3R2LA

1.85a resolution structure of iron soaked ftna from pseudomonas aeruginosa (ph 7.5)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
154
structure length
154
Chain Sequence
b'MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Two distinct ferritin-like molecules in Pseudomonas aeruginosa: the product of the bfrA gene is a bacterial ferritin (FtnA) and not a bacterioferritin (Bfr).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 75
structure length 154
sequence length 154
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3r2lA00
4ITTA 3EZ0A 3HIUA 1SOFA 4RC6A 3R2SA 4EVEA 4PG1A 5CMRA 1VEIA 4EVCA 4RC7B 4DE6A 3NOZX 3BVIA 4ZL6A 1GWGA 3WVUA 2G4HA 2ZG9X 3O7SA 2V2IA 3U90A 1MOJA 2RBDA 5GU0X 3BVFA 2HTNA 3RGDA 3E1JA 5CMQA 2XGWA 1JI5A 1LKPA 3KX9A 3BVEA 5GU3X 3AJQA 4PGIA 3PVRB 4TOHA 2CLBA 3SH6A 3SE1A 2OH3A 3QHBA 4YKHA 4II4A 2V2LA 2C2FA 3KXUA 3F35A 3AJPA 1FHAA 3EGMA 1TJOA 3PVTB 2YW7A 2XJOA 4TOBA 3E1NA 4OYNA 5LG2A 4PGKA 3NP2X 5D8PA 4KVSA 1KRQA 2OC5A 3ISFA 3R2KA 3KA8A 4EVDA 3F36A 2GYDA 2D5KA 4QUWA 2V2RA 1OTKA 3OJ5A 2JD60 2IB0A 2CLUA 2UX1A 1F30A 2V2OA 4CMYA 1S30A 3MPSA 5JKLA 3QVDA 4CVRA 3NP0X 1J30A 3SIDA 3KWOA 1QGHA 2FG8A 4Y08A 2Y3QA 4LYUA 1JKVA 2WLUA 4CVPA 1Z4AA 1JGCA 4ERUA 4ZKHA 3ERZA 1ZUJA 4XKUA 1Z6OM 3F38A 1JI4A 3E1MA 3Q4OA 3PW1A 1BG7A 2V2MA 4TOEA 2YJKA 1HRSA 3RBCA 4RC7A 1XZ1A 3Q4NA 4RC5B 3R2HA 2C2JA 4PG0A 5E1UA 2ZG8X 3FSEA 3F32A 2V2SA 1O9RA 3QB9A 2XJMA 3IS7A 2ZA7A 2YW6A 2ITBA 3PVRA 2VZBA 1MFRA 1VELA 2Z5QA 2CHPA 3E1OA 3RAVA 1VLGA 2FHAA 1TK6A 1YUXA 2HR5A 1H96A 5I4JA 3F34A 4M33A 1B71A 1N1QA 2CN7A 3R2LA 3UNOA 1R03A 4U3GA 4DZ0A 4AM4A 3PW8C 1DVBA 3E1PA 3QD8A 5GOUA 2FKZA 4CVTA 5GN8B 4EVBA 2FFXJ 4MUDA 2V2JA 5D8YA 1ZS3A 5D8XA 1UMNA 3IS8A 2Z5RA 3BT5A 1EUMA 1JTSA 3RE7A 1DPSA 3PZAA 4TOGA 4DI0A 4ML5A 3PVYA 4TOAA 2CN6A 3A68A 5J8WA 2F7NA 3AJOA 5C6FA 1VJXA 3GE4A 1LKMA 4IXKA 3UOFA 3PWQC 3KA6A 3T9JA 1SQ3A 5ERJA 5JACA 4MY7A 3R2RA 4TOCA 4REUA 2C2UA 3RD0A 1YV1A 3QHCA 2FJCA 5J93A 3H7GA 4DYUA 2C6RA 2JD80 3AK8A 5GU2X 4M35A 5LBHA 3QZ3A 4DYYA 5K52A 3E6SA 4ITWA 1AEWA 2WTLA 1IESA 4ISPA 4KVRA 1F33A 3AK9A 1RCIA 1JREA 2VXXA 2CF7A 2QQYA 2YJJA 3KA9A 1NF6A 3WVVA 4LPNA 4AM5A 3F37A 5JKMG 2V2NA 2Z5PA 4TOFA 1NNQA 2V2PA 4LYXA 3AF7X 1QYBA 4LQHA 3O7RA 2QF9A 4TO9A 4TODA 1RCDA 4CYAA 3PVTA 2W0OA 5K53A 5FFEA 1UVHA 3BKNA 3UOIA 3F39A 4MJYA 4DYZA 4M32A 2ZG7X 1NFVA 4Z5SA 3FI6A 4XKSA 4ZKXA 3PW1B 4IWKA 1S3QA 1JIGA 2BJYA 2IU2A 5AXSA 2X170 4AM2A 3ES3A 4ISMA 5E2DA 1L8HA 5HJFA 1RCCA 3BVKA 3HL1A 4A25A 4TW3A 3F33A 3BVLA 4MKUA 5J9VA 3R2MA 2Z6MA 1L8IA 4XGSA 4DASA 1NF4A 4MN9A 4XKTA 3TA8A 4RC8A 5LS9A 3KA4A 3FVBA 2XJNA 3R2OA 2ZA8A 4RC6B 3E2CA 2C41A 2FZFA 3AF8X 1TKPA 2CHIA 3SHXA 1IERA 4Z3BA 1RYTA 5FEJA 4ZL5A 2JD70 4R42A 4LQJA 2GYQA 3PW8A 1LB3A 2CEIA 1DATA 3EZUA 3OGHA 4P18A 5FFCA 4LQVA 5D8SA 5J8SA 1TKOA 2ZURX 3A9QA 4RC5A 3VNXA 1RCGA 5CZUA 4IWJA 2XKQA 2GS4A 4CMYV 2BW1A 4ZLWA 4ETRA 2BKCA 4ZKWA 5HJHA 5FFAA 1RCEA 4II4B 4LPJA 3GVYA 2WLAA 5D8QA 2IY4A 3WVWA 1VEQA 4LQNA 2V15A 5HQOA 4ZJKA 2CIHA 4KVQA 5IX6A 3Q4QA 2PYBA 3PWFA 4LPMA 5JKMA 1Z6OA 1JKUA 3E1QA 3WNWA 3KA3A 4E6KA 3PVYB 2Z90A 4CVSA 1BFRA 5GU1X 3PWQA 4ZMCA 4M34A 5FFBA 5JKLG 1S2ZA 2BK6A 1JYBA 2VXIA 4CY9A 5FFDA 1YUZA 4DYXA 1XZ3A 3E6RA 3E1LA 3GHQA 5ERKA 1LKOA 3Q4RA 5GN8A 2ZA6A 5D8RA 2FL0A 3ISEA 5D8OA 3IQ1A 4CYBA 4ZTTA 5LG8A 2FG4A 1O9IA 1BCFA 3AF9X
chains in the Genus database with same CATH superfamily
4ITTA 3EZ0A 3HIUA 1SOFA 4RC6A 3R2SA 4EVEA 3C23A 4PG1A 5CMRA 1VEIA 4EVCA 4RC7B 4DE6A 3NOZX 3BVIA 4ZL6A 1GWGA 4YXMA 3WVUA 2G4HA 2ZG9X 3O7SA 2V2IA 3U90A 1MOJA 2RBDA 5GU0X 3BVFA 2HTNA 3RGDA 3FRRA 3E1JA 5CMQA 2XGWA 1JI5A 1LKPA 3C1ZA 3KX9A 3BVEA 5GU3X 3AJQA 4PGIA 3PVRB 4TOHA 2CLBA 3SH6A 3SE1A 2OH3A 3QHBA 4YKHA 4II4A 2V2LA 2C2FA 3KXUA 3F35A 3AJPA 1FHAA 3EGMA 1TJOA 3PVTB 2YW7A 2XJOA 4TOBA 3E1NA 4OYNA 5LG2A 5HU6D 4PGKA 4KXRB 3NP2X 5D8PA 3L0MA 4KVSA 1KRQA 2OC5A 3ISFA 3R2KA 3KA8A 4EVDA 3F36A 2GYDA 2D5KA 4QUWA 2V2RA 1OTKA 3OJ5A 2JD60 2IB0A 2CLUA 2UX1A 1F30A 2V2OA 4CMYA 1S30A 3MPSA 5JKLA 3QVDA 4CVRA 3NP0X 1J30A 3SIDA 3KWOA 2V8TA 1QGHA 2FG8A 4Y08A 2Y3QA 2V8UA 4LYUA 1JKVA 2WLUA 4CVPA 1Z4AA 2AR0A 1JGCA 4ERUA 4ZKHA 3ERZA 1ZUJA 4XKUA 1Z6OM 3F38A 1JI4A 3E1MA 3Q4OA 3PW1A 1BG7A 2V2MA 4TOEA 2YJKA 2Y44A 1HRSA 3RBCA 4RC7A 1XZ1A 3Q4NA 4RC5B 3R2HA 2C2JA 4PG0A 5E1UA 2ZG8X 3FSEA 3F32A 2V2SA 1O9RA 3QB9A 2XJMA 3IS7A 2ZA7A 2YW6A 2ITBA 3PVRA 2VZBA 1MFRA 1VELA 2Z5QA 2CHPA 3E1OA 3RAVA 1VLGA 2FHAA 1TK6A 3JZAB 1YUXA 2HR5A 1H96A 5I4JA 2CWLA 3F34A 4M33A 1B71A 3KHKA 1N1QA 2CN7A 3R2LA 3UNOA 1R03A 4U3GA 4WJG4 4DZ0A 4AM4A 3PW8C 1DVBA 3E1PA 3QD8A 5GOUA 2FKZA 4CVTA 5GN8B 4EVBA 2FFXJ 4MUDA 2V2JA 5D8YA 1ZS3A 5D8XA 1UMNA 3IS8A 3KDQA 2Z5RA 3BT5A 3VV9A 1EUMA 1JTSA 3RE7A 1DPSA 3PZAA 4TOGA 4DI0A 4ML5A 3PVYA 4TOAA 2CN6A 3A68A 5J8WA 2F7NA 3AJOA 5C6FA 1VJXA 3GE4A 1LKMA 3JZ9A 4IXKA 3UOFA 3PWQC 3KA6A 3T9JA 1SQ3A 5ERJA 5JACA 4MY7A 3R2RA 4TOCA 4REUA 2C2UA 3RD0A 1YV1A 3QHCA 3V3KB 2FJCA 5J93A 4YXJA 3H7GA 4DYUA 2C6RA 2JD80 3AK8A 5GU2X 4M35A 5LBHA 4E40A 3QZ3A 4DYYA 5K52A 3E6SA 4ITWA 1AEWA 4X0JA 4W4LB 2WTLA 1IESA 4ISPA 4KVRA 1F33A 3AK9A 1RCIA 1JREA 2VXXA 2CF7A 2QQYA 2YJJA 3KA9A 1NF6A 3WVVA 4LPNA 4AM5A 3F37A 5JKMG 2V2NA 2Z5PA 4TOFA 1NNQA 2V2PA 4LYXA 3AF7X 1QYBA 4LQHA 3O7RA 2QF9A 5JDOB 4TO9A 4TODA 1RCDA 3VVAA 3W54A 4CYAA 3PVTA 2W0OA 5K53A 5FFEA 1UVHA 3BKNA 3UOIA 3F39A 4MJYA 4DYZA 4M32A 2ZG7X 1NFVA 4Z5SA 3FI6A 4XKSA 4ZKXA 3PW1B 4IWKA 1S3QA 1JIGA 2BJYA 2IU2A 5AXSA 2X170 4YVZA 4AM2A 3ES3A 4ISMA 3DBYA 5E2DA 1L8HA 5HJFA 1RCCA 3BVKA 3HL1A 4A25A 2MGYA 4TW3A 3F33A 3BVLA 4MKUA 5J9VA 3R2MA 2Z6MA 1L8IA 4XGSA 4DASA 1NF4A 4MN9A 3GGYA 4XKTA 3TA8A 4RC8A 5LS9A 3KA4A 3FVBA 2XJNA 3R2OA 2ZA8A 4RC6B 3E2CA 2C41A 2FZFA 3AF8X 1TKPA 2CHIA 3SHXA 3C21A 1IERA 4Z3BA 2N02A 1RYTA 5FEJA 4ZL5A 2JD70 3C1YA 4LQJA 4R42A 2GYQA 3PW8A 1LB3A 2CEIA 1DATA 3EZUA 3OGHA 4P18A 5FFCA 4LQVA 5D8SA 4W4KB 1TKOA 2ZURX 5J8SA 3A9QA 4RC5A 3VNXA 1RCGA 5CZUA 4IWJA 2XKQA 4MXPA 2GS4A 4CMYV 2BW1A 4ZLWA 4ETRA 2WWXB 2BKCA 4ZKWA 5HJHA 5FFAA 1RCEA 4II4B 4LPJA 3GVYA 2WLAA 5D8QA 2IY4A 3D19A 3WVWA 1VEQA 4LQNA 2V15A 5HQOA 4ZJKA 2CIHA 3M6JA 4KVQA 5IX6A 3Q4QA 2PYBA 3PWFA 5JDOA 2OKCA 4LPMA 5JKMA 1Z6OA 1JKUA 3E1QA 2G38B 3WNWA 3KA3A 4E6KA 3GGZA 3PVYB 2Z90A 4CVSA 1BFRA 3N6OA 3LKDA 5GU1X 3PWQA 4ZMCA 4M34A 5FFBA 5JKLG 1S2ZA 2BK6A 1JYBA 2VXIA 4CY9A 3FRSA 1YUZA 5FFDA 4DYXA 1XZ3A 3E6RA 3E1LA 3GHQA 5ERKA 1LKOA 3Q4RA 5GN8A 2ZA6A 5D8RA 2FL0A 3ISEA 5D8OA 3IQ1A 4CYBA 4ZTTA 5LG8A 3UFBA 2FG4A 1O9IA 1BCFA 3AF9X
chains in the Genus database with same CATH topology
4ITTA 3EZ0A 3HIUA 1SOFA 4RC6A 3R2SA 4EVEA 3C23A 4PG1A 5CMRA 1VEIA 4EVCA 4RC7B 4DE6A 3NOZX 3BVIA 4ZL6A 1GWGA 4YXMA 3WVUA 2G4HA 2ZG9X 3O7SA 2V2IA 3U90A 1MOJA 2RBDA 5GU0X 3BVFA 2HTNA 3RGDA 3FRRA 3E1JA 5CMQA 2XGWA 1JI5A 1LKPA 3C1ZA 3KX9A 3BVEA 5GU3X 3AJQA 4PGIA 3PVRB 4TOHA 2CLBA 3SH6A 3SE1A 2OH3A 3QHBA 4YKHA 4II4A 2V2LA 2C2FA 3KXUA 3F35A 3AJPA 1FHAA 3EGMA 1TJOA 3PVTB 2YW7A 2XJOA 4TOBA 3E1NA 4OYNA 5LG2A 5HU6D 4PGKA 4KXRB 3NP2X 5D8PA 3L0MA 4KVSA 1KRQA 2OC5A 3ISFA 3R2KA 3KA8A 4EVDA 3F36A 2GYDA 2D5KA 4QUWA 2V2RA 1OTKA 3OJ5A 2JD60 2IB0A 2CLUA 2UX1A 1F30A 2V2OA 4CMYA 1S30A 3MPSA 5JKLA 3QVDA 4CVRA 3NP0X 1J30A 3SIDA 3KWOA 2V8TA 1QGHA 2FG8A 4Y08A 2Y3QA 2V8UA 4LYUA 1JKVA 2WLUA 4CVPA 1Z4AA 2AR0A 1JGCA 4ERUA 4ZKHA 3ERZA 1ZUJA 4XKUA 1Z6OM 3F38A 1JI4A 3E1MA 3Q4OA 3PW1A 1BG7A 2V2MA 4TOEA 2YJKA 2Y44A 1HRSA 3RBCA 4RC7A 1XZ1A 3Q4NA 4RC5B 3R2HA 2C2JA 4PG0A 5E1UA 2ZG8X 3FSEA 3F32A 2V2SA 1O9RA 3QB9A 2XJMA 3IS7A 2ZA7A 2YW6A 2ITBA 3PVRA 2VZBA 1MFRA 1VELA 2Z5QA 2CHPA 3E1OA 3RAVA 1VLGA 2FHAA 1TK6A 3JZAB 1YUXA 2HR5A 1H96A 5I4JA 2CWLA 3F34A 4M33A 1B71A 3KHKA 1N1QA 2CN7A 3R2LA 3UNOA 1R03A 4U3GA 4WJG4 4DZ0A 4AM4A 3PW8C 1DVBA 3E1PA 3QD8A 5GOUA 2FKZA 4CVTA 5GN8B 4EVBA 2FFXJ 4MUDA 2V2JA 5D8YA 1ZS3A 5D8XA 1UMNA 3IS8A 3KDQA 2Z5RA 3BT5A 3VV9A 1EUMA 1JTSA 3RE7A 1DPSA 3PZAA 4TOGA 4DI0A 4ML5A 3PVYA 4TOAA 2CN6A 3A68A 5J8WA 2F7NA 3AJOA 5C6FA 1VJXA 3GE4A 1LKMA 3JZ9A 4IXKA 3UOFA 3PWQC 3KA6A 3T9JA 1SQ3A 5ERJA 5JACA 4MY7A 3R2RA 4TOCA 4REUA 2C2UA 3RD0A 1YV1A 3QHCA 3V3KB 2FJCA 5J93A 4YXJA 3H7GA 4DYUA 2C6RA 2JD80 3AK8A 5GU2X 4M35A 5LBHA 4E40A 3QZ3A 4DYYA 5K52A 3E6SA 4ITWA 1AEWA 4X0JA 4W4LB 2WTLA 1IESA 4ISPA 4KVRA 1F33A 3AK9A 1RCIA 1JREA 2VXXA 2CF7A 2QQYA 2YJJA 3KA9A 1NF6A 3WVVA 4LPNA 4AM5A 3F37A 5JKMG 2V2NA 2Z5PA 4TOFA 1NNQA 2V2PA 4LYXA 3AF7X 1QYBA 4LQHA 3O7RA 2QF9A 5JDOB 4TO9A 4TODA 1RCDA 3VVAA 3W54A 4CYAA 3PVTA 2W0OA 5K53A 5FFEA 1UVHA 3BKNA 3UOIA 3F39A 4MJYA 4DYZA 4M32A 2ZG7X 1NFVA 4Z5SA 3FI6A 4XKSA 4ZKXA 3PW1B 4IWKA 1S3QA 1JIGA 2BJYA 2IU2A 5AXSA 2X170 4YVZA 4AM2A 3ES3A 4ISMA 3DBYA 5E2DA 1L8HA 5HJFA 1RCCA 3BVKA 3HL1A 4A25A 2MGYA 4TW3A 3F33A 3BVLA 4MKUA 5J9VA 3R2MA 2Z6MA 1L8IA 4XGSA 4DASA 1NF4A 4MN9A 3GGYA 4XKTA 3TA8A 4RC8A 5LS9A 3KA4A 3FVBA 2XJNA 3R2OA 2ZA8A 4RC6B 3E2CA 2C41A 2FZFA 3AF8X 1TKPA 2CHIA 3SHXA 3C21A 1IERA 4Z3BA 2N02A 1RYTA 5FEJA 4ZL5A 2JD70 3C1YA 4LQJA 4R42A 2GYQA 3PW8A 1LB3A 2CEIA 1DATA 3EZUA 3OGHA 4P18A 5FFCA 4LQVA 5D8SA 4W4KB 1TKOA 2ZURX 5J8SA 3A9QA 4RC5A 3VNXA 1RCGA 5CZUA 4IWJA 2XKQA 4MXPA 2GS4A 4CMYV 2BW1A 4ZLWA 4ETRA 2WWXB 2BKCA 4ZKWA 5HJHA 5FFAA 1RCEA 4II4B 4LPJA 3GVYA 2WLAA 5D8QA 2IY4A 3D19A 3WVWA 1VEQA 4LQNA 2V15A 5HQOA 4ZJKA 2CIHA 3M6JA 4KVQA 5IX6A 3Q4QA 2PYBA 3PWFA 5JDOA 2OKCA 4LPMA 5JKMA 1Z6OA 1JKUA 3E1QA 2G38B 3WNWA 3KA3A 4E6KA 3GGZA 3PVYB 2Z90A 4CVSA 1BFRA 3N6OA 3LKDA 5GU1X 3PWQA 4ZMCA 4M34A 5FFBA 5JKLG 1S2ZA 2BK6A 1JYBA 2VXIA 4CY9A 3FRSA 1YUZA 5FFDA 4DYXA 1XZ3A 3E6RA 3E1LA 3GHQA 5ERKA 1LKOA 3Q4RA 5GN8A 2ZA6A 5D8RA 2FL0A 3ISEA 5D8OA 3IQ1A 4CYBA 4ZTTA 5LG8A 3UFBA 2FG4A 1O9IA 1BCFA 3AF9X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITT A;  3EZ0 A;  3HIU A;  1SOF A;  4RC6 A;  3R2S A;  4EVE A;  4PG1 A;  5CMR A;  1VEI A;  4EVC A;  4RC7 B;  4DE6 A;  3NOZ X;  3BVI A;  4ZL6 A;  1GWG A;  3WVU A;  2G4H A;  2ZG9 X;  3O7S A;  2V2I A;  3U90 A;  1MOJ A;  2RBD A;  5GU0 X;  3BVF A;  2HTN A;  3RGD A;  3E1J A;  5CMQ A;  2XGW A;  1JI5 A;  1LKP A;  3KX9 A;  3BVE A;  5GU3 X;  3AJQ A;  4PGI A;  3PVR B;  4TOH A;  2CLB A;  3SH6 A;  3SE1 A;  2OH3 A;  3QHB A;  4YKH A;  4II4 A;  2V2L A;  2C2F A;  3KXU A;  3F35 A;  3AJP A;  1FHA A;  3EGM A;  1TJO A;  3PVT B;  2YW7 A;  2XJO A;  4TOB A;  3E1N A;  4OYN A;  5LG2 A;  4PGK A;  3NP2 X;  5D8P A;  4KVS A;  1KRQ A;  2OC5 A;  3ISF A;  3R2K A;  3KA8 A;  4EVD A;  3F36 A;  2GYD A;  2D5K A;  4QUW A;  2V2R A;  1OTK A;  3OJ5 A;  2JD6 0;  2IB0 A;  2CLU A;  2UX1 A;  1F30 A;  2V2O A;  4CMY A;  1S30 A;  3MPS A;  5JKL A;  3QVD A;  4CVR A;  3NP0 X;  1J30 A;  3SID A;  3KWO A;  1QGH A;  2FG8 A;  4Y08 A;  2Y3Q A;  4LYU A;  1JKV A;  2WLU A;  4CVP A;  1Z4A A;  1JGC A;  4ERU A;  4ZKH A;  3ERZ A;  1ZUJ A;  4XKU A;  1Z6O M;  3F38 A;  1JI4 A;  3E1M A;  3Q4O A;  3PW1 A;  1BG7 A;  2V2M A;  4TOE A;  2YJK A;  1HRS A;  3RBC A;  4RC7 A;  1XZ1 A;  3Q4N A;  4RC5 B;  3R2H A;  2C2J A;  4PG0 A;  5E1U A;  2ZG8 X;  3FSE A;  3F32 A;  2V2S A;  1O9R A;  3QB9 A;  2XJM A;  3IS7 A;  2ZA7 A;  2YW6 A;  2ITB A;  3PVR A;  2VZB A;  1MFR A;  1VEL A;  2Z5Q A;  2CHP A;  3E1O A;  3RAV A;  1VLG A;  2FHA A;  1TK6 A;  1YUX A;  2HR5 A;  1H96 A;  5I4J A;  3F34 A;  4M33 A;  1B71 A;  1N1Q A;  2CN7 A;  3R2L A;  3UNO A;  1R03 A;  4U3G A;  4DZ0 A;  4AM4 A;  3PW8 C;  1DVB A;  3E1P A;  3QD8 A;  5GOU A;  2FKZ A;  4CVT A;  5GN8 B;  4EVB A;  2FFX J;  4MUD A;  2V2J A;  5D8Y A;  1ZS3 A;  5D8X A;  1UMN A;  3IS8 A;  2Z5R A;  3BT5 A;  1EUM A;  1JTS A;  3RE7 A;  1DPS A;  3PZA A;  4TOG A;  4DI0 A;  4ML5 A;  3PVY A;  4TOA A;  2CN6 A;  3A68 A;  5J8W A;  2F7N A;  3AJO A;  5C6F A;  1VJX A;  3GE4 A;  1LKM A;  4IXK A;  3UOF A;  3PWQ C;  3KA6 A;  3T9J A;  1SQ3 A;  5ERJ A;  5JAC A;  4MY7 A;  3R2R A;  4TOC A;  4REU A;  2C2U A;  3RD0 A;  1YV1 A;  3QHC A;  2FJC A;  5J93 A;  3H7G A;  4DYU A;  2C6R A;  2JD8 0;  3AK8 A;  5GU2 X;  4M35 A;  5LBH A;  3QZ3 A;  4DYY A;  5K52 A;  3E6S A;  4ITW A;  1AEW A;  2WTL A;  1IES A;  4ISP A;  4KVR A;  1F33 A;  3AK9 A;  1RCI A;  1JRE A;  2VXX A;  2CF7 A;  2QQY A;  2YJJ A;  3KA9 A;  1NF6 A;  3WVV A;  4LPN A;  4AM5 A;  3F37 A;  5JKM G;  2V2N A;  2Z5P A;  4TOF A;  1NNQ A;  2V2P A;  4LYX A;  3AF7 X;  1QYB A;  4LQH A;  3O7R A;  2QF9 A;  4TO9 A;  4TOD A;  1RCD A;  4CYA A;  3PVT A;  2W0O A;  5K53 A;  5FFE A;  1UVH A;  3BKN A;  3UOI A;  3F39 A;  4MJY A;  4DYZ A;  4M32 A;  2ZG7 X;  1NFV A;  4Z5S A;  3FI6 A;  4XKS A;  4ZKX A;  3PW1 B;  4IWK A;  1S3Q A;  1JIG A;  2BJY A;  2IU2 A;  5AXS A;  2X17 0;  4AM2 A;  3ES3 A;  4ISM A;  5E2D A;  1L8H A;  5HJF A;  1RCC A;  3BVK A;  3HL1 A;  4A25 A;  4TW3 A;  3F33 A;  3BVL A;  4MKU A;  5J9V A;  3R2M A;  2Z6M A;  1L8I A;  4XGS A;  4DAS A;  1NF4 A;  4MN9 A;  4XKT A;  3TA8 A;  4RC8 A;  5LS9 A;  3KA4 A;  3FVB A;  2XJN A;  3R2O A;  2ZA8 A;  4RC6 B;  3E2C A;  2C41 A;  2FZF A;  3AF8 X;  1TKP A;  2CHI A;  3SHX A;  1IER A;  4Z3B A;  1RYT A;  5FEJ A;  4ZL5 A;  2JD7 0;  4R42 A;  4LQJ A;  2GYQ A;  3PW8 A;  1LB3 A;  2CEI A;  1DAT A;  3EZU A;  3OGH A;  4P18 A;  5FFC A;  4LQV A;  5D8S A;  5J8S A;  1TKO A;  2ZUR X;  3A9Q A;  4RC5 A;  3VNX A;  1RCG A;  5CZU A;  4IWJ A;  2XKQ A;  2GS4 A;  4CMY V;  2BW1 A;  4ZLW A;  4ETR A;  2BKC A;  4ZKW A;  5HJH A;  5FFA A;  1RCE A;  4II4 B;  4LPJ A;  3GVY A;  2WLA A;  5D8Q A;  2IY4 A;  3WVW A;  1VEQ A;  4LQN A;  2V15 A;  5HQO A;  4ZJK A;  2CIH A;  4KVQ A;  5IX6 A;  3Q4Q A;  2PYB A;  3PWF A;  4LPM A;  5JKM A;  1Z6O A;  1JKU A;  3E1Q A;  3WNW A;  3KA3 A;  4E6K A;  3PVY B;  2Z90 A;  4CVS A;  1BFR A;  5GU1 X;  3PWQ A;  4ZMC A;  4M34 A;  5FFB A;  5JKL G;  1S2Z A;  2BK6 A;  1JYB A;  2VXI A;  4CY9 A;  5FFD A;  1YUZ A;  4DYX A;  1XZ3 A;  3E6R A;  3E1L A;  3GHQ A;  5ERK A;  1LKO A;  3Q4R A;  5GN8 A;  2ZA6 A;  5D8R A;  2FL0 A;  3ISE A;  5D8O A;  3IQ1 A;  4CYB A;  4ZTT A;  5LG8 A;  2FG4 A;  1O9I A;  1BCF A;  3AF9 X; 
#chains in the Genus database with same CATH topology
 4ITT A;  3EZ0 A;  3HIU A;  1SOF A;  4RC6 A;  3R2S A;  4EVE A;  3C23 A;  4PG1 A;  5CMR A;  1VEI A;  4EVC A;  4RC7 B;  4DE6 A;  3NOZ X;  3BVI A;  4ZL6 A;  1GWG A;  4YXM A;  3WVU A;  2G4H A;  2ZG9 X;  3O7S A;  2V2I A;  3U90 A;  1MOJ A;  2RBD A;  5GU0 X;  3BVF A;  2HTN A;  3RGD A;  3FRR A;  3E1J A;  5CMQ A;  2XGW A;  1JI5 A;  1LKP A;  3C1Z A;  3KX9 A;  3BVE A;  5GU3 X;  3AJQ A;  4PGI A;  3PVR B;  4TOH A;  2CLB A;  3SH6 A;  3SE1 A;  2OH3 A;  3QHB A;  4YKH A;  4II4 A;  2V2L A;  2C2F A;  3KXU A;  3F35 A;  3AJP A;  1FHA A;  3EGM A;  1TJO A;  3PVT B;  2YW7 A;  2XJO A;  4TOB A;  3E1N A;  4OYN A;  5LG2 A;  5HU6 D;  4PGK A;  4KXR B;  3NP2 X;  5D8P A;  3L0M A;  4KVS A;  1KRQ A;  2OC5 A;  3ISF A;  3R2K A;  3KA8 A;  4EVD A;  3F36 A;  2GYD A;  2D5K A;  4QUW A;  2V2R A;  1OTK A;  3OJ5 A;  2JD6 0;  2IB0 A;  2CLU A;  2UX1 A;  1F30 A;  2V2O A;  4CMY A;  1S30 A;  3MPS A;  5JKL A;  3QVD A;  4CVR A;  3NP0 X;  1J30 A;  3SID A;  3KWO A;  2V8T A;  1QGH A;  2FG8 A;  4Y08 A;  2Y3Q A;  2V8U A;  4LYU A;  1JKV A;  2WLU A;  4CVP A;  1Z4A A;  2AR0 A;  1JGC A;  4ERU A;  4ZKH A;  3ERZ A;  1ZUJ A;  4XKU A;  1Z6O M;  3F38 A;  1JI4 A;  3E1M A;  3Q4O A;  3PW1 A;  1BG7 A;  2V2M A;  4TOE A;  2YJK A;  2Y44 A;  1HRS A;  3RBC A;  4RC7 A;  1XZ1 A;  3Q4N A;  4RC5 B;  3R2H A;  2C2J A;  4PG0 A;  5E1U A;  2ZG8 X;  3FSE A;  3F32 A;  2V2S A;  1O9R A;  3QB9 A;  2XJM A;  3IS7 A;  2ZA7 A;  2YW6 A;  2ITB A;  3PVR A;  2VZB A;  1MFR A;  1VEL A;  2Z5Q A;  2CHP A;  3E1O A;  3RAV A;  1VLG A;  2FHA A;  1TK6 A;  3JZA B;  1YUX A;  2HR5 A;  1H96 A;  5I4J A;  2CWL A;  3F34 A;  4M33 A;  1B71 A;  3KHK A;  1N1Q A;  2CN7 A;  3R2L A;  3UNO A;  1R03 A;  4U3G A;  4WJG 4;  4DZ0 A;  4AM4 A;  3PW8 C;  1DVB A;  3E1P A;  3QD8 A;  5GOU A;  2FKZ A;  4CVT A;  5GN8 B;  4EVB A;  2FFX J;  4MUD A;  2V2J A;  5D8Y A;  1ZS3 A;  5D8X A;  1UMN A;  3IS8 A;  3KDQ A;  2Z5R A;  3BT5 A;  3VV9 A;  1EUM A;  1JTS A;  3RE7 A;  1DPS A;  3PZA A;  4TOG A;  4DI0 A;  4ML5 A;  3PVY A;  4TOA A;  2CN6 A;  3A68 A;  5J8W A;  2F7N A;  3AJO A;  5C6F A;  1VJX A;  3GE4 A;  1LKM A;  3JZ9 A;  4IXK A;  3UOF A;  3PWQ C;  3KA6 A;  3T9J A;  1SQ3 A;  5ERJ A;  5JAC A;  4MY7 A;  3R2R A;  4TOC A;  4REU A;  2C2U A;  3RD0 A;  1YV1 A;  3QHC A;  3V3K B;  2FJC A;  5J93 A;  4YXJ A;  3H7G A;  4DYU A;  2C6R A;  2JD8 0;  3AK8 A;  5GU2 X;  4M35 A;  5LBH A;  4E40 A;  3QZ3 A;  4DYY A;  5K52 A;  3E6S A;  4ITW A;  1AEW A;  4X0J A;  4W4L B;  2WTL A;  1IES A;  4ISP A;  4KVR A;  1F33 A;  3AK9 A;  1RCI A;  1JRE A;  2VXX A;  2CF7 A;  2QQY A;  2YJJ A;  3KA9 A;  1NF6 A;  3WVV A;  4LPN A;  4AM5 A;  3F37 A;  5JKM G;  2V2N A;  2Z5P A;  4TOF A;  1NNQ A;  2V2P A;  4LYX A;  3AF7 X;  1QYB A;  4LQH A;  3O7R A;  2QF9 A;  5JDO B;  4TO9 A;  4TOD A;  1RCD A;  3VVA A;  3W54 A;  4CYA A;  3PVT A;  2W0O A;  5K53 A;  5FFE A;  1UVH A;  3BKN A;  3UOI A;  3F39 A;  4MJY A;  4DYZ A;  4M32 A;  2ZG7 X;  1NFV A;  4Z5S A;  3FI6 A;  4XKS A;  4ZKX A;  3PW1 B;  4IWK A;  1S3Q A;  1JIG A;  2BJY A;  2IU2 A;  5AXS A;  2X17 0;  4YVZ A;  4AM2 A;  3ES3 A;  4ISM A;  3DBY A;  5E2D A;  1L8H A;  5HJF A;  1RCC A;  3BVK A;  3HL1 A;  4A25 A;  2MGY A;  4TW3 A;  3F33 A;  3BVL A;  4MKU A;  5J9V A;  3R2M A;  2Z6M A;  1L8I A;  4XGS A;  4DAS A;  1NF4 A;  4MN9 A;  3GGY A;  4XKT A;  3TA8 A;  4RC8 A;  5LS9 A;  3KA4 A;  3FVB A;  2XJN A;  3R2O A;  2ZA8 A;  4RC6 B;  3E2C A;  2C41 A;  2FZF A;  3AF8 X;  1TKP A;  2CHI A;  3SHX A;  3C21 A;  1IER A;  4Z3B A;  2N02 A;  1RYT A;  5FEJ A;  4ZL5 A;  2JD7 0;  3C1Y A;  4LQJ A;  4R42 A;  2GYQ A;  3PW8 A;  1LB3 A;  2CEI A;  1DAT A;  3EZU A;  3OGH A;  4P18 A;  5FFC A;  4LQV A;  5D8S A;  4W4K B;  1TKO A;  2ZUR X;  5J8S A;  3A9Q A;  4RC5 A;  3VNX A;  1RCG A;  5CZU A;  4IWJ A;  2XKQ A;  4MXP A;  2GS4 A;  4CMY V;  2BW1 A;  4ZLW A;  4ETR A;  2WWX B;  2BKC A;  4ZKW A;  5HJH A;  5FFA A;  1RCE A;  4II4 B;  4LPJ A;  3GVY A;  2WLA A;  5D8Q A;  2IY4 A;  3D19 A;  3WVW A;  1VEQ A;  4LQN A;  2V15 A;  5HQO A;  4ZJK A;  2CIH A;  3M6J A;  4KVQ A;  5IX6 A;  3Q4Q A;  2PYB A;  3PWF A;  5JDO A;  2OKC A;  4LPM A;  5JKM A;  1Z6O A;  1JKU A;  3E1Q A;  2G38 B;  3WNW A;  3KA3 A;  4E6K A;  3GGZ A;  3PVY B;  2Z90 A;  4CVS A;  1BFR A;  3N6O A;  3LKD A;  5GU1 X;  3PWQ A;  4ZMC A;  4M34 A;  5FFB A;  5JKL G;  1S2Z A;  2BK6 A;  1JYB A;  2VXI A;  4CY9 A;  3FRS A;  1YUZ A;  5FFD A;  4DYX A;  1XZ3 A;  3E6R A;  3E1L A;  3GHQ A;  5ERK A;  1LKO A;  3Q4R A;  5GN8 A;  2ZA6 A;  5D8R A;  2FL0 A;  3ISE A;  5D8O A;  3IQ1 A;  4CYB A;  4ZTT A;  5LG8 A;  3UFB A;  2FG4 A;  1O9I A;  1BCF A;  3AF9 X; 
#chains in the Genus database with same CATH homology
 4ITT A;  3EZ0 A;  3HIU A;  1SOF A;  4RC6 A;  3R2S A;  4EVE A;  3C23 A;  4PG1 A;  5CMR A;  1VEI A;  4EVC A;  4RC7 B;  4DE6 A;  3NOZ X;  3BVI A;  4ZL6 A;  1GWG A;  4YXM A;  3WVU A;  2G4H A;  2ZG9 X;  3O7S A;  2V2I A;  3U90 A;  1MOJ A;  2RBD A;  5GU0 X;  3BVF A;  2HTN A;  3RGD A;  3FRR A;  3E1J A;  5CMQ A;  2XGW A;  1JI5 A;  1LKP A;  3C1Z A;  3KX9 A;  3BVE A;  5GU3 X;  3AJQ A;  4PGI A;  3PVR B;  4TOH A;  2CLB A;  3SH6 A;  3SE1 A;  2OH3 A;  3QHB A;  4YKH A;  4II4 A;  2V2L A;  2C2F A;  3KXU A;  3F35 A;  3AJP A;  1FHA A;  3EGM A;  1TJO A;  3PVT B;  2YW7 A;  2XJO A;  4TOB A;  3E1N A;  4OYN A;  5LG2 A;  5HU6 D;  4PGK A;  4KXR B;  3NP2 X;  5D8P A;  3L0M A;  4KVS A;  1KRQ A;  2OC5 A;  3ISF A;  3R2K A;  3KA8 A;  4EVD A;  3F36 A;  2GYD A;  2D5K A;  4QUW A;  2V2R A;  1OTK A;  3OJ5 A;  2JD6 0;  2IB0 A;  2CLU A;  2UX1 A;  1F30 A;  2V2O A;  4CMY A;  1S30 A;  3MPS A;  5JKL A;  3QVD A;  4CVR A;  3NP0 X;  1J30 A;  3SID A;  3KWO A;  2V8T A;  1QGH A;  2FG8 A;  4Y08 A;  2Y3Q A;  2V8U A;  4LYU A;  1JKV A;  2WLU A;  4CVP A;  1Z4A A;  2AR0 A;  1JGC A;  4ERU A;  4ZKH A;  3ERZ A;  1ZUJ A;  4XKU A;  1Z6O M;  3F38 A;  1JI4 A;  3E1M A;  3Q4O A;  3PW1 A;  1BG7 A;  2V2M A;  4TOE A;  2YJK A;  2Y44 A;  1HRS A;  3RBC A;  4RC7 A;  1XZ1 A;  3Q4N A;  4RC5 B;  3R2H A;  2C2J A;  4PG0 A;  5E1U A;  2ZG8 X;  3FSE A;  3F32 A;  2V2S A;  1O9R A;  3QB9 A;  2XJM A;  3IS7 A;  2ZA7 A;  2YW6 A;  2ITB A;  3PVR A;  2VZB A;  1MFR A;  1VEL A;  2Z5Q A;  2CHP A;  3E1O A;  3RAV A;  1VLG A;  2FHA A;  1TK6 A;  3JZA B;  1YUX A;  2HR5 A;  1H96 A;  5I4J A;  2CWL A;  3F34 A;  4M33 A;  1B71 A;  3KHK A;  1N1Q A;  2CN7 A;  3R2L A;  3UNO A;  1R03 A;  4U3G A;  4WJG 4;  4DZ0 A;  4AM4 A;  3PW8 C;  1DVB A;  3E1P A;  3QD8 A;  5GOU A;  2FKZ A;  4CVT A;  5GN8 B;  4EVB A;  2FFX J;  4MUD A;  2V2J A;  5D8Y A;  1ZS3 A;  5D8X A;  1UMN A;  3IS8 A;  3KDQ A;  2Z5R A;  3BT5 A;  3VV9 A;  1EUM A;  1JTS A;  3RE7 A;  1DPS A;  3PZA A;  4TOG A;  4DI0 A;  4ML5 A;  3PVY A;  4TOA A;  2CN6 A;  3A68 A;  5J8W A;  2F7N A;  3AJO A;  5C6F A;  1VJX A;  3GE4 A;  1LKM A;  3JZ9 A;  4IXK A;  3UOF A;  3PWQ C;  3KA6 A;  3T9J A;  1SQ3 A;  5ERJ A;  5JAC A;  4MY7 A;  3R2R A;  4TOC A;  4REU A;  2C2U A;  3RD0 A;  1YV1 A;  3QHC A;  3V3K B;  2FJC A;  5J93 A;  4YXJ A;  3H7G A;  4DYU A;  2C6R A;  2JD8 0;  3AK8 A;  5GU2 X;  4M35 A;  5LBH A;  4E40 A;  3QZ3 A;  4DYY A;  5K52 A;  3E6S A;  4ITW A;  1AEW A;  4X0J A;  4W4L B;  2WTL A;  1IES A;  4ISP A;  4KVR A;  1F33 A;  3AK9 A;  1RCI A;  1JRE A;  2VXX A;  2CF7 A;  2QQY A;  2YJJ A;  3KA9 A;  1NF6 A;  3WVV A;  4LPN A;  4AM5 A;  3F37 A;  5JKM G;  2V2N A;  2Z5P A;  4TOF A;  1NNQ A;  2V2P A;  4LYX A;  3AF7 X;  1QYB A;  4LQH A;  3O7R A;  2QF9 A;  5JDO B;  4TO9 A;  4TOD A;  1RCD A;  3VVA A;  3W54 A;  4CYA A;  3PVT A;  2W0O A;  5K53 A;  5FFE A;  1UVH A;  3BKN A;  3UOI A;  3F39 A;  4MJY A;  4DYZ A;  4M32 A;  2ZG7 X;  1NFV A;  4Z5S A;  3FI6 A;  4XKS A;  4ZKX A;  3PW1 B;  4IWK A;  1S3Q A;  1JIG A;  2BJY A;  2IU2 A;  5AXS A;  2X17 0;  4YVZ A;  4AM2 A;  3ES3 A;  4ISM A;  3DBY A;  5E2D A;  1L8H A;  5HJF A;  1RCC A;  3BVK A;  3HL1 A;  4A25 A;  2MGY A;  4TW3 A;  3F33 A;  3BVL A;  4MKU A;  5J9V A;  3R2M A;  2Z6M A;  1L8I A;  4XGS A;  4DAS A;  1NF4 A;  4MN9 A;  3GGY A;  4XKT A;  3TA8 A;  4RC8 A;  5LS9 A;  3KA4 A;  3FVB A;  2XJN A;  3R2O A;  2ZA8 A;  4RC6 B;  3E2C A;  2C41 A;  2FZF A;  3AF8 X;  1TKP A;  2CHI A;  3SHX A;  3C21 A;  1IER A;  4Z3B A;  2N02 A;  1RYT A;  5FEJ A;  4ZL5 A;  2JD7 0;  3C1Y A;  4LQJ A;  4R42 A;  2GYQ A;  3PW8 A;  1LB3 A;  2CEI A;  1DAT A;  3EZU A;  3OGH A;  4P18 A;  5FFC A;  4LQV A;  5D8S A;  4W4K B;  1TKO A;  2ZUR X;  5J8S A;  3A9Q A;  4RC5 A;  3VNX A;  1RCG A;  5CZU A;  4IWJ A;  2XKQ A;  4MXP A;  2GS4 A;  4CMY V;  2BW1 A;  4ZLW A;  4ETR A;  2WWX B;  2BKC A;  4ZKW A;  5HJH A;  5FFA A;  1RCE A;  4II4 B;  4LPJ A;  3GVY A;  2WLA A;  5D8Q A;  2IY4 A;  3D19 A;  3WVW A;  1VEQ A;  4LQN A;  2V15 A;  5HQO A;  4ZJK A;  2CIH A;  3M6J A;  4KVQ A;  5IX6 A;  3Q4Q A;  2PYB A;  3PWF A;  5JDO A;  2OKC A;  4LPM A;  5JKM A;  1Z6O A;  1JKU A;  3E1Q A;  2G38 B;  3WNW A;  3KA3 A;  4E6K A;  3GGZ A;  3PVY B;  2Z90 A;  4CVS A;  1BFR A;  3N6O A;  3LKD A;  5GU1 X;  3PWQ A;  4ZMC A;  4M34 A;  5FFB A;  5JKL G;  1S2Z A;  2BK6 A;  1JYB A;  2VXI A;  4CY9 A;  3FRS A;  1YUZ A;  5FFD A;  4DYX A;  1XZ3 A;  3E6R A;  3E1L A;  3GHQ A;  5ERK A;  1LKO A;  3Q4R A;  5GN8 A;  2ZA6 A;  5D8R A;  2FL0 A;  3ISE A;  5D8O A;  3IQ1 A;  4CYB A;  4ZTT A;  5LG8 A;  3UFB A;  2FG4 A;  1O9I A;  1BCF A;  3AF9 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...