2BW1A

Iron-bound crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
151
structure length
151
Chain Sequence
LADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DPS-LIKE PEROXIDE RESISTANCE PROTEIN
publication title Iron incorporation in Streptococcus suis Dps-like peroxide resistance protein Dpr requires mobility in the ferroxidase center and leads to the formation of a ferrihydrite-like core.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Peroxide resistance
total genus 68
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2bw1A00
2Z5PA 2BW1A 3BT5A 3AF9X 2CLUA 2V2LA 1JYBA 2JD60 3R2OA 1MFRA 4CYBA 3GE4A 3RE7A 4LYUA 2IY4A 3E1NA 2Z6MA 1XZ3A 1VJXA 2FL0A 1DATA 1GWGA 3RD0A 1F30A 3U90A 3E6SA 3E1PA 3E1JA 4DE6A 2VZBA 4ZMCA 1RCGA 3QD8A 1YUXA 2JD70 5J9VA 4TOHA 3PWFA 1XZ1A 3AJPA 2V2PA 4DASA 5ERKA 4RC5B 3KXUA 5HJHA 2UX1A 1HRSA 4RC7B 3ES3A 3KA6A 2IB0A 3Q4QA 5J8WA 5FFCA 1DPSA 1YUZA 4PG1A 5GN8B 4RC5A 4ITTA 1IESA 4CVTA 3E1QA 4RC7A 5JACA 3AF7X 4MN9A 3SE1A 4E6KA 5J93A 1R03A 2ITBA 1Z4AA 5JKMA 3KA3A 5GN8A 3IS8A 1O9IA 1Z6OA 1O9RA 2PYBA 5GU0X 5GU3X 3R2RA 2GYDA 3WVUA 1LKPA 2Y3QA 3VNXA 2V2SA 5LG8A 4ZJKA 3OGHA 4XKTA 1S30A 1UMNA 3F35A 5GU1X 1RYTA 3A9QA 5AXSA 3QZ3A 2Z5QA 3Q4OA 3PVTB 3NP2X 4CVRA 1LKMA 4CMYA 2VXXA 1TJOA 5JKLG 4REUA 4CVSA 3PVTA 3F36A 1NF4A 2IU2A 3R2SA 1UVHA 4KVQA 5E1UA 3PW8C 1S3QA 4ZKWA 4DYYA 1DVBA 1VLGA 1TKOA 5GU2X 4ZKHA 5D8OA 4TW3A 2CEIA 2RBDA 2HR5A 3EZ0A 4DYZA 1YV1A 3PVYB 2GYQA 4ZKXA 3ISFA 3OJ5A 1ZS3A 4LQJA 2XJNA 2QQYA 1MOJA 3A68A 3BVKA 4EVBA 4DYXA 1ZUJA 3PVYA 3FVBA 3R2LA 1TKPA 3F39A 2V15A 3Q4NA 1RCIA 4XGSA 3SIDA 4MUDA 4LQVA 1VEIA 1L8HA 2WLAA 3R2MA 3RAVA 2C2FA 5E2DA 2V2MA 2BK6A 5K52A 2WTLA 1BCFA 5D8RA 1B71A 2CLBA 4LPMA 4EVCA 5K53A 3Q4RA 2ZA6A 5J8SA 3WVWA 5GOUA 2YJJA 2HTNA 4IWKA 3F37A 2CHIA 2ZA8A 4QUWA 1AEWA 4EVEA 2C2UA 1Z6OM 5C6FA 4EVDA 3O7SA 4PGIA 2XJOA 3WNWA 4IXKA 3QVDA 2BJYA 2FJCA 3BVFA 4TODA 3SHXA 3AJQA 3T9JA 4RC8A 4YKHA 4Y08A 3H7GA 3HIUA 3E1OA 3BVIA 2BKCA 5LBHA 1OTKA 1JIGA 2WLUA 1JKUA 5IX6A 4Z3BA 5HJFA 3UOFA 4DYUA 3F34A 4TOCA 5I4JA 3AK9A 3R2HA 2V2NA 3E2CA 3F32A 1N1QA 3KX9A 2YJKA 3PVRB 5LS9A 3PWQC 4IWJA 3KWOA 4MY7A 3ISEA 4LYXA 4ML5A 3MPSA 4M32A 2FG8A 2CN6A 3KA9A 3HL1A 5CZUA 3FSEA 4MJYA 1JGCA 2ZURX 3GHQA 3PVRA 5CMQA 2XJMA 1JI4A 3AK8A 4CMYV 1RCCA 4ZL6A 1QGHA 4CY9A 3QHBA 4LPJA 3E1MA 4PG0A 3O7RA 2CHPA 1L8IA 5FFDA 3SH6A 2CN7A 4ERUA 1VELA 5FFEA 2FHAA 2G4HA 3AJOA 5CMRA 1VEQA 3BVLA 5LG2A 3FI6A 2C2JA 4XKSA 3BVEA 3QB9A 5FEJA 4RC6B 4AM5A 4OYNA 4DI0A 2X170 3AF8X 4AM2A 5JKMG 1NF6A 3F38A 4CYAA 2FZFA 2OC5A 3GVYA 1RCEA 4RC6A 2XKQA 4M34A 3EGMA 1FHAA 5D8XA 4TOBA 2ZG7X 4R42A 4ZTTA 3E6RA 2V2RA 4TOFA 4TO9A 4KVSA 1KRQA 1JTSA 4DZ0A 5JKLA 1S2ZA 2CF7A 1NNQA 4CVPA 2FFXJ 4MKUA 3IS7A 4TOEA 3F33A 1F33A 1QYBA 3RBCA 3KA4A 2XGWA 4LQHA 1NFVA 2ZG9X 3UNOA 4XKUA 4ZLWA 2FG4A 4M33A 2ZG8X 4KVRA 1TK6A 3PWQA 3BKNA 5D8YA 2JD80 3ERZA 3PW1B 4AM4A 1SOFA 3QHCA 3TA8A 4ISPA 2D5KA 2YW7A 2ZA7A 1JKVA 3PW8A 3PZAA 4M35A 2V2OA 3WVVA 1JREA 3KA8A 1JI5A 3PW1A 1BFRA 5FFAA 2OH3A 2FKZA 2Z5RA 2V2JA 3RGDA 2VXIA 4ETRA 2YW6A 5D8SA 3NP0X 4ZL5A 4Z5SA 2C41A 2V2IA 4ITWA 2GS4A 4II4B 2F7NA 1LB3A 1SQ3A 2W0OA 2CIHA 3UOIA 1EUMA 4TOGA 3EZUA 3NOZX 1BG7A 1LKOA 1J30A 4II4A 5FFBA 4P18A 1IERA 2Z90A 4U3GA 4ISMA 5HQOA 4TOAA 5D8PA 2QF9A 4LPNA 5D8QA 4A25A 3E1LA 1RCDA 5ERJA 3R2KA 2C6RA 4PGKA 4LQNA 3IQ1A 1H96A
chains in the Genus database with same CATH superfamily
4W4KB 2Z5PA 2BW1A 3BT5A 3AF9X 2CLUA 2V2LA 1JYBA 2JD60 3R2OA 1MFRA 4CYBA 3GE4A 3RE7A 4LYUA 2IY4A 3E1NA 3GGZA 2Z6MA 1XZ3A 1VJXA 2FL0A 1DATA 1GWGA 3RD0A 1F30A 3U90A 3E6SA 3E1PA 3E1JA 4DE6A 2VZBA 4ZMCA 1RCGA 3QD8A 1YUXA 2JD70 5J9VA 4TOHA 3PWFA 1XZ1A 3AJPA 2V2PA 4DASA 5ERKA 4RC5B 3KXUA 5HJHA 3DBYA 2UX1A 1HRSA 4YVZA 4RC7B 3ES3A 3KA6A 2IB0A 3Q4QA 5J8WA 5FFCA 1DPSA 1YUZA 4PG1A 5GN8B 4RC5A 4ITTA 1IESA 4CVTA 3E1QA 2V8TA 4RC7A 3LKDA 5JACA 3AF7X 4MN9A 3SE1A 4E6KA 5J93A 2MGYA 1R03A 2ITBA 1Z4AA 5JKMA 3KA3A 5GN8A 3IS8A 1O9IA 1Z6OA 1O9RA 2PYBA 5GU0X 5GU3X 3R2RA 2GYDA 3WVUA 1LKPA 2Y3QA 3VNXA 2V2SA 5LG8A 4ZJKA 3OGHA 4XKTA 1S30A 1UMNA 3F35A 5GU1X 1RYTA 3A9QA 3VVAA 5AXSA 3VV9A 3QZ3A 2Z5QA 3Q4OA 3PVTB 3NP2X 4CVRA 1LKMA 4CMYA 2VXXA 1TJOA 5JKLG 4REUA 4CVSA 3PVTA 3F36A 1NF4A 2IU2A 3R2SA 4YXMA 1UVHA 4KVQA 5E1UA 3PW8C 1S3QA 4ZKWA 4DYYA 1DVBA 1VLGA 1TKOA 5GU2X 4ZKHA 5D8OA 4TW3A 2CEIA 2RBDA 2HR5A 3EZ0A 4DYZA 1YV1A 3PVYB 2GYQA 2OKCA 4ZKXA 3ISFA 3OJ5A 1ZS3A 4LQJA 2XJNA 2QQYA 1MOJA 3JZ9A 3JZAB 3A68A 3BVKA 4EVBA 4DYXA 1ZUJA 3PVYA 3FVBA 3R2LA 1TKPA 3F39A 5JDOB 2V15A 3Q4NA 1RCIA 4XGSA 3SIDA 4MUDA 4LQVA 1VEIA 4E40A 1L8HA 2WLAA 3R2MA 3RAVA 2C2FA 5E2DA 2V2MA 5JDOA 2BK6A 5K52A 2WTLA 1BCFA 5D8RA 1B71A 2CLBA 4LPMA 4EVCA 5K53A 3Q4RA 2ZA6A 5J8SA 3WVWA 5GOUA 2YJJA 2HTNA 4IWKA 3F37A 2CHIA 2ZA8A 3D19A 3N6OA 1AEWA 4QUWA 4EVEA 2C2UA 1Z6OM 5C6FA 2G38B 4KXRB 2WWXB 4EVDA 3O7SA 4PGIA 2XJOA 3WNWA 4IXKA 3QVDA 2BJYA 2FJCA 3BVFA 3KHKA 4TODA 3SHXA 3AJQA 3T9JA 3KDQA 4RC8A 4YKHA 3GGYA 4Y08A 3H7GA 3HIUA 3E1OA 3BVIA 2BKCA 5LBHA 1OTKA 1JIGA 2WLUA 1JKUA 5IX6A 4Z3BA 5HJFA 3UOFA 4DYUA 3F34A 4TOCA 5I4JA 3C23A 3AK9A 3R2HA 2V2NA 3E2CA 3F32A 3FRSA 3L0MA 1N1QA 3KX9A 2YJKA 3PVRB 5LS9A 3PWQC 4IWJA 3KWOA 3W54A 2CWLA 4MY7A 3ISEA 4LYXA 4ML5A 3MPSA 4M32A 2FG8A 2CN6A 3KA9A 3HL1A 5CZUA 3FSEA 4MJYA 3M6JA 1JGCA 2ZURX 3GHQA 3PVRA 5CMQA 2XJMA 1JI4A 3AK8A 4CMYV 1RCCA 4ZL6A 1QGHA 4CY9A 3QHBA 4LPJA 3E1MA 4PG0A 3O7RA 2CHPA 1L8IA 5FFDA 3SH6A 2CN7A 4ERUA 1VELA 5FFEA 2FHAA 2G4HA 3AJOA 5CMRA 1VEQA 3BVLA 4W4LB 5LG2A 3FI6A 2C2JA 4XKSA 3BVEA 3QB9A 5FEJA 4RC6B 4AM5A 4OYNA 4DI0A 2X170 3AF8X 4AM2A 5JKMG 1NF6A 4X0JA 3F38A 4CYAA 2Y44A 2FZFA 2OC5A 3GVYA 1RCEA 4MXPA 4RC6A 2XKQA 4M34A 3EGMA 1FHAA 5D8XA 4TOBA 4YXJA 2ZG7X 4R42A 3C1ZA 4ZTTA 3E6RA 2V2RA 4TOFA 4TO9A 4KVSA 1KRQA 1JTSA 4DZ0A 5JKLA 1S2ZA 2CF7A 3C1YA 1NNQA 4CVPA 2FFXJ 4MKUA 3IS7A 4TOEA 3F33A 1F33A 1QYBA 3RBCA 3KA4A 2XGWA 4LQHA 1NFVA 5HU6D 2ZG9X 3UNOA 4XKUA 4ZLWA 2FG4A 4M33A 2ZG8X 4KVRA 1TK6A 3C21A 3PWQA 3BKNA 5D8YA 2JD80 3ERZA 4WJG4 3PW1B 4AM4A 1SOFA 3QHCA 3TA8A 3FRRA 4ISPA 2D5KA 2YW7A 2ZA7A 1JKVA 3PW8A 3PZAA 4M35A 2N02A 2V2OA 2AR0A 3WVVA 1JREA 3KA8A 1JI5A 3PW1A 1BFRA 5FFAA 2OH3A 2FKZA 2Z5RA 2V2JA 3RGDA 2VXIA 4ETRA 2YW6A 5D8SA 3NP0X 4ZL5A 4Z5SA 3V3KB 2V8UA 3UFBA 2C41A 2V2IA 4ITWA 2GS4A 4II4B 2F7NA 1LB3A 1SQ3A 2W0OA 2CIHA 3UOIA 1EUMA 4TOGA 3EZUA 3NOZX 1BG7A 1LKOA 1J30A 4II4A 5FFBA 4P18A 1IERA 2Z90A 4U3GA 4ISMA 5HQOA 4TOAA 5D8PA 2QF9A 4LPNA 5D8QA 4A25A 3E1LA 1RCDA 5ERJA 3R2KA 2C6RA 4PGKA 4LQNA 3IQ1A 1H96A
chains in the Genus database with same CATH topology
4W4KB 2Z5PA 2BW1A 3BT5A 3AF9X 2CLUA 2V2LA 1JYBA 2JD60 3R2OA 1MFRA 4CYBA 3GE4A 3RE7A 4LYUA 2IY4A 3E1NA 3GGZA 2Z6MA 1XZ3A 1VJXA 2FL0A 1DATA 1GWGA 3RD0A 1F30A 3U90A 3E6SA 3E1PA 3E1JA 4DE6A 2VZBA 4ZMCA 1RCGA 3QD8A 1YUXA 2JD70 5J9VA 4TOHA 3PWFA 1XZ1A 3AJPA 2V2PA 4DASA 5ERKA 4RC5B 3KXUA 5HJHA 3DBYA 2UX1A 1HRSA 4YVZA 4RC7B 3ES3A 3KA6A 2IB0A 3Q4QA 5J8WA 5FFCA 1DPSA 1YUZA 4PG1A 5GN8B 4RC5A 4ITTA 1IESA 4CVTA 3E1QA 2V8TA 4RC7A 3LKDA 5JACA 3AF7X 4MN9A 3SE1A 4E6KA 5J93A 2MGYA 1R03A 2ITBA 1Z4AA 5JKMA 3KA3A 5GN8A 3IS8A 1O9IA 1Z6OA 1O9RA 2PYBA 5GU0X 5GU3X 3R2RA 2GYDA 3WVUA 1LKPA 2Y3QA 3VNXA 2V2SA 5LG8A 4ZJKA 3OGHA 4XKTA 1S30A 1UMNA 3F35A 5GU1X 1RYTA 3A9QA 3VVAA 5AXSA 3VV9A 3QZ3A 2Z5QA 3Q4OA 3PVTB 3NP2X 4CVRA 1LKMA 4CMYA 2VXXA 1TJOA 5JKLG 4REUA 4CVSA 3PVTA 3F36A 1NF4A 2IU2A 3R2SA 4YXMA 1UVHA 4KVQA 5E1UA 3PW8C 1S3QA 4ZKWA 4DYYA 1DVBA 1VLGA 1TKOA 5GU2X 4ZKHA 5D8OA 4TW3A 2CEIA 2RBDA 2HR5A 3EZ0A 4DYZA 1YV1A 3PVYB 2GYQA 2OKCA 4ZKXA 3ISFA 3OJ5A 1ZS3A 4LQJA 2XJNA 2QQYA 1MOJA 3JZ9A 3JZAB 3A68A 3BVKA 4EVBA 4DYXA 1ZUJA 3PVYA 3FVBA 3R2LA 1TKPA 3F39A 5JDOB 2V15A 3Q4NA 1RCIA 4XGSA 3SIDA 4MUDA 4LQVA 1VEIA 4E40A 1L8HA 2WLAA 3R2MA 3RAVA 2C2FA 5E2DA 2V2MA 5JDOA 2BK6A 5K52A 2WTLA 1BCFA 5D8RA 1B71A 2CLBA 4LPMA 4EVCA 5K53A 3Q4RA 2ZA6A 5J8SA 3WVWA 5GOUA 2YJJA 2HTNA 4IWKA 3F37A 2CHIA 2ZA8A 3D19A 3N6OA 1AEWA 4QUWA 4EVEA 2C2UA 1Z6OM 5C6FA 2G38B 4KXRB 2WWXB 4EVDA 3O7SA 4PGIA 2XJOA 3WNWA 4IXKA 3QVDA 2BJYA 2FJCA 3BVFA 3KHKA 4TODA 3SHXA 3AJQA 3T9JA 3KDQA 4RC8A 4YKHA 3GGYA 4Y08A 3H7GA 3HIUA 3E1OA 3BVIA 2BKCA 5LBHA 1OTKA 1JIGA 2WLUA 1JKUA 5IX6A 4Z3BA 5HJFA 3UOFA 4DYUA 3F34A 4TOCA 5I4JA 3C23A 3AK9A 3R2HA 2V2NA 3E2CA 3F32A 3FRSA 3L0MA 1N1QA 3KX9A 2YJKA 3PVRB 5LS9A 3PWQC 4IWJA 3KWOA 3W54A 2CWLA 4MY7A 3ISEA 4LYXA 4ML5A 3MPSA 4M32A 2FG8A 2CN6A 3KA9A 3HL1A 5CZUA 3FSEA 4MJYA 3M6JA 1JGCA 2ZURX 3GHQA 3PVRA 5CMQA 2XJMA 1JI4A 3AK8A 4CMYV 1RCCA 4ZL6A 1QGHA 4CY9A 3QHBA 4LPJA 3E1MA 4PG0A 3O7RA 2CHPA 1L8IA 5FFDA 3SH6A 2CN7A 4ERUA 1VELA 5FFEA 2FHAA 2G4HA 3AJOA 5CMRA 1VEQA 3BVLA 4W4LB 5LG2A 3FI6A 2C2JA 4XKSA 3BVEA 3QB9A 5FEJA 4RC6B 4AM5A 4OYNA 4DI0A 2X170 3AF8X 4AM2A 5JKMG 1NF6A 4X0JA 3F38A 4CYAA 2Y44A 2FZFA 2OC5A 3GVYA 1RCEA 4MXPA 4RC6A 2XKQA 4M34A 3EGMA 1FHAA 5D8XA 4TOBA 4YXJA 2ZG7X 4R42A 3C1ZA 4ZTTA 3E6RA 2V2RA 4TOFA 4TO9A 4KVSA 1KRQA 1JTSA 4DZ0A 5JKLA 1S2ZA 2CF7A 3C1YA 1NNQA 4CVPA 2FFXJ 4MKUA 3IS7A 4TOEA 3F33A 1F33A 1QYBA 3RBCA 3KA4A 2XGWA 4LQHA 1NFVA 5HU6D 2ZG9X 3UNOA 4XKUA 4ZLWA 2FG4A 4M33A 2ZG8X 4KVRA 1TK6A 3C21A 3PWQA 3BKNA 5D8YA 2JD80 3ERZA 4WJG4 3PW1B 4AM4A 1SOFA 3QHCA 3TA8A 3FRRA 4ISPA 2D5KA 2YW7A 2ZA7A 1JKVA 3PW8A 3PZAA 4M35A 2N02A 2V2OA 2AR0A 3WVVA 1JREA 3KA8A 1JI5A 3PW1A 1BFRA 5FFAA 2OH3A 2FKZA 2Z5RA 2V2JA 3RGDA 2VXIA 4ETRA 2YW6A 5D8SA 3NP0X 4ZL5A 4Z5SA 3V3KB 2V8UA 3UFBA 2C41A 2V2IA 4ITWA 2GS4A 4II4B 2F7NA 1LB3A 1SQ3A 2W0OA 2CIHA 3UOIA 1EUMA 4TOGA 3EZUA 3NOZX 1BG7A 1LKOA 1J30A 4II4A 5FFBA 4P18A 1IERA 2Z90A 4U3GA 4ISMA 5HQOA 4TOAA 5D8PA 2QF9A 4LPNA 5D8QA 4A25A 3E1LA 1RCDA 5ERJA 3R2KA 2C6RA 4PGKA 4LQNA 3IQ1A 1H96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5P A;  2BW1 A;  3BT5 A;  3AF9 X;  2CLU A;  2V2L A;  1JYB A;  2JD6 0;  3R2O A;  1MFR A;  4CYB A;  3GE4 A;  3RE7 A;  4LYU A;  2IY4 A;  3E1N A;  2Z6M A;  1XZ3 A;  1VJX A;  2FL0 A;  1DAT A;  1GWG A;  3RD0 A;  1F30 A;  3U90 A;  3E6S A;  3E1P A;  3E1J A;  4DE6 A;  2VZB A;  4ZMC A;  1RCG A;  3QD8 A;  1YUX A;  2JD7 0;  5J9V A;  4TOH A;  3PWF A;  1XZ1 A;  3AJP A;  2V2P A;  4DAS A;  5ERK A;  4RC5 B;  3KXU A;  5HJH A;  2UX1 A;  1HRS A;  4RC7 B;  3ES3 A;  3KA6 A;  2IB0 A;  3Q4Q A;  5J8W A;  5FFC A;  1DPS A;  1YUZ A;  4PG1 A;  5GN8 B;  4RC5 A;  4ITT A;  1IES A;  4CVT A;  3E1Q A;  4RC7 A;  5JAC A;  3AF7 X;  4MN9 A;  3SE1 A;  4E6K A;  5J93 A;  1R03 A;  2ITB A;  1Z4A A;  5JKM A;  3KA3 A;  5GN8 A;  3IS8 A;  1O9I A;  1Z6O A;  1O9R A;  2PYB A;  5GU0 X;  5GU3 X;  3R2R A;  2GYD A;  3WVU A;  1LKP A;  2Y3Q A;  3VNX A;  2V2S A;  5LG8 A;  4ZJK A;  3OGH A;  4XKT A;  1S30 A;  1UMN A;  3F35 A;  5GU1 X;  1RYT A;  3A9Q A;  5AXS A;  3QZ3 A;  2Z5Q A;  3Q4O A;  3PVT B;  3NP2 X;  4CVR A;  1LKM A;  4CMY A;  2VXX A;  1TJO A;  5JKL G;  4REU A;  4CVS A;  3PVT A;  3F36 A;  1NF4 A;  2IU2 A;  3R2S A;  1UVH A;  4KVQ A;  5E1U A;  3PW8 C;  1S3Q A;  4ZKW A;  4DYY A;  1DVB A;  1VLG A;  1TKO A;  5GU2 X;  4ZKH A;  5D8O A;  4TW3 A;  2CEI A;  2RBD A;  2HR5 A;  3EZ0 A;  4DYZ A;  1YV1 A;  3PVY B;  2GYQ A;  4ZKX A;  3ISF A;  3OJ5 A;  1ZS3 A;  4LQJ A;  2XJN A;  2QQY A;  1MOJ A;  3A68 A;  3BVK A;  4EVB A;  4DYX A;  1ZUJ A;  3PVY A;  3FVB A;  3R2L A;  1TKP A;  3F39 A;  2V15 A;  3Q4N A;  1RCI A;  4XGS A;  3SID A;  4MUD A;  4LQV A;  1VEI A;  1L8H A;  2WLA A;  3R2M A;  3RAV A;  2C2F A;  5E2D A;  2V2M A;  2BK6 A;  5K52 A;  2WTL A;  1BCF A;  5D8R A;  1B71 A;  2CLB A;  4LPM A;  4EVC A;  5K53 A;  3Q4R A;  2ZA6 A;  5J8S A;  3WVW A;  5GOU A;  2YJJ A;  2HTN A;  4IWK A;  3F37 A;  2CHI A;  2ZA8 A;  4QUW A;  1AEW A;  4EVE A;  2C2U A;  1Z6O M;  5C6F A;  4EVD A;  3O7S A;  4PGI A;  2XJO A;  3WNW A;  4IXK A;  3QVD A;  2BJY A;  2FJC A;  3BVF A;  4TOD A;  3SHX A;  3AJQ A;  3T9J A;  4RC8 A;  4YKH A;  4Y08 A;  3H7G A;  3HIU A;  3E1O A;  3BVI A;  2BKC A;  5LBH A;  1OTK A;  1JIG A;  2WLU A;  1JKU A;  5IX6 A;  4Z3B A;  5HJF A;  3UOF A;  4DYU A;  3F34 A;  4TOC A;  5I4J A;  3AK9 A;  3R2H A;  2V2N A;  3E2C A;  3F32 A;  1N1Q A;  3KX9 A;  2YJK A;  3PVR B;  5LS9 A;  3PWQ C;  4IWJ A;  3KWO A;  4MY7 A;  3ISE A;  4LYX A;  4ML5 A;  3MPS A;  4M32 A;  2FG8 A;  2CN6 A;  3KA9 A;  3HL1 A;  5CZU A;  3FSE A;  4MJY A;  1JGC A;  2ZUR X;  3GHQ A;  3PVR A;  5CMQ A;  2XJM A;  1JI4 A;  3AK8 A;  4CMY V;  1RCC A;  4ZL6 A;  1QGH A;  4CY9 A;  3QHB A;  4LPJ A;  3E1M A;  4PG0 A;  3O7R A;  2CHP A;  1L8I A;  5FFD A;  3SH6 A;  2CN7 A;  4ERU A;  1VEL A;  5FFE A;  2FHA A;  2G4H A;  3AJO A;  5CMR A;  1VEQ A;  3BVL A;  5LG2 A;  3FI6 A;  2C2J A;  4XKS A;  3BVE A;  3QB9 A;  5FEJ A;  4RC6 B;  4AM5 A;  4OYN A;  4DI0 A;  2X17 0;  3AF8 X;  4AM2 A;  5JKM G;  1NF6 A;  3F38 A;  4CYA A;  2FZF A;  2OC5 A;  3GVY A;  1RCE A;  4RC6 A;  2XKQ A;  4M34 A;  3EGM A;  1FHA A;  5D8X A;  4TOB A;  2ZG7 X;  4R42 A;  4ZTT A;  3E6R A;  2V2R A;  4TOF A;  4TO9 A;  4KVS A;  1KRQ A;  1JTS A;  4DZ0 A;  5JKL A;  1S2Z A;  2CF7 A;  1NNQ A;  4CVP A;  2FFX J;  4MKU A;  3IS7 A;  4TOE A;  3F33 A;  1F33 A;  1QYB A;  3RBC A;  3KA4 A;  2XGW A;  4LQH A;  1NFV A;  2ZG9 X;  3UNO A;  4XKU A;  4ZLW A;  2FG4 A;  4M33 A;  2ZG8 X;  4KVR A;  1TK6 A;  3PWQ A;  3BKN A;  5D8Y A;  2JD8 0;  3ERZ A;  3PW1 B;  4AM4 A;  1SOF A;  3QHC A;  3TA8 A;  4ISP A;  2D5K A;  2YW7 A;  2ZA7 A;  1JKV A;  3PW8 A;  3PZA A;  4M35 A;  2V2O A;  3WVV A;  1JRE A;  3KA8 A;  1JI5 A;  3PW1 A;  1BFR A;  5FFA A;  2OH3 A;  2FKZ A;  2Z5R A;  2V2J A;  3RGD A;  2VXI A;  4ETR A;  2YW6 A;  5D8S A;  3NP0 X;  4ZL5 A;  4Z5S A;  2C41 A;  2V2I A;  4ITW A;  2GS4 A;  4II4 B;  2F7N A;  1LB3 A;  1SQ3 A;  2W0O A;  2CIH A;  3UOI A;  1EUM A;  4TOG A;  3EZU A;  3NOZ X;  1BG7 A;  1LKO A;  1J30 A;  4II4 A;  5FFB A;  4P18 A;  1IER A;  2Z90 A;  4U3G A;  4ISM A;  5HQO A;  4TOA A;  5D8P A;  2QF9 A;  4LPN A;  5D8Q A;  4A25 A;  3E1L A;  1RCD A;  5ERJ A;  3R2K A;  2C6R A;  4PGK A;  4LQN A;  3IQ1 A;  1H96 A; 
#chains in the Genus database with same CATH topology
 4W4K B;  2Z5P A;  2BW1 A;  3BT5 A;  3AF9 X;  2CLU A;  2V2L A;  1JYB A;  2JD6 0;  3R2O A;  1MFR A;  4CYB A;  3GE4 A;  3RE7 A;  4LYU A;  2IY4 A;  3E1N A;  3GGZ A;  2Z6M A;  1XZ3 A;  1VJX A;  2FL0 A;  1DAT A;  1GWG A;  3RD0 A;  1F30 A;  3U90 A;  3E6S A;  3E1P A;  3E1J A;  4DE6 A;  2VZB A;  4ZMC A;  1RCG A;  3QD8 A;  1YUX A;  2JD7 0;  5J9V A;  4TOH A;  3PWF A;  1XZ1 A;  3AJP A;  2V2P A;  4DAS A;  5ERK A;  4RC5 B;  3KXU A;  5HJH A;  3DBY A;  2UX1 A;  1HRS A;  4YVZ A;  4RC7 B;  3ES3 A;  3KA6 A;  2IB0 A;  3Q4Q A;  5J8W A;  5FFC A;  1DPS A;  1YUZ A;  4PG1 A;  5GN8 B;  4RC5 A;  4ITT A;  1IES A;  4CVT A;  3E1Q A;  2V8T A;  4RC7 A;  3LKD A;  5JAC A;  3AF7 X;  4MN9 A;  3SE1 A;  4E6K A;  5J93 A;  2MGY A;  1R03 A;  2ITB A;  1Z4A A;  5JKM A;  3KA3 A;  5GN8 A;  3IS8 A;  1O9I A;  1Z6O A;  1O9R A;  2PYB A;  5GU0 X;  5GU3 X;  3R2R A;  2GYD A;  3WVU A;  1LKP A;  2Y3Q A;  3VNX A;  2V2S A;  5LG8 A;  4ZJK A;  3OGH A;  4XKT A;  1S30 A;  1UMN A;  3F35 A;  5GU1 X;  1RYT A;  3A9Q A;  3VVA A;  5AXS A;  3VV9 A;  3QZ3 A;  2Z5Q A;  3Q4O A;  3PVT B;  3NP2 X;  4CVR A;  1LKM A;  4CMY A;  2VXX A;  1TJO A;  5JKL G;  4REU A;  4CVS A;  3PVT A;  3F36 A;  1NF4 A;  2IU2 A;  3R2S A;  4YXM A;  1UVH A;  4KVQ A;  5E1U A;  3PW8 C;  1S3Q A;  4ZKW A;  4DYY A;  1DVB A;  1VLG A;  1TKO A;  5GU2 X;  4ZKH A;  5D8O A;  4TW3 A;  2CEI A;  2RBD A;  2HR5 A;  3EZ0 A;  4DYZ A;  1YV1 A;  3PVY B;  2GYQ A;  2OKC A;  4ZKX A;  3ISF A;  3OJ5 A;  1ZS3 A;  4LQJ A;  2XJN A;  2QQY A;  1MOJ A;  3JZ9 A;  3JZA B;  3A68 A;  3BVK A;  4EVB A;  4DYX A;  1ZUJ A;  3PVY A;  3FVB A;  3R2L A;  1TKP A;  3F39 A;  5JDO B;  2V15 A;  3Q4N A;  1RCI A;  4XGS A;  3SID A;  4MUD A;  4LQV A;  1VEI A;  4E40 A;  1L8H A;  2WLA A;  3R2M A;  3RAV A;  2C2F A;  5E2D A;  2V2M A;  5JDO A;  2BK6 A;  5K52 A;  2WTL A;  1BCF A;  5D8R A;  1B71 A;  2CLB A;  4LPM A;  4EVC A;  5K53 A;  3Q4R A;  2ZA6 A;  5J8S A;  3WVW A;  5GOU A;  2YJJ A;  2HTN A;  4IWK A;  3F37 A;  2CHI A;  2ZA8 A;  3D19 A;  3N6O A;  1AEW A;  4QUW A;  4EVE A;  2C2U A;  1Z6O M;  5C6F A;  2G38 B;  4KXR B;  2WWX B;  4EVD A;  3O7S A;  4PGI A;  2XJO A;  3WNW A;  4IXK A;  3QVD A;  2BJY A;  2FJC A;  3BVF A;  3KHK A;  4TOD A;  3SHX A;  3AJQ A;  3T9J A;  3KDQ A;  4RC8 A;  4YKH A;  3GGY A;  4Y08 A;  3H7G A;  3HIU A;  3E1O A;  3BVI A;  2BKC A;  5LBH A;  1OTK A;  1JIG A;  2WLU A;  1JKU A;  5IX6 A;  4Z3B A;  5HJF A;  3UOF A;  4DYU A;  3F34 A;  4TOC A;  5I4J A;  3C23 A;  3AK9 A;  3R2H A;  2V2N A;  3E2C A;  3F32 A;  3FRS A;  3L0M A;  1N1Q A;  3KX9 A;  2YJK A;  3PVR B;  5LS9 A;  3PWQ C;  4IWJ A;  3KWO A;  3W54 A;  2CWL A;  4MY7 A;  3ISE A;  4LYX A;  4ML5 A;  3MPS A;  4M32 A;  2FG8 A;  2CN6 A;  3KA9 A;  3HL1 A;  5CZU A;  3FSE A;  4MJY A;  3M6J A;  1JGC A;  2ZUR X;  3GHQ A;  3PVR A;  5CMQ A;  2XJM A;  1JI4 A;  3AK8 A;  4CMY V;  1RCC A;  4ZL6 A;  1QGH A;  4CY9 A;  3QHB A;  4LPJ A;  3E1M A;  4PG0 A;  3O7R A;  2CHP A;  1L8I A;  5FFD A;  3SH6 A;  2CN7 A;  4ERU A;  1VEL A;  5FFE A;  2FHA A;  2G4H A;  3AJO A;  5CMR A;  1VEQ A;  3BVL A;  4W4L B;  5LG2 A;  3FI6 A;  2C2J A;  4XKS A;  3BVE A;  3QB9 A;  5FEJ A;  4RC6 B;  4AM5 A;  4OYN A;  4DI0 A;  2X17 0;  3AF8 X;  4AM2 A;  5JKM G;  1NF6 A;  4X0J A;  3F38 A;  4CYA A;  2Y44 A;  2FZF A;  2OC5 A;  3GVY A;  1RCE A;  4MXP A;  4RC6 A;  2XKQ A;  4M34 A;  3EGM A;  1FHA A;  5D8X A;  4TOB A;  4YXJ A;  2ZG7 X;  4R42 A;  3C1Z A;  4ZTT A;  3E6R A;  2V2R A;  4TOF A;  4TO9 A;  4KVS A;  1KRQ A;  1JTS A;  4DZ0 A;  5JKL A;  1S2Z A;  2CF7 A;  3C1Y A;  1NNQ A;  4CVP A;  2FFX J;  4MKU A;  3IS7 A;  4TOE A;  3F33 A;  1F33 A;  1QYB A;  3RBC A;  3KA4 A;  2XGW A;  4LQH A;  1NFV A;  5HU6 D;  2ZG9 X;  3UNO A;  4XKU A;  4ZLW A;  2FG4 A;  4M33 A;  2ZG8 X;  4KVR A;  1TK6 A;  3C21 A;  3PWQ A;  3BKN A;  5D8Y A;  2JD8 0;  3ERZ A;  4WJG 4;  3PW1 B;  4AM4 A;  1SOF A;  3QHC A;  3TA8 A;  3FRR A;  4ISP A;  2D5K A;  2YW7 A;  2ZA7 A;  1JKV A;  3PW8 A;  3PZA A;  4M35 A;  2N02 A;  2V2O A;  2AR0 A;  3WVV A;  1JRE A;  3KA8 A;  1JI5 A;  3PW1 A;  1BFR A;  5FFA A;  2OH3 A;  2FKZ A;  2Z5R A;  2V2J A;  3RGD A;  2VXI A;  4ETR A;  2YW6 A;  5D8S A;  3NP0 X;  4ZL5 A;  4Z5S A;  3V3K B;  2V8U A;  3UFB A;  2C41 A;  2V2I A;  4ITW A;  2GS4 A;  4II4 B;  2F7N A;  1LB3 A;  1SQ3 A;  2W0O A;  2CIH A;  3UOI A;  1EUM A;  4TOG A;  3EZU A;  3NOZ X;  1BG7 A;  1LKO A;  1J30 A;  4II4 A;  5FFB A;  4P18 A;  1IER A;  2Z90 A;  4U3G A;  4ISM A;  5HQO A;  4TOA A;  5D8P A;  2QF9 A;  4LPN A;  5D8Q A;  4A25 A;  3E1L A;  1RCD A;  5ERJ A;  3R2K A;  2C6R A;  4PGK A;  4LQN A;  3IQ1 A;  1H96 A; 
#chains in the Genus database with same CATH homology
 4W4K B;  2Z5P A;  2BW1 A;  3BT5 A;  3AF9 X;  2CLU A;  2V2L A;  1JYB A;  2JD6 0;  3R2O A;  1MFR A;  4CYB A;  3GE4 A;  3RE7 A;  4LYU A;  2IY4 A;  3E1N A;  3GGZ A;  2Z6M A;  1XZ3 A;  1VJX A;  2FL0 A;  1DAT A;  1GWG A;  3RD0 A;  1F30 A;  3U90 A;  3E6S A;  3E1P A;  3E1J A;  4DE6 A;  2VZB A;  4ZMC A;  1RCG A;  3QD8 A;  1YUX A;  2JD7 0;  5J9V A;  4TOH A;  3PWF A;  1XZ1 A;  3AJP A;  2V2P A;  4DAS A;  5ERK A;  4RC5 B;  3KXU A;  5HJH A;  3DBY A;  2UX1 A;  1HRS A;  4YVZ A;  4RC7 B;  3ES3 A;  3KA6 A;  2IB0 A;  3Q4Q A;  5J8W A;  5FFC A;  1DPS A;  1YUZ A;  4PG1 A;  5GN8 B;  4RC5 A;  4ITT A;  1IES A;  4CVT A;  3E1Q A;  2V8T A;  4RC7 A;  3LKD A;  5JAC A;  3AF7 X;  4MN9 A;  3SE1 A;  4E6K A;  5J93 A;  2MGY A;  1R03 A;  2ITB A;  1Z4A A;  5JKM A;  3KA3 A;  5GN8 A;  3IS8 A;  1O9I A;  1Z6O A;  1O9R A;  2PYB A;  5GU0 X;  5GU3 X;  3R2R A;  2GYD A;  3WVU A;  1LKP A;  2Y3Q A;  3VNX A;  2V2S A;  5LG8 A;  4ZJK A;  3OGH A;  4XKT A;  1S30 A;  1UMN A;  3F35 A;  5GU1 X;  1RYT A;  3A9Q A;  3VVA A;  5AXS A;  3VV9 A;  3QZ3 A;  2Z5Q A;  3Q4O A;  3PVT B;  3NP2 X;  4CVR A;  1LKM A;  4CMY A;  2VXX A;  1TJO A;  5JKL G;  4REU A;  4CVS A;  3PVT A;  3F36 A;  1NF4 A;  2IU2 A;  3R2S A;  4YXM A;  1UVH A;  4KVQ A;  5E1U A;  3PW8 C;  1S3Q A;  4ZKW A;  4DYY A;  1DVB A;  1VLG A;  1TKO A;  5GU2 X;  4ZKH A;  5D8O A;  4TW3 A;  2CEI A;  2RBD A;  2HR5 A;  3EZ0 A;  4DYZ A;  1YV1 A;  3PVY B;  2GYQ A;  2OKC A;  4ZKX A;  3ISF A;  3OJ5 A;  1ZS3 A;  4LQJ A;  2XJN A;  2QQY A;  1MOJ A;  3JZ9 A;  3JZA B;  3A68 A;  3BVK A;  4EVB A;  4DYX A;  1ZUJ A;  3PVY A;  3FVB A;  3R2L A;  1TKP A;  3F39 A;  5JDO B;  2V15 A;  3Q4N A;  1RCI A;  4XGS A;  3SID A;  4MUD A;  4LQV A;  1VEI A;  4E40 A;  1L8H A;  2WLA A;  3R2M A;  3RAV A;  2C2F A;  5E2D A;  2V2M A;  5JDO A;  2BK6 A;  5K52 A;  2WTL A;  1BCF A;  5D8R A;  1B71 A;  2CLB A;  4LPM A;  4EVC A;  5K53 A;  3Q4R A;  2ZA6 A;  5J8S A;  3WVW A;  5GOU A;  2YJJ A;  2HTN A;  4IWK A;  3F37 A;  2CHI A;  2ZA8 A;  3D19 A;  3N6O A;  1AEW A;  4QUW A;  4EVE A;  2C2U A;  1Z6O M;  5C6F A;  2G38 B;  4KXR B;  2WWX B;  4EVD A;  3O7S A;  4PGI A;  2XJO A;  3WNW A;  4IXK A;  3QVD A;  2BJY A;  2FJC A;  3BVF A;  3KHK A;  4TOD A;  3SHX A;  3AJQ A;  3T9J A;  3KDQ A;  4RC8 A;  4YKH A;  3GGY A;  4Y08 A;  3H7G A;  3HIU A;  3E1O A;  3BVI A;  2BKC A;  5LBH A;  1OTK A;  1JIG A;  2WLU A;  1JKU A;  5IX6 A;  4Z3B A;  5HJF A;  3UOF A;  4DYU A;  3F34 A;  4TOC A;  5I4J A;  3C23 A;  3AK9 A;  3R2H A;  2V2N A;  3E2C A;  3F32 A;  3FRS A;  3L0M A;  1N1Q A;  3KX9 A;  2YJK A;  3PVR B;  5LS9 A;  3PWQ C;  4IWJ A;  3KWO A;  3W54 A;  2CWL A;  4MY7 A;  3ISE A;  4LYX A;  4ML5 A;  3MPS A;  4M32 A;  2FG8 A;  2CN6 A;  3KA9 A;  3HL1 A;  5CZU A;  3FSE A;  4MJY A;  3M6J A;  1JGC A;  2ZUR X;  3GHQ A;  3PVR A;  5CMQ A;  2XJM A;  1JI4 A;  3AK8 A;  4CMY V;  1RCC A;  4ZL6 A;  1QGH A;  4CY9 A;  3QHB A;  4LPJ A;  3E1M A;  4PG0 A;  3O7R A;  2CHP A;  1L8I A;  5FFD A;  3SH6 A;  2CN7 A;  4ERU A;  1VEL A;  5FFE A;  2FHA A;  2G4H A;  3AJO A;  5CMR A;  1VEQ A;  3BVL A;  4W4L B;  5LG2 A;  3FI6 A;  2C2J A;  4XKS A;  3BVE A;  3QB9 A;  5FEJ A;  4RC6 B;  4AM5 A;  4OYN A;  4DI0 A;  2X17 0;  3AF8 X;  4AM2 A;  5JKM G;  1NF6 A;  4X0J A;  3F38 A;  4CYA A;  2Y44 A;  2FZF A;  2OC5 A;  3GVY A;  1RCE A;  4MXP A;  4RC6 A;  2XKQ A;  4M34 A;  3EGM A;  1FHA A;  5D8X A;  4TOB A;  4YXJ A;  2ZG7 X;  4R42 A;  3C1Z A;  4ZTT A;  3E6R A;  2V2R A;  4TOF A;  4TO9 A;  4KVS A;  1KRQ A;  1JTS A;  4DZ0 A;  5JKL A;  1S2Z A;  2CF7 A;  3C1Y A;  1NNQ A;  4CVP A;  2FFX J;  4MKU A;  3IS7 A;  4TOE A;  3F33 A;  1F33 A;  1QYB A;  3RBC A;  3KA4 A;  2XGW A;  4LQH A;  1NFV A;  5HU6 D;  2ZG9 X;  3UNO A;  4XKU A;  4ZLW A;  2FG4 A;  4M33 A;  2ZG8 X;  4KVR A;  1TK6 A;  3C21 A;  3PWQ A;  3BKN A;  5D8Y A;  2JD8 0;  3ERZ A;  4WJG 4;  3PW1 B;  4AM4 A;  1SOF A;  3QHC A;  3TA8 A;  3FRR A;  4ISP A;  2D5K A;  2YW7 A;  2ZA7 A;  1JKV A;  3PW8 A;  3PZA A;  4M35 A;  2N02 A;  2V2O A;  2AR0 A;  3WVV A;  1JRE A;  3KA8 A;  1JI5 A;  3PW1 A;  1BFR A;  5FFA A;  2OH3 A;  2FKZ A;  2Z5R A;  2V2J A;  3RGD A;  2VXI A;  4ETR A;  2YW6 A;  5D8S A;  3NP0 X;  4ZL5 A;  4Z5S A;  3V3K B;  2V8U A;  3UFB A;  2C41 A;  2V2I A;  4ITW A;  2GS4 A;  4II4 B;  2F7N A;  1LB3 A;  1SQ3 A;  2W0O A;  2CIH A;  3UOI A;  1EUM A;  4TOG A;  3EZU A;  3NOZ X;  1BG7 A;  1LKO A;  1J30 A;  4II4 A;  5FFB A;  4P18 A;  1IER A;  2Z90 A;  4U3G A;  4ISM A;  5HQO A;  4TOA A;  5D8P A;  2QF9 A;  4LPN A;  5D8Q A;  4A25 A;  3E1L A;  1RCD A;  5ERJ A;  3R2K A;  2C6R A;  4PGK A;  4LQN A;  3IQ1 A;  1H96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...