A;  3R2S A;  2CN6 A;  5LBH A;  1BFR A;  5GOU A;  2VXI A;  2Z5Q A;  3E1P A;  3FI6 A;  3PVT A;  3D19 A;  5HQO A;  1VEI A;  2D5K A;  1JIG A;  1RCC A;  2JD7 0;  3QB9 A;  5CMR A;  4M33 A;  3SID A;  5JKL A;  3O7S A;  2YW6 A;  4MKU A;  2G38 B;  4CMY V;  1UVH A;  3IQ1 A;  2FG8 A;  2ZG8 X;  3PW1 A;  2QQY A;  2XKQ A;  2AR0 A;  2N02 A;  4CY9 A;  2V2R A;  3EZU A;  1TJO A;  5JKM A;  1KRQ A;  5CZU A;  3WVU A;  2F7N A;  3DBY A;  3AK8 A;  3EZ0 A;  3PWQ C;  4DYU A;  4Z5S A;  3IS8 A;  4ZL6 A;  2FFX J;  5D8Q A;  1NF6 A;  4REU A;  3Q4N A;  2JD8 0;  5K53 A;  1TKO A;  2CF7 A;  3E1M A;  3UOF A;  3FSE A;  5D8O A;  5LS9 A;  3E1O A;  3QHC A;  2ZA7 A;  2FKZ A;  5JDO B;  1OTK A;  4TOD A;  4RC7 B;  4DYY A;  4Z3B A;  2FG4 A;  2UX1 A;  1L8H A;  3MPS A;  3QD8 A;  4W4K B;  3BVF A;  2CLB A;  4IWJ A;  2IB0 A;  1UMN A;  4DE6 A;  2RBD A;  1DAT A;  3KX9 A;  1IER A;  3UNO A;  3NP0 X;  3VV9 A;  5GU0 X;  3F33 A;  3TA8 A;  3PVT B;  3U90 A;  2OH3 A;  5D8R A;  1HRS A;  4ISM A;  1EUM A;  4ML5 A;  1F30 A;  3KA3 A;  5HJF A;  1J30 A;  2Z5P A;  5JDO A;  4KVR A;  4LQJ A;  4PGK A;  4RC6 A;  1JKV A;  1R03 A;  3BVK A;  1QYB A;  3AF7 X;  1MOJ A;  4M34 A;  4ITT A;  1RCE A;  3A68 A;  1RYT A;  1VEQ A;  2IY4 A;  2GS4 A;  1YUZ A;  4TO9 A;  3E1J A;  4YKH A;  4EVD A;  2W0O A;  2C6R A;  3PW1 B;  3R2R A;  2CHI A;  2CN7 A;  5E2D A;  5LG2 A;  3QVD A;  4ZKW A;  4M32 A;  5HJH A; 
#chains in the Genus database with same CATH homology
 3Q4R A;  1Z6O A;  3RAV A;  1FHA A;  1LKP A;  3AJO A;  4AM5 A;  2ZG7 X;  2XGW A;  4A25 A;  3E2C A;  3V3K B;  2ZA8 A;  2WTL A;  2IU2 A;  2CLU A;  3ISE A;  2Z6M A;  2VXX A;  1JYB A;  1BCF A;  3PVR A;  4MXP A;  5J9V A;  2ZG9 X;  3PW8 A;  1AEW A;  4X0J A;  1NF4 A;  1SOF A;  1DPS A;  3PZA A;  4IWK A;  4CVR A;  3KHK A;  1JI5 A;  3ISF A;  1ZS3 A;  3ES3 A;  2X17 0;  5CMQ A;  4CMY A;  2YJK A;  5J93 A;  2V8U A;  1XZ1 A;  2CHP A;  3GVY A;  3JZ9 A;  4ERU A;  5D8P A;  4P18 A;  5LG8 A;  2YJJ A;  2MGY A;  1DVB A;  3F39 A;  2BW1 A;  4KVS A;  3KXU A;  1S2Z A;  1LKO A;  4CVT A;  2YW7 A;  1VJX A;  4CVP A;  5D8S A;  2XJO A;  3WVW A;  2BKC A;  5JAC A;  4DYZ A;  2V2L A;  2V2N A;  3VVA A;  4RC6 B;  1QGH A;  3R2H A;  3BVL A;  3R2M A;  5GN8 A;  2GYQ A;  5IX6 A;  2HTN A;  2V2M A;  4Y08 A;  4DI0 A;  1NFV A;  2ZA6 A;  2C2U A;  3AF8 X;  4RC5 B;  4TOE A;  4XGS A;  3Q4Q A;  5AXS A;  3BVE A;  3M6J A;  3KA4 A;  4R42 A;  3WNW A;  3AJP A;  5ERJ A;  4XKU A;  4MUD A;  4ZJK A;  1YV1 A;  3QHB A;  4PGI A;  3GGY A;  1VEL A;  3KA6 A;  2GYD A;  3PWQ A;  5JKL G;  4EVC A;  1O9I A;  3KWO A;  2G4H A;  4ZMC A;  5HU6 D;  3PVR B;  4LQN A;  3GE4 A;  3UFB A;  3FRS A;  3OGH A;  5FFA A;  4CVS A;  4YXJ A;  3C23 A;  3R2K A;  5J8W A;  2C41 A;  4MJY A;  1ZUJ A;  1JI4 A;  3C1Z A;  4II4 A;  3KA9 A;  3A9Q A;  3SHX A;  4RC5 A;  3Q4O A;  2FHA A;  5JKM G;  2V8T A;  1SQ3 A;  2ZUR X;  4EVE A;  4XKT A;  5FFC A;  1RCI A;  3F32 A;  5GU1 X;  3T9J A;  1H96 A;  2V15 A;  2JD6 0;  1RCG A;  3R2O A;  5D8X A;  3N6O A;  4TW3 A;  2CIH A;  1JRE A;  2CWL A;  3E1N A;  4ITW A;  3BT5 A;  4ZTT A;  3C1Y A;  1LB3 A;  5J8S A;  3E1Q A;  4LQH A;  2C2J A;  4TOB A;  3OJ5 A;  3E6S A;  4EVB A;  3W54 A;  2V2I A;  4CYB A;  3VNX A;  5GN8 B;  2V2O A;  5GU2 X;  2Y44 A;  3NOZ X;  5E1U A;  5FFE A;  4ZL5 A;  3JZA B;  1GWG A;  4LQV A;  4M35 A;  3SE1 A;  4CYA A;  5FFB A;  2WLA A;  5C6F A;  1LKM A;  3SH6 A;  5D8Y A;  2WWX B;  3H7G A;  4OYN A;  5I4J A;  2VZB A;  3RBC A;  4LYU A;  3PVY B;  4PG1 A;  3WVV A;  1N1Q A;  1F33 A;  3F36 A;  3BKN A;  3NP2 X;  3RGD A;  1JKU A;  3FRR A;  2BJY A;  2ITB A;  4AM2 A;  5FEJ A;  5GU3 X;  3AF9 X;  5FFD A;  2QF9 A;  2OC5 A;  1YUX A;  1MFR A;  3L0M A;  1TK6 A;  1Z6O M;  4II4 B;  4KVQ A;  1XZ3 A;  3F37 A;  4E6K A;  4TOF A;  1JGC A;  4W4L B;  3C21 A;  1B71 A;  3ERZ A;  3AJQ A;  1TKP A;  3F38 A;  4ISP A;  5ERK A;  1Z4A A;  4RC8 A;  2WLU A;  1L8I A;  2OKC A;  4MN9 A;  4ZKH A;  3AK9 A;  2V2J A;  4AM4 A;  1JTS A;  4TOH A;  3E6R A;  4LPN A;  1VLG A;  1O9R A;  4DYX A;  4U3G A;  1RCD A;  3F35 A;  2PYB A;  4WJG 4;  4DAS A;  2HR5 A;  3PVY A;  3O7R A;  1NNQ A;  4YVZ A;  1IES A;  2CEI A;  3FVB A;  4LPJ A;  3UOI A;  5K52 A;  4ZLW A;  3F34 A;  3KDQ A;  4ETR A;  2FZF A;  3BVI A;  4TOC A;  3KA8 A;  4LYX A;  2FJC A;  4E40 A;  3IS7 A;  4DZ0 A;  3GGZ A;  3LKD A;  3HIU A;  3R2L A;  3PW8 C;  2Y3Q A;  1S3Q A;  4TOG A;  3RE7 A;  3QZ3 A;  4IXK A;  2Z90 A;  2FL0 A;  4KXR B;  2XJM A;  1BG7 A;  2V2S A;  4RC7 A;  2BK6 A;  1S30 A;  3HL1 A;  4ZKX A;  2C2F A;  2XJN A;  4MY7 A;  2Z5R A;  4XKS A;  4LPM A;  2V2P A;  3PWF A;  4YXM A;  4TOA A;  3E1L A;  3EGM A;  3GHQ A;  3RD0 A;  4QUW A;  4PG0 A;  3R2S A;  2CN6 A;  5LBH A;  1BFR A;  5GOU A;  2VXI A;  2Z5Q A;  3E1P A;  3FI6 A;  3PVT A;  3D19 A;  5HQO A;  1VEI A;  2D5K A;  1JIG A;  1RCC A;  2JD7 0;  3QB9 A;  5CMR A;  4M33 A;  3SID A;  5JKL A;  3O7S A;  2YW6 A;  4MKU A;  2G38 B;  4CMY V;  1UVH A;  3IQ1 A;  2FG8 A;  2ZG8 X;  3PW1 A;  2QQY A;  2XKQ A;  2AR0 A;  2N02 A;  4CY9 A;  2V2R A;  3EZU A;  1TJO A;  5JKM A;  1KRQ A;  5CZU A;  3WVU A;  2F7N A;  3DBY A;  3AK8 A;  3EZ0 A;  3PWQ C;  4DYU A;  4Z5S A;  3IS8 A;  4ZL6 A;  2FFX J;  5D8Q A;  1NF6 A;  4REU A;  3Q4N A;  2JD8 0;  5K53 A;  1TKO A;  2CF7 A;  3E1M A;  3UOF A;  3FSE A;  5D8O A;  5LS9 A;  3E1O A;  3QHC A;  2ZA7 A;  2FKZ A;  5JDO B;  1OTK A;  4TOD A;  4RC7 B;  4DYY A;  4Z3B A;  2FG4 A;  2UX1 A;  1L8H A;  3MPS A;  3QD8 A;  4W4K B;  3BVF A;  2CLB A;  4IWJ A;  2IB0 A;  1UMN A;  4DE6 A;  2RBD A;  1DAT A;  3KX9 A;  1IER A;  3UNO A;  3NP0 X;  3VV9 A;  5GU0 X;  3F33 A;  3TA8 A;  3PVT B;  3U90 A;  2OH3 A;  5D8R A;  1HRS A;  4ISM A;  1EUM A;  4ML5 A;  1F30 A;  3KA3 A;  5HJF A;  1J30 A;  2Z5P A;  5JDO A;  4KVR A;  4LQJ A;  4PGK A;  4RC6 A;  1JKV A;  1R03 A;  3BVK A;  1QYB A;  3AF7 X;  1MOJ A;  4M34 A;  4ITT A;  1RCE A;  3A68 A;  1RYT A;  1VEQ A;  2IY4 A;  2GS4 A;  1YUZ A;  4TO9 A;  3E1J A;  4YKH A;  4EVD A;  2W0O A;  2C6R A;  3PW1 B;  3R2R A;  2CHI A;  2CN7 A;  5E2D A;  5LG2 A;  3QVD A;  4ZKW A;  4M32 A;  5HJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...