3R2LA

1.85a resolution structure of iron soaked ftna from pseudomonas aeruginosa (ph 7.5)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
154
structure length
154
Chain Sequence
MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Bacterioferritin
publication title Two distinct ferritin-like molecules in Pseudomonas aeruginosa: the product of the bfrA gene is a bacterial ferritin (FtnA) and not a bacterioferritin (Bfr).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 75
structure length 154
sequence length 154
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3r2lA00
1IERA 4U3GA 4KVQA 2CHIA 3OJ5A 2IY4A 3RE7A 4ZMCA 2WLAA 2V15A 4ZKWA 1TKOA 3AK9A 2OH3A 4TOGA 4EVEA 3IS8A 2ZURX 2JD80 3NP0X 4Z5SA 1B71A 3ISFA 1L8IA 2VXIA 2QQYA 4TOEA 5J93A 1JIGA 2XJNA 4II4A 2IU2A 4TODA 5JKMA 5J8SA 5GN8A 2BW1A 2BJYA 4RC5A 4RC6B 4ZLWA 1SQ3A 2WLUA 2C2UA 4XKSA 4ZL6A 3E1MA 2BK6A 2V2SA 5FFEA 2ZG8X 3EGMA 1VELA 3PVTA 5D8YA 2XJMA 3E1LA 4DE6A 2BKCA 1JYBA 4TOAA 2V2IA 1BCFA 2V2OA 2YJKA 1MOJA 4TOBA 3GHQA 5D8SA 5FEJA 2C41A 1NFVA 4TOHA 3E1PA 4ISPA 2FHAA 1YUZA 2ZA7A 1RYTA 1JI4A 3EZUA 3SE1A 2Z90A 1N1QA 1LKMA 4REUA 3HIUA 1ZUJA 4ERUA 4KVRA 3U90A 3QD8A 1AEWA 3PVRA 3BVIA 4IWKA 1O9IA 4OYNA 3O7RA 1TK6A 3PW8C 3PWQA 3R2HA 2Z5RA 5LG8A 3A9QA 1DATA 3MPSA 5K52A 3WVVA 4CMYA 4ZKHA 3PW1A 4ITTA 1JKUA 1QYBA 2Z5QA 3AJOA 3F32A 4PG1A 2G4HA 1MFRA 3PVYB 1XZ3A 4EVBA 4II4B 3UNOA 3PWFA 4E6KA 2ITBA 5GN8B 4RC5B 2F7NA 2Z5PA 4EVDA 4LQJA 4AM5A 5GU3X 1Z6OA 4EVCA 4IXKA 3KA6A 4YKHA 4XKTA 1RCDA 3PVTB 5ERJA 1NF6A 4LYXA 1J30A 5CZUA 3WNWA 3QZ3A 2ZA6A 3KA3A 4XKUA 1BFRA 1FHAA 5ERKA 3PZAA 2Z6MA 2GYDA 2W0OA 2V2JA 1RCCA 4PG0A 4LPNA 1TKPA 4M32A 2VXXA 3AJPA 4AM2A 4ETRA 3F35A 3BVKA 5LS9A 3Q4NA 2X170 5D8RA 1LKPA 2V2LA 3PVRB 3FI6A 3EZ0A 3F39A 3VNXA 4DYUA 2WTLA 1RCIA 3ES3A 1NNQA 4KVSA 1JGCA 1EUMA 2FG8A 2IB0A 4LPJA 5D8OA 1OTKA 5E1UA 3IQ1A 3SHXA 4ZKXA 4PGIA 3PW1B 3RD0A 4LYUA 4DI0A 1GWGA 5JACA 2XKQA 3QB9A 1LKOA 4ZL5A 5LG2A 1VEIA 4CVTA 2CIHA 2Y3QA 5E2DA 2D5KA 2HR5A 3RAVA 4MJYA 4ZJKA 5FFCA 4MY7A 1BG7A 3A68A 2XJOA 5AXSA 3BVFA 4ML5A 2FL0A 4CY9A 1JTSA 3OGHA 3BVEA 3KWOA 5JKLG 3R2SA 4CVPA 4LPMA 3F33A 4A25A 3TA8A 3KX9A 2QF9A 1S30A 3ERZA 1RCEA 3E1NA 3AF8X 2YW7A 1S3QA 1S2ZA 2FFXJ 4TOCA 1JKVA 1HRSA 1YUXA 5D8XA 4Y08A 3AK8A 4RC6A 4CMYV 3R2KA 4RC7A 3IS7A 1F30A 3KA9A 2CHPA 4PGKA 2YJJA 4Z3BA 3KXUA 3F34A 1F33A 1UMNA 1KRQA 2C6RA 4DZ0A 2CN7A 2RBDA 4DASA 1JI5A 5D8PA 2FJCA 2ZA8A 3GVYA 3R2RA 4M34A 1R03A 5FFAA 2UX1A 5I4JA 2HTNA 3SIDA 5CMRA 4MN9A 2CEIA 3BVLA 1DPSA 4XGSA 3KA4A 4CVSA 5JKLA 4DYZA 5LBHA 1VJXA 2FZFA 3RGDA 1O9RA 3E1OA 4CVRA 3AF9X 4QUWA 4MKUA 3H7GA 4DYXA 3Q4RA 3FSEA 2V2PA 4TOFA 3QVDA 3PVYA 5GU0X 4M33A 1QGHA 1ZS3A 2V2MA 3PWQC 2CLBA 3NP2X 1L8HA 5CMQA 5C6FA 1SOFA 3QHCA 4RC8A 2V2NA 2FG4A 4RC7B 2FKZA 3E1QA 3F36A 2C2FA 4ITWA 3UOIA 5D8QA 1NF4A 5HJFA 4TW3A 5FFDA 4LQHA 4M35A 3GE4A 1UVHA 2V2RA 2ZG9X 4ZTTA 4LQNA 3O7SA 4TO9A 4MUDA 2PYBA 3KA8A 5GU2X 4IWJA 1RCGA 1Z6OM 2YW6A 3F38A 3R2MA 3ISEA 5HJHA 2OC5A 3E1JA 3E2CA 2XGWA 3AF7X 4R42A 3Q4OA 5FFBA 2JD70 5GOUA 4CYAA 5HQOA 1IESA 1XZ1A 5IX6A 1TJOA 1LB3A 3E6RA 3WVUA 1VEQA 2CN6A 4LQVA 5K53A 1JREA 2JD60 4ISMA 1Z4AA 5JKMG 3SH6A 1YV1A 2GS4A 3BT5A 4AM4A 3AJQA 3F37A 3Q4QA 3UOFA 2CLUA 5GU1X 3R2LA 4CYBA 3HL1A 3QHBA 4P18A 2C2JA 3T9JA 3WVWA 5J8WA 3R2OA 5J9VA 2GYQA 1VLGA 3BKNA 2CF7A 3E6SA 3RBCA 4DYYA 1H96A 3PW8A 3NOZX 2VZBA 3FVBA 2ZG7X 1DVBA
chains in the Genus database with same CATH superfamily
1IERA 4U3GA 4KVQA 3C23A 2CHIA 5JDOB 3OJ5A 2IY4A 3RE7A 4ZMCA 2WLAA 2V15A 4ZKWA 1TKOA 3AK9A 2OH3A 4TOGA 4EVEA 3IS8A 2ZURX 2JD80 3NP0X 4Z5SA 1B71A 3ISFA 1L8IA 2VXIA 3GGYA 2QQYA 3C1YA 4TOEA 5J93A 1JIGA 2XJNA 4II4A 2IU2A 4TODA 5JKMA 2G38B 3GGZA 5J8SA 5GN8A 2BW1A 2BJYA 4RC5A 4W4KB 4RC6B 4ZLWA 1SQ3A 2WLUA 2C2UA 4XKSA 4ZL6A 3E1MA 2BK6A 2V2SA 5FFEA 2ZG8X 3JZ9A 3C21A 3EGMA 1VELA 3PVTA 5D8YA 2XJMA 3E1LA 4DE6A 2BKCA 1JYBA 4TOAA 2V2IA 1BCFA 4MXPA 2V2OA 2YJKA 1MOJA 4TOBA 3GHQA 2N02A 5D8SA 5FEJA 2C41A 1NFVA 4TOHA 3E1PA 2MGYA 4ISPA 2FHAA 1YUZA 2ZA7A 1RYTA 3M6JA 1JI4A 4YVZA 3EZUA 3SE1A 2Z90A 1N1QA 1LKMA 4REUA 3HIUA 1ZUJA 4ERUA 4KVRA 3U90A 3QD8A 1AEWA 3PVRA 3BVIA 4IWKA 1O9IA 4OYNA 3VVAA 3O7RA 1TK6A 3PW8C 3PWQA 3R2HA 2Z5RA 5LG8A 3A9QA 1DATA 3MPSA 5K52A 3UFBA 3WVVA 4CMYA 4ZKHA 3PW1A 4ITTA 1JKUA 4WJG4 1QYBA 2Z5QA 3AJOA 3F32A 2V8UA 4PG1A 2G4HA 1MFRA 3PVYB 1XZ3A 4EVBA 4II4B 3UNOA 3PWFA 4E6KA 2ITBA 5GN8B 4RC5B 2F7NA 2Z5PA 4EVDA 4LQJA 4AM5A 5GU3X 1Z6OA 4EVCA 4IXKA 3KA6A 4YKHA 4XKTA 1RCDA 3KDQA 3PVTB 5ERJA 1NF6A 4LYXA 1J30A 5CZUA 3WNWA 4W4LB 2WWXB 3QZ3A 2ZA6A 3KA3A 4XKUA 4YXMA 1BFRA 1FHAA 5ERKA 3PZAA 2Z6MA 2GYDA 2W0OA 2V2JA 1RCCA 3W54A 4PG0A 4LPNA 1TKPA 4E40A 4X0JA 4M32A 2VXXA 3AJPA 4AM2A 4ETRA 3F35A 3BVKA 5LS9A 3Q4NA 2X170 5D8RA 1LKPA 2V2LA 3PVRB 3FI6A 3EZ0A 3F39A 3VNXA 4DYUA 2WTLA 1RCIA 3ES3A 1NNQA 4KVSA 1JGCA 1EUMA 2FG8A 2IB0A 4LPJA 5D8OA 1OTKA 5E1UA 3IQ1A 3SHXA 4ZKXA 4PGIA 3PW1B 3RD0A 3C1ZA 4LYUA 4DI0A 1GWGA 5JACA 2XKQA 3QB9A 1LKOA 4ZL5A 5LG2A 1VEIA 4CVTA 2CIHA 2Y3QA 5E2DA 2D5KA 2HR5A 3RAVA 3FRRA 4MJYA 4ZJKA 2AR0A 5FFCA 4MY7A 1BG7A 3A68A 2XJOA 3DBYA 5AXSA 3BVFA 4ML5A 2FL0A 4CY9A 1JTSA 3OGHA 3BVEA 3KWOA 5JKLG 3R2SA 4CVPA 4LPMA 3F33A 4A25A 3TA8A 3KX9A 3L0MA 2QF9A 1S30A 3ERZA 1RCEA 3E1NA 3AF8X 2YW7A 1S3QA 1S2ZA 2FFXJ 4TOCA 1JKVA 1HRSA 1YUXA 5D8XA 4Y08A 3AK8A 4RC6A 4CMYV 3R2KA 4RC7A 3IS7A 1F30A 3KA9A 2CHPA 4PGKA 2YJJA 4Z3BA 3KXUA 3F34A 2OKCA 1F33A 1UMNA 3FRSA 1KRQA 2C6RA 4DZ0A 2CN7A 2RBDA 4DASA 1JI5A 5D8PA 2FJCA 2ZA8A 3GVYA 3R2RA 4M34A 1R03A 5FFAA 2UX1A 5I4JA 2HTNA 3SIDA 5CMRA 4MN9A 2CEIA 3BVLA 1DPSA 4XGSA 3KA4A 4CVSA 5JKLA 4DYZA 5LBHA 1VJXA 2FZFA 3RGDA 1O9RA 3E1OA 4CVRA 3AF9X 4QUWA 4MKUA 3H7GA 4YXJA 4DYXA 3Q4RA 3FSEA 2V2PA 4TOFA 3QVDA 3PVYA 5GU0X 4M33A 5HU6D 1QGHA 1ZS3A 3N6OA 2V2MA 3PWQC 2CLBA 3NP2X 1L8HA 5CMQA 5C6FA 1SOFA 2V8TA 3QHCA 4RC8A 2V2NA 2FG4A 4RC7B 2FKZA 3E1QA 3F36A 3JZAB 2C2FA 4ITWA 3UOIA 5D8QA 1NF4A 5HJFA 4TW3A 5FFDA 4LQHA 4M35A 3GE4A 1UVHA 2V2RA 2ZG9X 4ZTTA 4LQNA 2Y44A 3LKDA 5JDOA 3O7SA 4TO9A 4MUDA 2PYBA 3KA8A 4KXRB 5GU2X 4IWJA 1RCGA 1Z6OM 2YW6A 3F38A 3R2MA 3ISEA 5HJHA 2OC5A 3E1JA 3E2CA 3V3KB 2XGWA 3D19A 3AF7X 4R42A 3Q4OA 5FFBA 2JD70 5GOUA 4CYAA 5HQOA 1IESA 3VV9A 1XZ1A 5IX6A 1TJOA 1LB3A 3E6RA 3WVUA 1VEQA 2CN6A 4LQVA 5K53A 1JREA 2JD60 3KHKA 4ISMA 1Z4AA 5JKMG 3SH6A 1YV1A 2GS4A 3BT5A 2CWLA 4AM4A 3AJQA 3F37A 3Q4QA 3UOFA 2CLUA 5GU1X 3R2LA 4CYBA 3HL1A 3QHBA 4P18A 2C2JA 3T9JA 3WVWA 5J8WA 3R2OA 5J9VA 2GYQA 1VLGA 3BKNA 2CF7A 3E6SA 3RBCA 4DYYA 1H96A 3PW8A 3NOZX 2VZBA 3FVBA 2ZG7X 1DVBA
chains in the Genus database with same CATH topology
1IERA 4U3GA 4KVQA 3C23A 2CHIA 5JDOB 3OJ5A 2IY4A 3RE7A 4ZMCA 2WLAA 2V15A 4ZKWA 1TKOA 3AK9A 2OH3A 4TOGA 4EVEA 3IS8A 2ZURX 2JD80 3NP0X 4Z5SA 1B71A 3ISFA 1L8IA 2VXIA 3GGYA 2QQYA 3C1YA 4TOEA 5J93A 1JIGA 2XJNA 4II4A 2IU2A 4TODA 5JKMA 2G38B 3GGZA 5J8SA 5GN8A 2BW1A 2BJYA 4RC5A 4W4KB 4RC6B 4ZLWA 1SQ3A 2WLUA 2C2UA 4XKSA 4ZL6A 3E1MA 2BK6A 2V2SA 5FFEA 2ZG8X 3JZ9A 3C21A 3EGMA 1VELA 3PVTA 5D8YA 2XJMA 3E1LA 4DE6A 2BKCA 1JYBA 4TOAA 2V2IA 1BCFA 4MXPA 2V2OA 2YJKA 1MOJA 4TOBA 3GHQA 2N02A 5D8SA 5FEJA 2C41A 1NFVA 4TOHA 3E1PA 2MGYA 4ISPA 2FHAA 1YUZA 2ZA7A 1RYTA 3M6JA 1JI4A 4YVZA 3EZUA 3SE1A 2Z90A 1N1QA 1LKMA 4REUA 3HIUA 1ZUJA 4ERUA 4KVRA 3U90A 3QD8A 1AEWA 3PVRA 3BVIA 4IWKA 1O9IA 4OYNA 3VVAA 3O7RA 1TK6A 3PW8C 3PWQA 3R2HA 2Z5RA 5LG8A 3A9QA 1DATA 3MPSA 5K52A 3UFBA 3WVVA 4CMYA 4ZKHA 3PW1A 4ITTA 1JKUA 4WJG4 1QYBA 2Z5QA 3AJOA 3F32A 2V8UA 4PG1A 2G4HA 1MFRA 3PVYB 1XZ3A 4EVBA 4II4B 3UNOA 3PWFA 4E6KA 2ITBA 5GN8B 4RC5B 2F7NA 2Z5PA 4EVDA 4LQJA 4AM5A 5GU3X 1Z6OA 4EVCA 4IXKA 3KA6A 4YKHA 4XKTA 1RCDA 3KDQA 3PVTB 5ERJA 1NF6A 4LYXA 1J30A 5CZUA 3WNWA 4W4LB 2WWXB 3QZ3A 2ZA6A 3KA3A 4XKUA 4YXMA 1BFRA 1FHAA 5ERKA 3PZAA 2Z6MA 2GYDA 2W0OA 2V2JA 1RCCA 3W54A 4PG0A 4LPNA 1TKPA 4E40A 4X0JA 4M32A 2VXXA 3AJPA 4AM2A 4ETRA 3F35A 3BVKA 5LS9A 3Q4NA 2X170 5D8RA 1LKPA 2V2LA 3PVRB 3FI6A 3EZ0A 3F39A 3VNXA 4DYUA 2WTLA 1RCIA 3ES3A 1NNQA 4KVSA 1JGCA 1EUMA 2FG8A 2IB0A 4LPJA 5D8OA 1OTKA 5E1UA 3IQ1A 3SHXA 4ZKXA 4PGIA 3PW1B 3RD0A 3C1ZA 4LYUA 4DI0A 1GWGA 5JACA 2XKQA 3QB9A 1LKOA 4ZL5A 5LG2A 1VEIA 4CVTA 2CIHA 2Y3QA 5E2DA 2D5KA 2HR5A 3RAVA 3FRRA 4MJYA 4ZJKA 2AR0A 5FFCA 4MY7A 1BG7A 3A68A 2XJOA 3DBYA 5AXSA 3BVFA 4ML5A 2FL0A 4CY9A 1JTSA 3OGHA 3BVEA 3KWOA 5JKLG 3R2SA 4CVPA 4LPMA 3F33A 4A25A 3TA8A 3KX9A 3L0MA 2QF9A 1S30A 3ERZA 1RCEA 3E1NA 3AF8X 2YW7A 1S3QA 1S2ZA 2FFXJ 4TOCA 1JKVA 1HRSA 1YUXA 5D8XA 4Y08A 3AK8A 4RC6A 4CMYV 3R2KA 4RC7A 3IS7A 1F30A 3KA9A 2CHPA 4PGKA 2YJJA 4Z3BA 3KXUA 3F34A 2OKCA 1F33A 1UMNA 3FRSA 1KRQA 2C6RA 4DZ0A 2CN7A 2RBDA 4DASA 1JI5A 5D8PA 2FJCA 2ZA8A 3GVYA 3R2RA 4M34A 1R03A 5FFAA 2UX1A 5I4JA 2HTNA 3SIDA 5CMRA 4MN9A 2CEIA 3BVLA 1DPSA 4XGSA 3KA4A 4CVSA 5JKLA 4DYZA 5LBHA 1VJXA 2FZFA 3RGDA 1O9RA 3E1OA 4CVRA 3AF9X 4QUWA 4MKUA 3H7GA 4YXJA 4DYXA 3Q4RA 3FSEA 2V2PA 4TOFA 3QVDA 3PVYA 5GU0X 4M33A 5HU6D 1QGHA 1ZS3A 3N6OA 2V2MA 3PWQC 2CLBA 3NP2X 1L8HA 5CMQA 5C6FA 1SOFA 2V8TA 3QHCA 4RC8A 2V2NA 2FG4A 4RC7B 2FKZA 3E1QA 3F36A 3JZAB 2C2FA 4ITWA 3UOIA 5D8QA 1NF4A 5HJFA 4TW3A 5FFDA 4LQHA 4M35A 3GE4A 1UVHA 2V2RA 2ZG9X 4ZTTA 4LQNA 2Y44A 3LKDA 5JDOA 3O7SA 4TO9A 4MUDA 2PYBA 3KA8A 4KXRB 5GU2X 4IWJA 1RCGA 1Z6OM 2YW6A 3F38A 3R2MA 3ISEA 5HJHA 2OC5A 3E1JA 3E2CA 3V3KB 2XGWA 3D19A 3AF7X 4R42A 3Q4OA 5FFBA 2JD70 5GOUA 4CYAA 5HQOA 1IESA 3VV9A 1XZ1A 5IX6A 1TJOA 1LB3A 3E6RA 3WVUA 1VEQA 2CN6A 4LQVA 5K53A 1JREA 2JD60 3KHKA 4ISMA 1Z4AA 5JKMG 3SH6A 1YV1A 2GS4A 3BT5A 2CWLA 4AM4A 3AJQA 3F37A 3Q4QA 3UOFA 2CLUA 5GU1X 3R2LA 4CYBA 3HL1A 3QHBA 4P18A 2C2JA 3T9JA 3WVWA 5J8WA 3R2OA 5J9VA 2GYQA 1VLGA 3BKNA 2CF7A 3E6SA 3RBCA 4DYYA 1H96A 3PW8A 3NOZX 2VZBA 3FVBA 2ZG7X 1DVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IER A;  4U3G A;  4KVQ A;  2CHI A;  3OJ5 A;  2IY4 A;  3RE7 A;  4ZMC A;  2WLA A;  2V15 A;  4ZKW A;  1TKO A;  3AK9 A;  2OH3 A;  4TOG A;  4EVE A;  3IS8 A;  2ZUR X;  2JD8 0;  3NP0 X;  4Z5S A;  1B71 A;  3ISF A;  1L8I A;  2VXI A;  2QQY A;  4TOE A;  5J93 A;  1JIG A;  2XJN A;  4II4 A;  2IU2 A;  4TOD A;  5JKM A;  5J8S A;  5GN8 A;  2BW1 A;  2BJY A;  4RC5 A;  4RC6 B;  4ZLW A;  1SQ3 A;  2WLU A;  2C2U A;  4XKS A;  4ZL6 A;  3E1M A;  2BK6 A;  2V2S A;  5FFE A;  2ZG8 X;  3EGM A;  1VEL A;  3PVT A;  5D8Y A;  2XJM A;  3E1L A;  4DE6 A;  2BKC A;  1JYB A;  4TOA A;  2V2I A;  1BCF A;  2V2O A;  2YJK A;  1MOJ A;  4TOB A;  3GHQ A;  5D8S A;  5FEJ A;  2C41 A;  1NFV A;  4TOH A;  3E1P A;  4ISP A;  2FHA A;  1YUZ A;  2ZA7 A;  1RYT A;  1JI4 A;  3EZU A;  3SE1 A;  2Z90 A;  1N1Q A;  1LKM A;  4REU A;  3HIU A;  1ZUJ A;  4ERU A;  4KVR A;  3U90 A;  3QD8 A;  1AEW A;  3PVR A;  3BVI A;  4IWK A;  1O9I A;  4OYN A;  3O7R A;  1TK6 A;  3PW8 C;  3PWQ A;  3R2H A;  2Z5R A;  5LG8 A;  3A9Q A;  1DAT A;  3MPS A;  5K52 A;  3WVV A;  4CMY A;  4ZKH A;  3PW1 A;  4ITT A;  1JKU A;  1QYB A;  2Z5Q A;  3AJO A;  3F32 A;  4PG1 A;  2G4H A;  1MFR A;  3PVY B;  1XZ3 A;  4EVB A;  4II4 B;  3UNO A;  3PWF A;  4E6K A;  2ITB A;  5GN8 B;  4RC5 B;  2F7N A;  2Z5P A;  4EVD A;  4LQJ A;  4AM5 A;  5GU3 X;  1Z6O A;  4EVC A;  4IXK A;  3KA6 A;  4YKH A;  4XKT A;  1RCD A;  3PVT B;  5ERJ A;  1NF6 A;  4LYX A;  1J30 A;  5CZU A;  3WNW A;  3QZ3 A;  2ZA6 A;  3KA3 A;  4XKU A;  1BFR A;  1FHA A;  5ERK A;  3PZA A;  2Z6M A;  2GYD A;  2W0O A;  2V2J A;  1RCC A;  4PG0 A;  4LPN A;  1TKP A;  4M32 A;  2VXX A;  3AJP A;  4AM2 A;  4ETR A;  3F35 A;  3BVK A;  5LS9 A;  3Q4N A;  2X17 0;  5D8R A;  1LKP A;  2V2L A;  3PVR B;  3FI6 A;  3EZ0 A;  3F39 A;  3VNX A;  4DYU A;  2WTL A;  1RCI A;  3ES3 A;  1NNQ A;  4KVS A;  1JGC A;  1EUM A;  2FG8 A;  2IB0 A;  4LPJ A;  5D8O A;  1OTK A;  5E1U A;  3IQ1 A;  3SHX A;  4ZKX A;  4PGI A;  3PW1 B;  3RD0 A;  4LYU A;  4DI0 A;  1GWG A;  5JAC A;  2XKQ A;  3QB9 A;  1LKO A;  4ZL5 A;  5LG2 A;  1VEI A;  4CVT A;  2CIH A;  2Y3Q A;  5E2D A;  2D5K A;  2HR5 A;  3RAV A;  4MJY A;  4ZJK A;  5FFC A;  4MY7 A;  1BG7 A;  3A68 A;  2XJO A;  5AXS A;  3BVF A;  4ML5 A;  2FL0 A;  4CY9 A;  1JTS A;  3OGH A;  3BVE A;  3KWO A;  5JKL G;  3R2S A;  4CVP A;  4LPM A;  3F33 A;  4A25 A;  3TA8 A;  3KX9 A;  2QF9 A;  1S30 A;  3ERZ A;  1RCE A;  3E1N A;  3AF8 X;  2YW7 A;  1S3Q A;  1S2Z A;  2FFX J;  4TOC A;  1JKV A;  1HRS A;  1YUX A;  5D8X A;  4Y08 A;  3AK8 A;  4RC6 A;  4CMY V;  3R2K A;  4RC7 A;  3IS7 A;  1F30 A;  3KA9 A;  2CHP A;  4PGK A;  2YJJ A;  4Z3B A;  3KXU A;  3F34 A;  1F33 A;  1UMN A;  1KRQ A;  2C6R A;  4DZ0 A;  2CN7 A;  2RBD A;  4DAS A;  1JI5 A;  5D8P A;  2FJC A;  2ZA8 A;  3GVY A;  3R2R A;  4M34 A;  1R03 A;  5FFA A;  2UX1 A;  5I4J A;  2HTN A;  3SID A;  5CMR A;  4MN9 A;  2CEI A;  3BVL A;  1DPS A;  4XGS A;  3KA4 A;  4CVS A;  5JKL A;  4DYZ A;  5LBH A;  1VJX A;  2FZF A;  3RGD A;  1O9R A;  3E1O A;  4CVR A;  3AF9 X;  4QUW A;  4MKU A;  3H7G A;  4DYX A;  3Q4R A;  3FSE A;  2V2P A;  4TOF A;  3QVD A;  3PVY A;  5GU0 X;  4M33 A;  1QGH A;  1ZS3 A;  2V2M A;  3PWQ C;  2CLB A;  3NP2 X;  1L8H A;  5CMQ A;  5C6F A;  1SOF A;  3QHC A;  4RC8 A;  2V2N A;  2FG4 A;  4RC7 B;  2FKZ A;  3E1Q A;  3F36 A;  2C2F A;  4ITW A;  3UOI A;  5D8Q A;  1NF4 A;  5HJF A;  4TW3 A;  5FFD A;  4LQH A;  4M35 A;  3GE4 A;  1UVH A;  2V2R A;  2ZG9 X;  4ZTT A;  4LQN A;  3O7S A;  4TO9 A;  4MUD A;  2PYB A;  3KA8 A;  5GU2 X;  4IWJ A;  1RCG A;  1Z6O M;  2YW6 A;  3F38 A;  3R2M A;  3ISE A;  5HJH A;  2OC5 A;  3E1J A;  3E2C A;  2XGW A;  3AF7 X;  4R42 A;  3Q4O A;  5FFB A;  2JD7 0;  5GOU A;  4CYA A;  5HQO A;  1IES A;  1XZ1 A;  5IX6 A;  1TJO A;  1LB3 A;  3E6R A;  3WVU A;  1VEQ A;  2CN6 A;  4LQV A;  5K53 A;  1JRE A;  2JD6 0;  4ISM A;  1Z4A A;  5JKM G;  3SH6 A;  1YV1 A;  2GS4 A;  3BT5 A;  4AM4 A;  3AJQ A;  3F37 A;  3Q4Q A;  3UOF A;  2CLU A;  5GU1 X;  3R2L A;  4CYB A;  3HL1 A;  3QHB A;  4P18 A;  2C2J A;  3T9J A;  3WVW A;  5J8W A;  3R2O A;  5J9V A;  2GYQ A;  1VLG A;  3BKN A;  2CF7 A;  3E6S A;  3RBC A;  4DYY A;  1H96 A;  3PW8 A;  3NOZ X;  2VZB A;  3FVB A;  2ZG7 X;  1DVB A; 
#chains in the Genus database with same CATH topology
 1IER A;  4U3G A;  4KVQ A;  3C23 A;  2CHI A;  5JDO B;  3OJ5 A;  2IY4 A;  3RE7 A;  4ZMC A;  2WLA A;  2V15 A;  4ZKW A;  1TKO A;  3AK9 A;  2OH3 A;  4TOG A;  4EVE A;  3IS8 A;  2ZUR X;  2JD8 0;  3NP0 X;  4Z5S A;  1B71 A;  3ISF A;  1L8I A;  2VXI A;  3GGY A;  2QQY A;  3C1Y A;  4TOE A;  5J93 A;  1JIG A;  2XJN A;  4II4 A;  2IU2 A;  4TOD A;  5JKM A;  2G38 B;  3GGZ A;  5J8S A;  5GN8 A;  2BW1 A;  2BJY A;  4RC5 A;  4W4K B;  4RC6 B;  4ZLW A;  1SQ3 A;  2WLU A;  2C2U A;  4XKS A;  4ZL6 A;  3E1M A;  2BK6 A;  2V2S A;  5FFE A;  2ZG8 X;  3JZ9 A;  3C21 A;  3EGM A;  1VEL A;  3PVT A;  5D8Y A;  2XJM A;  3E1L A;  4DE6 A;  2BKC A;  1JYB A;  4TOA A;  2V2I A;  1BCF A;  4MXP A;  2V2O A;  2YJK A;  1MOJ A;  4TOB A;  3GHQ A;  2N02 A;  5D8S A;  5FEJ A;  2C41 A;  1NFV A;  4TOH A;  3E1P A;  2MGY A;  4ISP A;  2FHA A;  1YUZ A;  2ZA7 A;  1RYT A;  3M6J A;  1JI4 A;  4YVZ A;  3EZU A;  3SE1 A;  2Z90 A;  1N1Q A;  1LKM A;  4REU A;  3HIU A;  1ZUJ A;  4ERU A;  4KVR A;  3U90 A;  3QD8 A;  1AEW A;  3PVR A;  3BVI A;  4IWK A;  1O9I A;  4OYN A;  3VVA A;  3O7R A;  1TK6 A;  3PW8 C;  3PWQ A;  3R2H A;  2Z5R A;  5LG8 A;  3A9Q A;  1DAT A;  3MPS A;  5K52 A;  3UFB A;  3WVV A;  4CMY A;  4ZKH A;  3PW1 A;  4ITT A;  1JKU A;  4WJG 4;  1QYB A;  2Z5Q A;  3AJO A;  3F32 A;  2V8U A;  4PG1 A;  2G4H A;  1MFR A;  3PVY B;  1XZ3 A;  4EVB A;  4II4 B;  3UNO A;  3PWF A;  4E6K A;  2ITB A;  5GN8 B;  4RC5 B;  2F7N A;  2Z5P A;  4EVD A;  4LQJ A;  4AM5 A;  5GU3 X;  1Z6O A;  4EVC A;  4IXK A;  3KA6 A;  4YKH A;  4XKT A;  1RCD A;  3KDQ A;  3PVT B;  5ERJ A;  1NF6 A;  4LYX A;  1J30 A;  5CZU A;  3WNW A;  4W4L B;  2WWX B;  3QZ3 A;  2ZA6 A;  3KA3 A;  4XKU A;  4YXM A;  1BFR A;  1FHA A;  5ERK A;  3PZA A;  2Z6M A;  2GYD A;  2W0O A;  2V2J A;  1RCC A;  3W54 A;  4PG0 A;  4LPN A;  1TKP A;  4E40 A;  4X0J A;  4M32 A;  2VXX A;  3AJP A;  4AM2 A;  4ETR A;  3F35 A;  3BVK A;  5LS9 A;  3Q4N A;  2X17 0;  5D8R A;  1LKP A;  2V2L A;  3PVR B;  3FI6 A;  3EZ0 A;  3F39 A;  3VNX A;  4DYU A;  2WTL A;  1RCI A;  3ES3 A;  1NNQ A;  4KVS A;  1JGC A;  1EUM A;  2FG8 A;  2IB0 A;  4LPJ A;  5D8O A;  1OTK A;  5E1U A;  3IQ1 A;  3SHX A;  4ZKX A;  4PGI A;  3PW1 B;  3RD0 A;  3C1Z A;  4LYU A;  4DI0 A;  1GWG A;  5JAC A;  2XKQ A;  3QB9 A;  1LKO A;  4ZL5 A;  5LG2 A;  1VEI A;  4CVT A;  2CIH A;  2Y3Q A;  5E2D A;  2D5K A;  2HR5 A;  3RAV A;  3FRR A;  4MJY A;  4ZJK A;  2AR0 A;  5FFC A;  4MY7 A;  1BG7 A;  3A68 A;  2XJO A;  3DBY A;  5AXS A;  3BVF A;  4ML5 A;  2FL0 A;  4CY9 A;  1JTS A;  3OGH A;  3BVE A;  3KWO A;  5JKL G;  3R2S A;  4CVP A;  4LPM A;  3F33 A;  4A25 A;  3TA8 A;  3KX9 A;  3L0M A;  2QF9 A;  1S30 A;  3ERZ A;  1RCE A;  3E1N A;  3AF8 X;  2YW7 A;  1S3Q A;  1S2Z A;  2FFX J;  4TOC A;  1JKV A;  1HRS A;  1YUX A;  5D8X A;  4Y08 A;  3AK8 A;  4RC6 A;  4CMY V;  3R2K A;  4RC7 A;  3IS7 A;  1F30 A;  3KA9 A;  2CHP A;  4PGK A;  2YJJ A;  4Z3B A;  3KXU A;  3F34 A;  2OKC A;  1F33 A;  1UMN A;  3FRS A;  1KRQ A;  2C6R A;  4DZ0 A;  2CN7 A;  2RBD A;  4DAS A;  1JI5 A;  5D8P A;  2FJC A;  2ZA8 A;  3GVY A;  3R2R A;  4M34 A;  1R03 A;  5FFA A;  2UX1 A;  5I4J A;  2HTN A;  3SID A;  5CMR A;  4MN9 A;  2CEI A;  3BVL A;  1DPS A;  4XGS A;  3KA4 A;  4CVS A;  5JKL A;  4DYZ A;  5LBH A;  1VJX A;  2FZF A;  3RGD A;  1O9R A;  3E1O A;  4CVR A;  3AF9 X;  4QUW A;  4MKU A;  3H7G A;  4YXJ A;  4DYX A;  3Q4R A;  3FSE A;  2V2P A;  4TOF A;  3QVD A;  3PVY A;  5GU0 X;  4M33 A;  5HU6 D;  1QGH A;  1ZS3 A;  3N6O A;  2V2M A;  3PWQ C;  2CLB A;  3NP2 X;  1L8H A;  5CMQ A;  5C6F A;  1SOF A;  2V8T A;  3QHC A;  4RC8 A;  2V2N A;  2FG4 A;  4RC7 B;  2FKZ A;  3E1Q A;  3F36 A;  3JZA B;  2C2F A;  4ITW A;  3UOI A;  5D8Q A;  1NF4 A;  5HJF A;  4TW3 A;  5FFD A;  4LQH A;  4M35 A;  3GE4 A;  1UVH A;  2V2R A;  2ZG9 X;  4ZTT A;  4LQN A;  2Y44 A;  3LKD A;  5JDO A;  3O7S A;  4TO9 A;  4MUD A;  2PYB A;  3KA8 A;  4KXR B;  5GU2 X;  4IWJ A;  1RCG A;  1Z6O M;  2YW6 A;  3F38 A;  3R2M A;  3ISE A;  5HJH A;  2OC5 A;  3E1J A;  3E2C A;  3V3K B;  2XGW A;  3D19 A;  3AF7 X;  4R42 A;  3Q4O A;  5FFB A;  2JD7 0;  5GOU A;  4CYA A;  5HQO A;  1IES A;  3VV9 A;  1XZ1 A;  5IX6 A;  1TJO A;  1LB3 A;  3E6R A;  3WVU A;  1VEQ A;  2CN6 A;  4LQV A;  5K53 A;  1JRE A;  2JD6 0;  3KHK A;  4ISM A;  1Z4A A;  5JKM G;  3SH6 A;  1YV1 A;  2GS4 A;  3BT5 A;  2CWL A;  4AM4 A;  3AJQ A;  3F37 A;  3Q4Q A;  3UOF A;  2CLU A;  5GU1 X;  3R2L A;  4CYB A;  3HL1 A;  3QHB A;  4P18 A;  2C2J A;  3T9J A;  3WVW A;  5J8W A;  3R2O A;  5J9V A;  2GYQ A;  1VLG A;  3BKN A;  2CF7 A;  3E6S A;  3RBC A;  4DYY A;  1H96 A;  3PW8 A;  3NOZ X;  2VZB A;  3FVB A;  2ZG7 X;  1DVB A; 
#chains in the Genus database with same CATH homology
 1IER A;  4U3G A;  4KVQ A;  3C23 A;  2CHI A;  5JDO B;  3OJ5 A;  2IY4 A;  3RE7 A;  4ZMC A;  2WLA A;  2V15 A;  4ZKW A;  1TKO A;  3AK9 A;  2OH3 A;  4TOG A;  4EVE A;  3IS8 A;  2ZUR X;  2JD8 0;  3NP0 X;  4Z5S A;  1B71 A;  3ISF A;  1L8I A;  2VXI A;  3GGY A;  2QQY A;  3C1Y A;  4TOE A;  5J93 A;  1JIG A;  2XJN A;  4II4 A;  2IU2 A;  4TOD A;  5JKM A;  2G38 B;  3GGZ A;  5J8S A;  5GN8 A;  2BW1 A;  2BJY A;  4RC5 A;  4W4K B;  4RC6 B;  4ZLW A;  1SQ3 A;  2WLU A;  2C2U A;  4XKS A;  4ZL6 A;  3E1M A;  2BK6 A;  2V2S A;  5FFE A;  2ZG8 X;  3JZ9 A;  3C21 A;  3EGM A;  1VEL A;  3PVT A;  5D8Y A;  2XJM A;  3E1L A;  4DE6 A;  2BKC A;  1JYB A;  4TOA A;  2V2I A;  1BCF A;  4MXP A;  2V2O A;  2YJK A;  1MOJ A;  4TOB A;  3GHQ A;  2N02 A;  5D8S A;  5FEJ A;  2C41 A;  1NFV A;  4TOH A;  3E1P A;  2MGY A;  4ISP A;  2FHA A;  1YUZ A;  2ZA7 A;  1RYT A;  3M6J A;  1JI4 A;  4YVZ A;  3EZU A;  3SE1 A;  2Z90 A;  1N1Q A;  1LKM A;  4REU A;  3HIU A;  1ZUJ A;  4ERU A;  4KVR A;  3U90 A;  3QD8 A;  1AEW A;  3PVR A;  3BVI A;  4IWK A;  1O9I A;  4OYN A;  3VVA A;  3O7R A;  1TK6 A;  3PW8 C;  3PWQ A;  3R2H A;  2Z5R A;  5LG8 A;  3A9Q A;  1DAT A;  3MPS A;  5K52 A;  3UFB A;  3WVV A;  4CMY A;  4ZKH A;  3PW1 A;  4ITT A;  1JKU A;  4WJG 4;  1QYB A;  2Z5Q A;  3AJO A;  3F32 A;  2V8U A;  4PG1 A;  2G4H A;  1MFR A;  3PVY B;  1XZ3 A;  4EVB A;  4II4 B;  3UNO A;  3PWF A;  4E6K A;  2ITB A;  5GN8 B;  4RC5 B;  2F7N A;  2Z5P A;  4EVD A;  4LQJ A;  4AM5 A;  5GU3 X;  1Z6O A;  4EVC A;  4IXK A;  3KA6 A;  4YKH A;  4XKT A;  1RCD A;  3KDQ A;  3PVT B;  5ERJ A;  1NF6 A;  4LYX A;  1J30 A;  5CZU A;  3WNW A;  4W4L B;  2WWX B;  3QZ3 A;  2ZA6 A;  3KA3 A;  4XKU A;  4YXM A;  1BFR A;  1FHA A;  5ERK A;  3PZA A;  2Z6M A;  2GYD A;  2W0O A;  2V2J A;  1RCC A;  3W54 A;  4PG0 A;  4LPN A;  1TKP A;  4E40 A;  4X0J A;  4M32 A;  2VXX A;  3AJP A;  4AM2 A;  4ETR A;  3F35 A;  3BVK A;  5LS9 A;  3Q4N A;  2X17 0;  5D8R A;  1LKP A;  2V2L A;  3PVR B;  3FI6 A;  3EZ0 A;  3F39 A;  3VNX A;  4DYU A;  2WTL A;  1RCI A;  3ES3 A;  1NNQ A;  4KVS A;  1JGC A;  1EUM A;  2FG8 A;  2IB0 A;  4LPJ A;  5D8O A;  1OTK A;  5E1U A;  3IQ1 A;  3SHX A;  4ZKX A;  4PGI A;  3PW1 B;  3RD0 A;  3C1Z A;  4LYU A;  4DI0 A;  1GWG A;  5JAC A;  2XKQ A;  3QB9 A;  1LKO A;  4ZL5 A;  5LG2 A;  1VEI A;  4CVT A;  2CIH A;  2Y3Q A;  5E2D A;  2D5K A;  2HR5 A;  3RAV A;  3FRR A;  4MJY A;  4ZJK A;  2AR0 A;  5FFC A;  4MY7 A;  1BG7 A;  3A68 A;  2XJO A;  3DBY A;  5AXS A;  3BVF A;  4ML5 A;  2FL0 A;  4CY9 A;  1JTS A;  3OGH A;  3BVE A;  3KWO A;  5JKL G;  3R2S A;  4CVP A;  4LPM A;  3F33 A;  4A25 A;  3TA8 A;  3KX9 A;  3L0M A;  2QF9 A;  1S30 A;  3ERZ A;  1RCE A;  3E1N A;  3AF8 X;  2YW7 A;  1S3Q A;  1S2Z A;  2FFX J;  4TOC A;  1JKV A;  1HRS A;  1YUX A;  5D8X A;  4Y08 A;  3AK8 A;  4RC6 A;  4CMY V;  3R2K A;  4RC7 A;  3IS7 A;  1F30 A;  3KA9 A;  2CHP A;  4PGK A;  2YJJ A;  4Z3B A;  3KXU A;  3F34 A;  2OKC A;  1F33 A;  1UMN A;  3FRS A;  1KRQ A;  2C6R A;  4DZ0 A;  2CN7 A;  2RBD A;  4DAS A;  1JI5 A;  5D8P A;  2FJC A;  2ZA8 A;  3GVY A;  3R2R A;  4M34 A;  1R03 A;  5FFA A;  2UX1 A;  5I4J A;  2HTN A;  3SID A;  5CMR A;  4MN9 A;  2CEI A;  3BVL A;  1DPS A;  4XGS A;  3KA4 A;  4CVS A;  5JKL A;  4DYZ A;  5LBH A;  1VJX A;  2FZF A;  3RGD A;  1O9R A;  3E1O A;  4CVR A;  3AF9 X;  4QUW A;  4MKU A;  3H7G A;  4YXJ A;  4DYX A;  3Q4R A;  3FSE A;  2V2P A;  4TOF A;  3QVD A;  3PVY A;  5GU0 X;  4M33 A;  5HU6 D;  1QGH A;  1ZS3 A;  3N6O A;  2V2M A;  3PWQ C;  2CLB A;  3NP2 X;  1L8H A;  5CMQ A;  5C6F A;  1SOF A;  2V8T A;  3QHC A;  4RC8 A;  2V2N A;  2FG4 A;  4RC7 B;  2FKZ A;  3E1Q A;  3F36 A;  3JZA B;  2C2F A;  4ITW A;  3UOI A;  5D8Q A;  1NF4 A;  5HJF A;  4TW3 A;  5FFD A;  4LQH A;  4M35 A;  3GE4 A;  1UVH A;  2V2R A;  2ZG9 X;  4ZTT A;  4LQN A;  2Y44 A;  3LKD A;  5JDO A;  3O7S A;  4TO9 A;  4MUD A;  2PYB A;  3KA8 A;  4KXR B;  5GU2 X;  4IWJ A;  1RCG A;  1Z6O M;  2YW6 A;  3F38 A;  3R2M A;  3ISE A;  5HJH A;  2OC5 A;  3E1J A;  3E2C A;  3V3K B;  2XGW A;  3D19 A;  3AF7 X;  4R42 A;  3Q4O A;  5FFB A;  2JD7 0;  5GOU A;  4CYA A;  5HQO A;  1IES A;  3VV9 A;  1XZ1 A;  5IX6 A;  1TJO A;  1LB3 A;  3E6R A;  3WVU A;  1VEQ A;  2CN6 A;  4LQV A;  5K53 A;  1JRE A;  2JD6 0;  3KHK A;  4ISM A;  1Z4A A;  5JKM G;  3SH6 A;  1YV1 A;  2GS4 A;  3BT5 A;  2CWL A;  4AM4 A;  3AJQ A;  3F37 A;  3Q4Q A;  3UOF A;  2CLU A;  5GU1 X;  3R2L A;  4CYB A;  3HL1 A;  3QHB A;  4P18 A;  2C2J A;  3T9J A;  3WVW A;  5J8W A;  3R2O A;  5J9V A;  2GYQ A;  1VLG A;  3BKN A;  2CF7 A;  3E6S A;  3RBC A;  4DYY A;  1H96 A;  3PW8 A;  3NOZ X;  2VZB A;  3FVB A;  2ZG7 X;  1DVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...