3Q4QA

Crystal structure of a deletion mutant(11-185) of hypothetical protein mj0754 with mn2+
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
169
structure length
169
Chain Sequence
PISEEEKEGLIEMREEEKLARDVYLTLYNKWKLQIFKNIAESEQTHMDAVKYLLEKYNIPDPVKNDSIGVFSNPKFEELYKKLVEKGDKSEVDALKVGATIEDLDIADLEKWINKTDNEDIKFVYENLMKGSRNHMRAFVRMLNNYGSNYTPQYISKEEYEEIISSSTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein MJ0754
publication title Structural insights into the metal binding properties of hypothetical protein MJ0754 from Methanococcus jannaschii DSM 2661
doi rcsb
source organism Methanocaldococcus jannaschii
total genus 73
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2010-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09968 DUF2202 Uncharacterized protein domain (DUF2202)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3q4qA00
5JKMA 2QF9A 3R2LA 3SE1A 1S3QA 3GE4A 4EVEA 5CMQA 3RGDA 1NF4A 3OJ5A 2XKQA 5FFAA 2V2IA 2CHPA 1EUMA 2GYDA 1QYBA 1H96A 2ZG9X 4RC8A 2XGWA 4LPNA 1ZS3A 1N1QA 1LB3A 1NF6A 1FHAA 1JI4A 2BK6A 5D8QA 4DYUA 1Z6OA 2V2JA 5E2DA 5IX6A 2FG4A 2CHIA 1VELA 1NFVA 1MOJA 2WLAA 1RYTA 2IU2A 3PVYB 3KA3A 3Q4NA 4EVDA 2Z90A 3E1PA 4MKUA 1RCIA 3PW1B 1F30A 3QHCA 3WVUA 3QVDA 2JD60 3PW1A 4XKSA 5FFCA 2FG8A 3NP2X 5FFDA 1J30A 4DZ0A 5CMRA 3F36A 2ZURX 3U90A 3UOFA 1TJOA 3IS8A 5HQOA 4ZLWA 2C41A 3EZ0A 2RBDA 2ZA8A 4EVCA 2G4HA 4DI0A 4R42A 3BKNA 4M32A 3E1NA 1L8IA 5J8SA 4ZMCA 5FFBA 4QUWA 5JKLG 3Q4RA 4TO9A 1VEQA 2V2RA 4CVSA 3KWOA 2V2OA 3VNXA 2WLUA 2CF7A 4PG1A 1JIGA 3BVIA 3PWFA 4CYAA 5LBHA 3R2MA 2WTLA 3ES3A 3SHXA 5D8XA 4MJYA 4TOEA 4PGIA 1JREA 2FFXJ 1LKOA 1UMNA 2ZA6A 3FSEA 2V2LA 5JACA 4ITTA 1RCGA 5HJHA 4CMYV 1JTSA 3E6RA 2VZBA 3QZ3A 3RE7A 4LPMA 3HL1A 3E1JA 4DYXA 4TOAA 1BCFA 2C6RA 2HTNA 3EZUA 3KA4A 1TKOA 4LYXA 2PYBA 2FZFA 4II4B 1IESA 3RAVA 3QHBA 2YJKA 3BVKA 4II4A 1KRQA 4IWJA 4ISPA 4PG0A 1SOFA 1TK6A 2V15A 5K53A 1JI5A 3O7SA 3UOIA 3A9QA 2CN7A 3R2RA 3PW8A 3KA8A 1BG7A 2FHAA 4M35A 3KX9A 4XKUA 3ISEA 5GU0X 5AXSA 3PVRB 4CMYA 3E1MA 1JKVA 2FJCA 3FVBA 3PWQA 3PVRA 3F34A 3TA8A 3AF7X 4KVRA 3E1OA 1LKPA 1DVBA 1TKPA 4ZL6A 4DYYA 1LKMA 2BKCA 2XJOA 3QB9A 2OC5A 3MPSA 2XJNA 1DATA 2IB0A 4RC5A 4Z5SA 3ISFA 1GWGA 4RC6B 3ERZA 1YV1A 3BVLA 1JKUA 4ML5A 4RC6A 2IY4A 4REUA 2V2NA 3WNWA 2ITBA 3PW8C 3F33A 5D8RA 4A25A 4CY9A 1ZUJA 2UX1A 3AK9A 4MUDA 2V2PA 2GYQA 4KVSA 2CIHA 2V2MA 3IS7A 1Z6OM 3F32A 4LQHA 3Q4OA 3PVTA 3AK8A 3PWQC 4CYBA 4TOGA 3NOZX 1DPSA 4TOCA 4LQJA 2ZG7X 3UNOA 4OYNA 3KA6A 5JKMG 4TODA 1VEIA 3AJQA 3E1QA 3RBCA 2JD80 3PZAA 1HRSA 1YUXA 3KA9A 1RCDA 4ZL5A 4IXKA 3Q4QA 3SIDA 1RCCA 4M34A 4CVRA 2FL0A 5ERJA 2C2UA 4CVPA 2JD70 1OTKA 3GHQA 5LG8A 3NP0X 5D8SA 3EGMA 3HIUA 4ITWA 5ERKA 2QQYA 5GU2X 4RC7B 5D8OA 4U3GA 1AEWA 1IERA 3R2KA 4MN9A 3BT5A 2XJMA 4ERUA 5J8WA 4RC7A 1O9RA 4DE6A 5GU3X 5GN8B 1XZ3A 4MY7A 3AF8X 1JGCA 5GN8A 4AM4A 4LQVA 2CN6A 1O9IA 1RCEA 1B71A 4ZTTA 1Z4AA 1NNQA 2Z5PA 1S30A 3E1LA 2X170 2BJYA 2C2JA 3BVFA 3KXUA 4ETRA 4ZKWA 1UVHA 2C2FA 3T9JA 5GOUA 4XGSA 4CVTA 2CEIA 2OH3A 3WVVA 2CLBA 2GS4A 4Z3BA 5K52A 3GVYA 5GU1X 2D5KA 4LPJA 5D8YA 2F7NA 3R2SA 5HJFA 2V2SA 3WVWA 4XKTA 5J9VA 1XZ1A 4KVQA 3RD0A 5LS9A 4E6KA 4IWKA 4M33A 4RC5B 4LYUA 3IQ1A 3F38A 3PVYA 2FKZA 5I4JA 2YW6A 5CZUA 3A68A 3OGHA 4ZKXA 2ZA7A 4TOHA 3F35A 4AM2A 4ZKHA 2YW7A 3R2HA 2HR5A 2W0OA 1SQ3A 4Y08A 3O7RA 1QGHA 2CLUA 3E6SA 3FI6A 5J93A 3PVTB 2YJJA 4YKHA 2ZG8X 4DYZA 4PGKA 4TOBA 3BVEA 3SH6A 1MFRA 2Z6MA 5D8PA 5LG2A 5FEJA 5FFEA 3AF9X 2VXIA 3E2CA 3F37A 5E1UA 2BW1A 5JKLA 4TOFA 4DASA 4EVBA 3F39A 3H7GA 4ZJKA 4LQNA 3R2OA 4AM5A 3AJPA 1VLGA 1VJXA 1JYBA 2Y3QA 3AJOA 2Z5QA 2Z5RA 4TW3A 1L8HA 1BFRA 5C6FA 4P18A 3QD8A 1S2ZA 2VXXA 1YUZA 1F33A 1R03A 4ISMA
chains in the Genus database with same CATH superfamily
5JKMA 2QF9A 3R2LA 3SE1A 3V3KB 1S3QA 3GE4A 4EVEA 5CMQA 3RGDA 2G38B 1NF4A 3OJ5A 2XKQA 5FFAA 2V2IA 2CHPA 1EUMA 2GYDA 3FRRA 4W4KB 1QYBA 1H96A 2ZG9X 4RC8A 2XGWA 4LPNA 3FRSA 4YVZA 1ZS3A 1N1QA 3LKDA 1LB3A 4YXMA 1NF6A 1FHAA 3UFBA 1JI4A 2BK6A 5D8QA 4DYUA 1Z6OA 2V2JA 5E2DA 5IX6A 2FG4A 2CHIA 1VELA 2V8TA 1NFVA 1MOJA 2WLAA 1RYTA 2IU2A 3PVYB 3KA3A 3Q4NA 4EVDA 2Z90A 3E1PA 4MKUA 2OKCA 1RCIA 3PW1B 1F30A 3QHCA 3WVUA 3QVDA 2JD60 3PW1A 4XKSA 5FFCA 2FG8A 3NP2X 5FFDA 1J30A 4DZ0A 5CMRA 3F36A 2ZURX 3U90A 3UOFA 1TJOA 3IS8A 5HQOA 4ZLWA 2C41A 3EZ0A 2RBDA 2ZA8A 4EVCA 2G4HA 4DI0A 4R42A 3BKNA 4M32A 3E1NA 1L8IA 5J8SA 4ZMCA 5FFBA 3VV9A 4QUWA 5JKLG 3Q4RA 4TO9A 1VEQA 2V2RA 4CVSA 3KWOA 3KHKA 2V2OA 3VNXA 2WLUA 2CF7A 4PG1A 1JIGA 3BVIA 3PWFA 4CYAA 4WJG4 5LBHA 3R2MA 2WTLA 3ES3A 3SHXA 5D8XA 5JDOB 4MJYA 3M6JA 4TOEA 4PGIA 5JDOA 4MXPA 1JREA 2FFXJ 1LKOA 3N6OA 1UMNA 2ZA6A 3FSEA 2V2LA 5JACA 4ITTA 1RCGA 5HJHA 4CMYV 1JTSA 3E6RA 2VZBA 3QZ3A 3RE7A 4LPMA 3HL1A 3E1JA 4DYXA 4TOAA 1BCFA 3DBYA 2C6RA 2HTNA 3EZUA 3KA4A 2WWXB 1TKOA 4LYXA 4YXJA 2PYBA 2V8UA 5HU6D 2FZFA 4II4B 1IESA 3RAVA 3QHBA 2YJKA 3BVKA 4II4A 1KRQA 4IWJA 4ISPA 4PG0A 1SOFA 1TK6A 2V15A 5K53A 1JI5A 4X0JA 3O7SA 3UOIA 3A9QA 2CN7A 3R2RA 3PW8A 3KA8A 1BG7A 2FHAA 4M35A 3KX9A 4XKUA 3ISEA 5GU0X 5AXSA 3PVRB 4CMYA 3E1MA 1JKVA 2FJCA 3FVBA 3PWQA 3PVRA 3L0MA 3F34A 3TA8A 3AF7X 4KVRA 3E1OA 1LKPA 1DVBA 1TKPA 4ZL6A 4DYYA 1LKMA 2BKCA 2XJOA 3QB9A 2OC5A 3MPSA 2XJNA 4E40A 1DATA 2IB0A 4RC5A 3JZ9A 4W4LB 4Z5SA 3ISFA 1GWGA 4RC6B 3ERZA 1YV1A 3BVLA 1JKUA 4ML5A 4RC6A 2CWLA 2IY4A 4REUA 2V2NA 3WNWA 2ITBA 3PW8C 3F33A 5D8RA 4A25A 2N02A 1ZUJA 4CY9A 2UX1A 3AK9A 4MUDA 2V2PA 2GYQA 4KVSA 2CIHA 3VVAA 2V2MA 3IS7A 1Z6OM 3F32A 4LQHA 3Q4OA 3PVTA 3AK8A 3PWQC 4CYBA 4TOGA 3NOZX 1DPSA 4TOCA 4LQJA 2ZG7X 3UNOA 4OYNA 3KA6A 5JKMG 4TODA 1VEIA 3AJQA 3E1QA 3C1ZA 3RBCA 2JD80 3PZAA 1HRSA 1YUXA 3KA9A 1RCDA 4ZL5A 4IXKA 3Q4QA 3SIDA 1RCCA 4M34A 4CVRA 2FL0A 5ERJA 2C2UA 4CVPA 2JD70 1OTKA 3GHQA 5LG8A 3GGYA 3NP0X 5D8SA 3EGMA 3HIUA 4ITWA 5ERKA 2QQYA 3GGZA 5GU2X 4RC7B 5D8OA 4U3GA 1AEWA 1IERA 3R2KA 4MN9A 3BT5A 2XJMA 4ERUA 5J8WA 4RC7A 1O9RA 4DE6A 5GU3X 5GN8B 1XZ3A 4MY7A 3AF8X 1JGCA 3C1YA 5GN8A 4AM4A 4LQVA 2CN6A 1O9IA 1RCEA 1B71A 4ZTTA 1Z4AA 1NNQA 2MGYA 2Z5PA 1S30A 3E1LA 3JZAB 2X170 2BJYA 2C2JA 3BVFA 3KXUA 4ETRA 4ZKWA 1UVHA 2C2FA 3T9JA 5GOUA 4XGSA 4CVTA 2CEIA 2OH3A 3WVVA 2CLBA 2GS4A 4Z3BA 5K52A 3GVYA 5GU1X 2D5KA 4LPJA 5D8YA 2F7NA 3R2SA 5HJFA 2V2SA 3WVWA 4XKTA 5J9VA 1XZ1A 4KVQA 3RD0A 5LS9A 4E6KA 4IWKA 4M33A 4RC5B 4LYUA 3IQ1A 3F38A 3PVYA 2FKZA 5I4JA 2YW6A 5CZUA 2Y44A 3W54A 3A68A 3OGHA 4ZKXA 2ZA7A 4TOHA 3F35A 4AM2A 4ZKHA 2YW7A 3C21A 3R2HA 2HR5A 2W0OA 1SQ3A 4Y08A 3O7RA 1QGHA 2CLUA 3E6SA 3FI6A 4KXRB 5J93A 3PVTB 2YJJA 4YKHA 2ZG8X 4DYZA 4PGKA 4TOBA 3BVEA 3SH6A 1MFRA 2Z6MA 5D8PA 5LG2A 5FEJA 5FFEA 3AF9X 2VXIA 3E2CA 3F37A 5E1UA 2BW1A 5JKLA 3D19A 3C23A 4TOFA 2AR0A 4DASA 4EVBA 3F39A 3H7GA 4ZJKA 4LQNA 3R2OA 4AM5A 3AJPA 1VLGA 1VJXA 1JYBA 2Y3QA 3AJOA 2Z5QA 2Z5RA 4TW3A 1L8HA 1BFRA 5C6FA 4P18A 3QD8A 1S2ZA 2VXXA 3KDQA 1YUZA 1F33A 1R03A 4ISMA
chains in the Genus database with same CATH topology
5JKMA 2QF9A 3R2LA 3SE1A 3V3KB 1S3QA 3GE4A 4EVEA 5CMQA 3RGDA 2G38B 1NF4A 3OJ5A 2XKQA 5FFAA 2V2IA 2CHPA 1EUMA 2GYDA 3FRRA 4W4KB 1QYBA 1H96A 2ZG9X 4RC8A 2XGWA 4LPNA 3FRSA 4YVZA 1ZS3A 1N1QA 3LKDA 1LB3A 4YXMA 1NF6A 1FHAA 3UFBA 1JI4A 2BK6A 5D8QA 4DYUA 1Z6OA 2V2JA 5E2DA 5IX6A 2FG4A 2CHIA 1VELA 2V8TA 1NFVA 1MOJA 2WLAA 1RYTA 2IU2A 3PVYB 3KA3A 3Q4NA 4EVDA 2Z90A 3E1PA 4MKUA 2OKCA 1RCIA 3PW1B 1F30A 3QHCA 3WVUA 3QVDA 2JD60 3PW1A 4XKSA 5FFCA 2FG8A 3NP2X 5FFDA 1J30A 4DZ0A 5CMRA 3F36A 2ZURX 3U90A 3UOFA 1TJOA 3IS8A 5HQOA 4ZLWA 2C41A 3EZ0A 2RBDA 2ZA8A 4EVCA 2G4HA 4DI0A 4R42A 3BKNA 4M32A 3E1NA 1L8IA 5J8SA 4ZMCA 5FFBA 3VV9A 4QUWA 5JKLG 3Q4RA 4TO9A 1VEQA 2V2RA 4CVSA 3KWOA 3KHKA 2V2OA 3VNXA 2WLUA 2CF7A 4PG1A 1JIGA 3BVIA 3PWFA 4CYAA 4WJG4 5LBHA 3R2MA 2WTLA 3ES3A 3SHXA 5D8XA 5JDOB 4MJYA 3M6JA 4TOEA 4PGIA 5JDOA 4MXPA 1JREA 2FFXJ 1LKOA 3N6OA 1UMNA 2ZA6A 3FSEA 2V2LA 5JACA 4ITTA 1RCGA 5HJHA 4CMYV 1JTSA 3E6RA 2VZBA 3QZ3A 3RE7A 4LPMA 3HL1A 3E1JA 4DYXA 4TOAA 1BCFA 3DBYA 2C6RA 2HTNA 3EZUA 3KA4A 2WWXB 1TKOA 4LYXA 4YXJA 2PYBA 2V8UA 5HU6D 2FZFA 4II4B 1IESA 3RAVA 3QHBA 2YJKA 3BVKA 4II4A 1KRQA 4IWJA 4ISPA 4PG0A 1SOFA 1TK6A 2V15A 5K53A 1JI5A 4X0JA 3O7SA 3UOIA 3A9QA 2CN7A 3R2RA 3PW8A 3KA8A 1BG7A 2FHAA 4M35A 3KX9A 4XKUA 3ISEA 5GU0X 5AXSA 3PVRB 4CMYA 3E1MA 1JKVA 2FJCA 3FVBA 3PWQA 3PVRA 3L0MA 3F34A 3TA8A 3AF7X 4KVRA 3E1OA 1LKPA 1DVBA 1TKPA 4ZL6A 4DYYA 1LKMA 2BKCA 2XJOA 3QB9A 2OC5A 3MPSA 2XJNA 4E40A 1DATA 2IB0A 4RC5A 3JZ9A 4W4LB 4Z5SA 3ISFA 1GWGA 4RC6B 3ERZA 1YV1A 3BVLA 1JKUA 4ML5A 4RC6A 2CWLA 2IY4A 4REUA 2V2NA 3WNWA 2ITBA 3PW8C 3F33A 5D8RA 4A25A 2N02A 1ZUJA 4CY9A 2UX1A 3AK9A 4MUDA 2V2PA 2GYQA 4KVSA 2CIHA 3VVAA 2V2MA 3IS7A 1Z6OM 3F32A 4LQHA 3Q4OA 3PVTA 3AK8A 3PWQC 4CYBA 4TOGA 3NOZX 1DPSA 4TOCA 4LQJA 2ZG7X 3UNOA 4OYNA 3KA6A 5JKMG 4TODA 1VEIA 3AJQA 3E1QA 3C1ZA 3RBCA 2JD80 3PZAA 1HRSA 1YUXA 3KA9A 1RCDA 4ZL5A 4IXKA 3Q4QA 3SIDA 1RCCA 4M34A 4CVRA 2FL0A 5ERJA 2C2UA 4CVPA 2JD70 1OTKA 3GHQA 5LG8A 3GGYA 3NP0X 5D8SA 3EGMA 3HIUA 4ITWA 5ERKA 2QQYA 3GGZA 5GU2X 4RC7B 5D8OA 4U3GA 1AEWA 1IERA 3R2KA 4MN9A 3BT5A 2XJMA 4ERUA 5J8WA 4RC7A 1O9RA 4DE6A 5GU3X 5GN8B 1XZ3A 4MY7A 3AF8X 1JGCA 3C1YA 5GN8A 4AM4A 4LQVA 2CN6A 1O9IA 1RCEA 1B71A 4ZTTA 1Z4AA 1NNQA 2MGYA 2Z5PA 1S30A 3E1LA 3JZAB 2X170 2BJYA 2C2JA 3BVFA 3KXUA 4ETRA 4ZKWA 1UVHA 2C2FA 3T9JA 5GOUA 4XGSA 4CVTA 2CEIA 2OH3A 3WVVA 2CLBA 2GS4A 4Z3BA 5K52A 3GVYA 5GU1X 2D5KA 4LPJA 5D8YA 2F7NA 3R2SA 5HJFA 2V2SA 3WVWA 4XKTA 5J9VA 1XZ1A 4KVQA 3RD0A 5LS9A 4E6KA 4IWKA 4M33A 4RC5B 4LYUA 3IQ1A 3F38A 3PVYA 2FKZA 5I4JA 2YW6A 5CZUA 2Y44A 3W54A 3A68A 3OGHA 4ZKXA 2ZA7A 4TOHA 3F35A 4AM2A 4ZKHA 2YW7A 3C21A 3R2HA 2HR5A 2W0OA 1SQ3A 4Y08A 3O7RA 1QGHA 2CLUA 3E6SA 3FI6A 4KXRB 5J93A 3PVTB 2YJJA 4YKHA 2ZG8X 4DYZA 4PGKA 4TOBA 3BVEA 3SH6A 1MFRA 2Z6MA 5D8PA 5LG2A 5FEJA 5FFEA 3AF9X 2VXIA 3E2CA 3F37A 5E1UA 2BW1A 5JKLA 3D19A 3C23A 4TOFA 2AR0A 4DASA 4EVBA 3F39A 3H7GA 4ZJKA 4LQNA 3R2OA 4AM5A 3AJPA 1VLGA 1VJXA 1JYBA 2Y3QA 3AJOA 2Z5QA 2Z5RA 4TW3A 1L8HA 1BFRA 5C6FA 4P18A 3QD8A 1S2ZA 2VXXA 3KDQA 1YUZA 1F33A 1R03A 4ISMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JKM A;  2QF9 A;  3R2L A;  3SE1 A;  1S3Q A;  3GE4 A;  4EVE A;  5CMQ A;  3RGD A;  1NF4 A;  3OJ5 A;  2XKQ A;  5FFA A;  2V2I A;  2CHP A;  1EUM A;  2GYD A;  1QYB A;  1H96 A;  2ZG9 X;  4RC8 A;  2XGW A;  4LPN A;  1ZS3 A;  1N1Q A;  1LB3 A;  1NF6 A;  1FHA A;  1JI4 A;  2BK6 A;  5D8Q A;  4DYU A;  1Z6O A;  2V2J A;  5E2D A;  5IX6 A;  2FG4 A;  2CHI A;  1VEL A;  1NFV A;  1MOJ A;  2WLA A;  1RYT A;  2IU2 A;  3PVY B;  3KA3 A;  3Q4N A;  4EVD A;  2Z90 A;  3E1P A;  4MKU A;  1RCI A;  3PW1 B;  1F30 A;  3QHC A;  3WVU A;  3QVD A;  2JD6 0;  3PW1 A;  4XKS A;  5FFC A;  2FG8 A;  3NP2 X;  5FFD A;  1J30 A;  4DZ0 A;  5CMR A;  3F36 A;  2ZUR X;  3U90 A;  3UOF A;  1TJO A;  3IS8 A;  5HQO A;  4ZLW A;  2C41 A;  3EZ0 A;  2RBD A;  2ZA8 A;  4EVC A;  2G4H A;  4DI0 A;  4R42 A;  3BKN A;  4M32 A;  3E1N A;  1L8I A;  5J8S A;  4ZMC A;  5FFB A;  4QUW A;  5JKL G;  3Q4R A;  4TO9 A;  1VEQ A;  2V2R A;  4CVS A;  3KWO A;  2V2O A;  3VNX A;  2WLU A;  2CF7 A;  4PG1 A;  1JIG A;  3BVI A;  3PWF A;  4CYA A;  5LBH A;  3R2M A;  2WTL A;  3ES3 A;  3SHX A;  5D8X A;  4MJY A;  4TOE A;  4PGI A;  1JRE A;  2FFX J;  1LKO A;  1UMN A;  2ZA6 A;  3FSE A;  2V2L A;  5JAC A;  4ITT A;  1RCG A;  5HJH A;  4CMY V;  1JTS A;  3E6R A;  2VZB A;  3QZ3 A;  3RE7 A;  4LPM A;  3HL1 A;  3E1J A;  4DYX A;  4TOA A;  1BCF A;  2C6R A;  2HTN A;  3EZU A;  3KA4 A;  1TKO A;  4LYX A;  2PYB A;  2FZF A;  4II4 B;  1IES A;  3RAV A;  3QHB A;  2YJK A;  3BVK A;  4II4 A;  1KRQ A;  4IWJ A;  4ISP A;  4PG0 A;  1SOF A;  1TK6 A;  2V15 A;  5K53 A;  1JI5 A;  3O7S A;  3UOI A;  3A9Q A;  2CN7 A;  3R2R A;  3PW8 A;  3KA8 A;  1BG7 A;  2FHA A;  4M35 A;  3KX9 A;  4XKU A;  3ISE A;  5GU0 X;  5AXS A;  3PVR B;  4CMY A;  3E1M A;  1JKV A;  2FJC A;  3FVB A;  3PWQ A;  3PVR A;  3F34 A;  3TA8 A;  3AF7 X;  4KVR A;  3E1O A;  1LKP A;  1DVB A;  1TKP A;  4ZL6 A;  4DYY A;  1LKM A;  2BKC A;  2XJO A;  3QB9 A;  2OC5 A;  3MPS A;  2XJN A;  1DAT A;  2IB0 A;  4RC5 A;  4Z5S A;  3ISF A;  1GWG A;  4RC6 B;  3ERZ A;  1YV1 A;  3BVL A;  1JKU A;  4ML5 A;  4RC6 A;  2IY4 A;  4REU A;  2V2N A;  3WNW A;  2ITB A;  3PW8 C;  3F33 A;  5D8R A;  4A25 A;  4CY9 A;  1ZUJ A;  2UX1 A;  3AK9 A;  4MUD A;  2V2P A;  2GYQ A;  4KVS A;  2CIH A;  2V2M A;  3IS7 A;  1Z6O M;  3F32 A;  4LQH A;  3Q4O A;  3PVT A;  3AK8 A;  3PWQ C;  4CYB A;  4TOG A;  3NOZ X;  1DPS A;  4TOC A;  4LQJ A;  2ZG7 X;  3UNO A;  4OYN A;  3KA6 A;  5JKM G;  4TOD A;  1VEI A;  3AJQ A;  3E1Q A;  3RBC A;  2JD8 0;  3PZA A;  1HRS A;  1YUX A;  3KA9 A;  1RCD A;  4ZL5 A;  4IXK A;  3Q4Q A;  3SID A;  1RCC A;  4M34 A;  4CVR A;  2FL0 A;  5ERJ A;  2C2U A;  4CVP A;  2JD7 0;  1OTK A;  3GHQ A;  5LG8 A;  3NP0 X;  5D8S A;  3EGM A;  3HIU A;  4ITW A;  5ERK A;  2QQY A;  5GU2 X;  4RC7 B;  5D8O A;  4U3G A;  1AEW A;  1IER A;  3R2K A;  4MN9 A;  3BT5 A;  2XJM A;  4ERU A;  5J8W A;  4RC7 A;  1O9R A;  4DE6 A;  5GU3 X;  5GN8 B;  1XZ3 A;  4MY7 A;  3AF8 X;  1JGC A;  5GN8 A;  4AM4 A;  4LQV A;  2CN6 A;  1O9I A;  1RCE A;  1B71 A;  4ZTT A;  1Z4A A;  1NNQ A;  2Z5P A;  1S30 A;  3E1L A;  2X17 0;  2BJY A;  2C2J A;  3BVF A;  3KXU A;  4ETR A;  4ZKW A;  1UVH A;  2C2F A;  3T9J A;  5GOU A;  4XGS A;  4CVT A;  2CEI A;  2OH3 A;  3WVV A;  2CLB A;  2GS4 A;  4Z3B A;  5K52 A;  3GVY A;  5GU1 X;  2D5K A;  4LPJ A;  5D8Y A;  2F7N A;  3R2S A;  5HJF A;  2V2S A;  3WVW A;  4XKT A;  5J9V A;  1XZ1 A;  4KVQ A;  3RD0 A;  5LS9 A;  4E6K A;  4IWK A;  4M33 A;  4RC5 B;  4LYU A;  3IQ1 A;  3F38 A;  3PVY A;  2FKZ A;  5I4J A;  2YW6 A;  5CZU A;  3A68 A;  3OGH A;  4ZKX A;  2ZA7 A;  4TOH A;  3F35 A;  4AM2 A;  4ZKH A;  2YW7 A;  3R2H A;  2HR5 A;  2W0O A;  1SQ3 A;  4Y08 A;  3O7R A;  1QGH A;  2CLU A;  3E6S A;  3FI6 A;  5J93 A;  3PVT B;  2YJJ A;  4YKH A;  2ZG8 X;  4DYZ A;  4PGK A;  4TOB A;  3BVE A;  3SH6 A;  1MFR A;  2Z6M A;  5D8P A;  5LG2 A;  5FEJ A;  5FFE A;  3AF9 X;  2VXI A;  3E2C A;  3F37 A;  5E1U A;  2BW1 A;  5JKL A;  4TOF A;  4DAS A;  4EVB A;  3F39 A;  3H7G A;  4ZJK A;  4LQN A;  3R2O A;  4AM5 A;  3AJP A;  1VLG A;  1VJX A;  1JYB A;  2Y3Q A;  3AJO A;  2Z5Q A;  2Z5R A;  4TW3 A;  1L8H A;  1BFR A;  5C6F A;  4P18 A;  3QD8 A;  1S2Z A;  2VXX A;  1YUZ A;  1F33 A;  1R03 A;  4ISM A; 
#chains in the Genus database with same CATH topology
 5JKM A;  2QF9 A;  3R2L A;  3SE1 A;  3V3K B;  1S3Q A;  3GE4 A;  4EVE A;  5CMQ A;  3RGD A;  2G38 B;  1NF4 A;  3OJ5 A;  2XKQ A;  5FFA A;  2V2I A;  2CHP A;  1EUM A;  2GYD A;  3FRR A;  4W4K B;  1QYB A;  1H96 A;  2ZG9 X;  4RC8 A;  2XGW A;  4LPN A;  3FRS A;  4YVZ A;  1ZS3 A;  1N1Q A;  3LKD A;  1LB3 A;  4YXM A;  1NF6 A;  1FHA A;  3UFB A;  1JI4 A;  2BK6 A;  5D8Q A;  4DYU A;  1Z6O A;  2V2J A;  5E2D A;  5IX6 A;  2FG4 A;  2CHI A;  1VEL A;  2V8T A;  1NFV A;  1MOJ A;  2WLA A;  1RYT A;  2IU2 A;  3PVY B;  3KA3 A;  3Q4N A;  4EVD A;  2Z90 A;  3E1P A;  4MKU A;  2OKC A;  1RCI A;  3PW1 B;  1F30 A;  3QHC A;  3WVU A;  3QVD A;  2JD6 0;  3PW1 A;  4XKS A;  5FFC A;  2FG8 A;  3NP2 X;  5FFD A;  1J30 A;  4DZ0 A;  5CMR A;  3F36 A;  2ZUR X;  3U90 A;  3UOF A;  1TJO A;  3IS8 A;  5HQO A;  4ZLW A;  2C41 A;  3EZ0 A;  2RBD A;  2ZA8 A;  4EVC A;  2G4H A;  4DI0 A;  4R42 A;  3BKN A;  4M32 A;  3E1N A;  1L8I A;  5J8S A;  4ZMC A;  5FFB A;  3VV9 A;  4QUW A;  5JKL G;  3Q4R A;  4TO9 A;  1VEQ A;  2V2R A;  4CVS A;  3KWO A;  3KHK A;  2V2O A;  3VNX A;  2WLU A;  2CF7 A;  4PG1 A;  1JIG A;  3BVI A;  3PWF A;  4CYA A;  4WJG 4;  5LBH A;  3R2M A;  2WTL A;  3ES3 A;  3SHX A;  5D8X A;  5JDO B;  4MJY A;  3M6J A;  4TOE A;  4PGI A;  5JDO A;  4MXP A;  1JRE A;  2FFX J;  1LKO A;  3N6O A;  1UMN A;  2ZA6 A;  3FSE A;  2V2L A;  5JAC A;  4ITT A;  1RCG A;  5HJH A;  4CMY V;  1JTS A;  3E6R A;  2VZB A;  3QZ3 A;  3RE7 A;  4LPM A;  3HL1 A;  3E1J A;  4DYX A;  4TOA A;  1BCF A;  3DBY A;  2C6R A;  2HTN A;  3EZU A;  3KA4 A;  2WWX B;  1TKO A;  4LYX A;  4YXJ A;  2PYB A;  2V8U A;  5HU6 D;  2FZF A;  4II4 B;  1IES A;  3RAV A;  3QHB A;  2YJK A;  3BVK A;  4II4 A;  1KRQ A;  4IWJ A;  4ISP A;  4PG0 A;  1SOF A;  1TK6 A;  2V15 A;  5K53 A;  1JI5 A;  4X0J A;  3O7S A;  3UOI A;  3A9Q A;  2CN7 A;  3R2R A;  3PW8 A;  3KA8 A;  1BG7 A;  2FHA A;  4M35 A;  3KX9 A;  4XKU A;  3ISE A;  5GU0 X;  5AXS A;  3PVR B;  4CMY A;  3E1M A;  1JKV A;  2FJC A;  3FVB A;  3PWQ A;  3PVR A;  3L0M A;  3F34 A;  3TA8 A;  3AF7 X;  4KVR A;  3E1O A;  1LKP A;  1DVB A;  1TKP A;  4ZL6 A;  4DYY A;  1LKM A;  2BKC A;  2XJO A;  3QB9 A;  2OC5 A;  3MPS A;  2XJN A;  4E40 A;  1DAT A;  2IB0 A;  4RC5 A;  3JZ9 A;  4W4L B;  4Z5S A;  3ISF A;  1GWG A;  4RC6 B;  3ERZ A;  1YV1 A;  3BVL A;  1JKU A;  4ML5 A;  4RC6 A;  2CWL A;  2IY4 A;  4REU A;  2V2N A;  3WNW A;  2ITB A;  3PW8 C;  3F33 A;  5D8R A;  4A25 A;  2N02 A;  1ZUJ A;  4CY9 A;  2UX1 A;  3AK9 A;  4MUD A;  2V2P A;  2GYQ A;  4KVS A;  2CIH A;  3VVA A;  2V2M A;  3IS7 A;  1Z6O M;  3F32 A;  4LQH A;  3Q4O A;  3PVT A;  3AK8 A;  3PWQ C;  4CYB A;  4TOG A;  3NOZ X;  1DPS A;  4TOC A;  4LQJ A;  2ZG7 X;  3UNO A;  4OYN A;  3KA6 A;  5JKM G;  4TOD A;  1VEI A;  3AJQ A;  3E1Q A;  3C1Z A;  3RBC A;  2JD8 0;  3PZA A;  1HRS A;  1YUX A;  3KA9 A;  1RCD A;  4ZL5 A;  4IXK A;  3Q4Q A;  3SID A;  1RCC A;  4M34 A;  4CVR A;  2FL0 A;  5ERJ A;  2C2U A;  4CVP A;  2JD7 0;  1OTK A;  3GHQ A;  5LG8 A;  3GGY A;  3NP0 X;  5D8S A;  3EGM A;  3HIU A;  4ITW A;  5ERK A;  2QQY A;  3GGZ A;  5GU2 X;  4RC7 B;  5D8O A;  4U3G A;  1AEW A;  1IER A;  3R2K A;  4MN9 A;  3BT5 A;  2XJM A;  4ERU A;  5J8W A;  4RC7 A;  1O9R A;  4DE6 A;  5GU3 X;  5GN8 B;  1XZ3 A;  4MY7 A;  3AF8 X;  1JGC A;  3C1Y A;  5GN8 A;  4AM4 A;  4LQV A;  2CN6 A;  1O9I A;  1RCE A;  1B71 A;  4ZTT A;  1Z4A A;  1NNQ A;  2MGY A;  2Z5P A;  1S30 A;  3E1L A;  3JZA B;  2X17 0;  2BJY A;  2C2J A;  3BVF A;  3KXU A;  4ETR A;  4ZKW A;  1UVH A;  2C2F A;  3T9J A;  5GOU A;  4XGS A;  4CVT A;  2CEI A;  2OH3 A;  3WVV A;  2CLB A;  2GS4 A;  4Z3B A;  5K52 A;  3GVY A;  5GU1 X;  2D5K A;  4LPJ A;  5D8Y A;  2F7N A;  3R2S A;  5HJF A;  2V2S A;  3WVW A;  4XKT A;  5J9V A;  1XZ1 A;  4KVQ A;  3RD0 A;  5LS9 A;  4E6K A;  4IWK A;  4M33 A;  4RC5 B;  4LYU A;  3IQ1 A;  3F38 A;  3PVY A;  2FKZ A;  5I4J A;  2YW6 A;  5CZU A;  2Y44 A;  3W54 A;  3A68 A;  3OGH A;  4ZKX A;  2ZA7 A;  4TOH A;  3F35 A;  4AM2 A;  4ZKH A;  2YW7 A;  3C21 A;  3R2H A;  2HR5 A;  2W0O A;  1SQ3 A;  4Y08 A;  3O7R A;  1QGH A;  2CLU A;  3E6S A;  3FI6 A;  4KXR B;  5J93 A;  3PVT B;  2YJJ A;  4YKH A;  2ZG8 X;  4DYZ A;  4PGK A;  4TOB A;  3BVE A;  3SH6 A;  1MFR A;  2Z6M A;  5D8P A;  5LG2 A;  5FEJ A;  5FFE A;  3AF9 X;  2VXI A;  3E2C A;  3F37 A;  5E1U A;  2BW1 A;  5JKL A;  3D19 A;  3C23 A;  4TOF A;  2AR0 A;  4DAS A;  4EVB A;  3F39 A;  3H7G A;  4ZJK A;  4LQN A;  3R2O A;  4AM5 A;  3AJP A;  1VLG A;  1VJX A;  1JYB A;  2Y3Q A;  3AJO A;  2Z5Q A;  2Z5R A;  4TW3 A;  1L8H A;  1BFR A;  5C6F A;  4P18 A;  3QD8 A;  1S2Z A;  2VXX A;  3KDQ A;  1YUZ A;  1F33 A;  1R03 A;  4ISM A; 
#chains in the Genus database with same CATH homology
 5JKM A;  2QF9 A;  3R2L A;  3SE1 A;  3V3K B;  1S3Q A;  3GE4 A;  4EVE A;  5CMQ A;  3RGD A;  2G38 B;  1NF4 A;  3OJ5 A;  2XKQ A;  5FFA A;  2V2I A;  2CHP A;  1EUM A;  2GYD A;  3FRR A;  4W4K B;  1QYB A;  1H96 A;  2ZG9 X;  4RC8 A;  2XGW A;  4LPN A;  3FRS A;  4YVZ A;  1ZS3 A;  1N1Q A;  3LKD A;  1LB3 A;  4YXM A;  1NF6 A;  1FHA A;  3UFB A;  1JI4 A;  2BK6 A;  5D8Q A;  4DYU A;  1Z6O A;  2V2J A;  5E2D A;  5IX6 A;  2FG4 A;  2CHI A;  1VEL A;  2V8T A;  1NFV A;  1MOJ A;  2WLA A;  1RYT A;  2IU2 A;  3PVY B;  3KA3 A;  3Q4N A;  4EVD A;  2Z90 A;  3E1P A;  4MKU A;  2OKC A;  1RCI A;  3PW1 B;  1F30 A;  3QHC A;  3WVU A;  3QVD A;  2JD6 0;  3PW1 A;  4XKS A;  5FFC A;  2FG8 A;  3NP2 X;  5FFD A;  1J30 A;  4DZ0 A;  5CMR A;  3F36 A;  2ZUR X;  3U90 A;  3UOF A;  1TJO A;  3IS8 A;  5HQO A;  4ZLW A;  2C41 A;  3EZ0 A;  2RBD A;  2ZA8 A;  4EVC A;  2G4H A;  4DI0 A;  4R42 A;  3BKN A;  4M32 A;  3E1N A;  1L8I A;  5J8S A;  4ZMC A;  5FFB A;  3VV9 A;  4QUW A;  5JKL G;  3Q4R A;  4TO9 A;  1VEQ A;  2V2R A;  4CVS A;  3KWO A;  3KHK A;  2V2O A;  3VNX A;  2WLU A;  2CF7 A;  4PG1 A;  1JIG A;  3BVI A;  3PWF A;  4CYA A;  4WJG 4;  5LBH A;  3R2M A;  2WTL A;  3ES3 A;  3SHX A;  5D8X A;  5JDO B;  4MJY A;  3M6J A;  4TOE A;  4PGI A;  5JDO A;  4MXP A;  1JRE A;  2FFX J;  1LKO A;  3N6O A;  1UMN A;  2ZA6 A;  3FSE A;  2V2L A;  5JAC A;  4ITT A;  1RCG A;  5HJH A;  4CMY V;  1JTS A;  3E6R A;  2VZB A;  3QZ3 A;  3RE7 A;  4LPM A;  3HL1 A;  3E1J A;  4DYX A;  4TOA A;  1BCF A;  3DBY A;  2C6R A;  2HTN A;  3EZU A;  3KA4 A;  2WWX B;  1TKO A;  4LYX A;  4YXJ A;  2PYB A;  2V8U A;  5HU6 D;  2FZF A;  4II4 B;  1IES A;  3RAV A;  3QHB A;  2YJK A;  3BVK A;  4II4 A;  1KRQ A;  4IWJ A;  4ISP A;  4PG0 A;  1SOF A;  1TK6 A;  2V15 A;  5K53 A;  1JI5 A;  4X0J A;  3O7S A;  3UOI A;  3A9Q A;  2CN7 A;  3R2R A;  3PW8 A;  3KA8 A;  1BG7 A;  2FHA A;  4M35 A;  3KX9 A;  4XKU A;  3ISE A;  5GU0 X;  5AXS A;  3PVR B;  4CMY A;  3E1M A;  1JKV A;  2FJC A;  3FVB A;  3PWQ A;  3PVR A;  3L0M A;  3F34 A;  3TA8 A;  3AF7 X;  4KVR A;  3E1O A;  1LKP A;  1DVB A;  1TKP A;  4ZL6 A;  4DYY A;  1LKM A;  2BKC A;  2XJO A;  3QB9 A;  2OC5 A;  3MPS A;  2XJN A;  4E40 A;  1DAT A;  2IB0 A;  4RC5 A;  3JZ9 A;  4W4L B;  4Z5S A;  3ISF A;  1GWG A;  4RC6 B;  3ERZ A;  1YV1 A;  3BVL A;  1JKU A;  4ML5 A;  4RC6 A;  2CWL A;  2IY4 A;  4REU A;  2V2N A;  3WNW A;  2ITB A;  3PW8 C;  3F33 A;  5D8R A;  4A25 A;  2N02 A;  1ZUJ A;  4CY9 A;  2UX1 A;  3AK9 A;  4MUD A;  2V2P A;  2GYQ A;  4KVS A;  2CIH A;  3VVA A;  2V2M A;  3IS7 A;  1Z6O M;  3F32 A;  4LQH A;  3Q4O A;  3PVT A;  3AK8 A;  3PWQ C;  4CYB A;  4TOG A;  3NOZ X;  1DPS A;  4TOC A;  4LQJ A;  2ZG7 X;  3UNO A;  4OYN A;  3KA6 A;  5JKM G;  4TOD A;  1VEI A;  3AJQ A;  3E1Q A;  3C1Z A;  3RBC A;  2JD8 0;  3PZA A;  1HRS A;  1YUX A;  3KA9 A;  1RCD A;  4ZL5 A;  4IXK A;  3Q4Q A;  3SID A;  1RCC A;  4M34 A;  4CVR A;  2FL0 A;  5ERJ A;  2C2U A;  4CVP A;  2JD7 0;  1OTK A;  3GHQ A;  5LG8 A;  3GGY A;  3NP0 X;  5D8S A;  3EGM A;  3HIU A;  4ITW A;  5ERK A;  2QQY A;  3GGZ A;  5GU2 X;  4RC7 B;  5D8O A;  4U3G A;  1AEW A;  1IER A;  3R2K A;  4MN9 A;  3BT5 A;  2XJM A;  4ERU A;  5J8W A;  4RC7 A;  1O9R A;  4DE6 A;  5GU3 X;  5GN8 B;  1XZ3 A;  4MY7 A;  3AF8 X;  1JGC A;  3C1Y A;  5GN8 A;  4AM4 A;  4LQV A;  2CN6 A;  1O9I A;  1RCE A;  1B71 A;  4ZTT A;  1Z4A A;  1NNQ A;  2MGY A;  2Z5P A;  1S30 A;  3E1L A;  3JZA B;  2X17 0;  2BJY A;  2C2J A;  3BVF A;  3KXU A;  4ETR A;  4ZKW A;  1UVH A;  2C2F A;  3T9J A;  5GOU A;  4XGS A;  4CVT A;  2CEI A;  2OH3 A;  3WVV A;  2CLB A;  2GS4 A;  4Z3B A;  5K52 A;  3GVY A;  5GU1 X;  2D5K A;  4LPJ A;  5D8Y A;  2F7N A;  3R2S A;  5HJF A;  2V2S A;  3WVW A;  4XKT A;  5J9V A;  1XZ1 A;  4KVQ A;  3RD0 A;  5LS9 A;  4E6K A;  4IWK A;  4M33 A;  4RC5 B;  4LYU A;  3IQ1 A;  3F38 A;  3PVY A;  2FKZ A;  5I4J A;  2YW6 A;  5CZU A;  2Y44 A;  3W54 A;  3A68 A;  3OGH A;  4ZKX A;  2ZA7 A;  4TOH A;  3F35 A;  4AM2 A;  4ZKH A;  2YW7 A;  3C21 A;  3R2H A;  2HR5 A;  2W0O A;  1SQ3 A;  4Y08 A;  3O7R A;  1QGH A;  2CLU A;  3E6S A;  3FI6 A;  4KXR B;  5J93 A;  3PVT B;  2YJJ A;  4YKH A;  2ZG8 X;  4DYZ A;  4PGK A;  4TOB A;  3BVE A;  3SH6 A;  1MFR A;  2Z6M A;  5D8P A;  5LG2 A;  5FEJ A;  5FFE A;  3AF9 X;  2VXI A;  3E2C A;  3F37 A;  5E1U A;  2BW1 A;  5JKL A;  3D19 A;  3C23 A;  4TOF A;  2AR0 A;  4DAS A;  4EVB A;  3F39 A;  3H7G A;  4ZJK A;  4LQN A;  3R2O A;  4AM5 A;  3AJP A;  1VLG A;  1VJX A;  1JYB A;  2Y3Q A;  3AJO A;  2Z5Q A;  2Z5R A;  4TW3 A;  1L8H A;  1BFR A;  5C6F A;  4P18 A;  3QD8 A;  1S2Z A;  2VXX A;  3KDQ A;  1YUZ A;  1F33 A;  1R03 A;  4ISM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...