2BW1A

Iron-bound crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
151
structure length
151
Chain Sequence
LADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peroxide resistance
molecule keywords DPS-LIKE PEROXIDE RESISTANCE PROTEIN
publication title Iron incorporation in Streptococcus suis Dps-like peroxide resistance protein Dpr requires mobility in the ferroxidase center and leads to the formation of a ferrihydrite-like core.
pubmed doi rcsb
source organism Streptococcus suis
total genus 68
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2bw1A00
5JKMG 2CLBA 2Z5RA 4MJYA 1ZUJA 3AJPA 4M33A 1VEQA 4A25A 3F39A 2OH3A 3FI6A 3WNWA 3AF7X 4PGIA 1HRSA 3PVYB 3E1JA 1GWGA 2WLUA 3RAVA 3OJ5A 3AK8A 4PGKA 1JTSA 5HJHA 1IESA 4II4A 5FFDA 1YV1A 3KA3A 3R2RA 4PG0A 1OTKA 3PZAA 3GVYA 2X170 3AF9X 4DYUA 4LQHA 3KA8A 4M32A 3U90A 2FZFA 2RBDA 5AXSA 3KA4A 3E1QA 3TA8A 4IWJA 1TK6A 3BVLA 4CY9A 3E6SA 3UOFA 5D8RA 1NF4A 3PVTB 1DATA 3E6RA 4XKSA 2UX1A 1RYTA 1L8IA 1TKOA 5IX6A 2ZA8A 5GU3X 4ISMA 2BW1A 4KVRA 3NP0X 4LPJA 4AM5A 3E1PA 1TJOA 5CMRA 1F30A 3WVWA 3PVTA 1YUZA 1NNQA 3PWQA 3AK9A 4ZKHA 3EZUA 2VXXA 1O9IA 2IU2A 4LQVA 3NOZX 4CVPA 3HIUA 3O7SA 2JD70 4LPMA 4ZKXA 4Z3BA 4TOEA 2JD60 5D8PA 4KVSA 2XJNA 3PW8A 2IY4A 1N1QA 5JACA 3IS7A 3EGMA 3R2SA 3R2KA 4ZL6A 2V2LA 2Z5PA 3E1LA 4CYBA 3QB9A 4Y08A 3A68A 3Q4NA 3UNOA 1UVHA 3H7GA 4ERUA 4MY7A 1FHAA 1JKVA 2V2RA 4ITWA 4REUA 5GU2X 4TO9A 2GYDA 3IS8A 3PWFA 2C6RA 5C6FA 3BKNA 3E1NA 4P18A 4TOHA 5ERKA 2FG4A 5FFCA 2QQYA 4EVCA 1H96A 2V15A 4RC6A 5J93A 5J8WA 3FSEA 1KRQA 1S30A 2CLUA 1LB3A 3RE7A 3SHXA 2V2OA 4ZLWA 2F7NA 4AM2A 2C2FA 4LPNA 3PVYA 2VZBA 4U3GA 3R2MA 2CF7A 4ZKWA 4DASA 3O7RA 4CVTA 1RCIA 3R2OA 5K53A 1VELA 4ITTA 2GYQA 3BVKA 2XGWA 3WVUA 2CHPA 3ERZA 1L8HA 3GE4A 4TOCA 3PVRB 1XZ1A 2CN7A 4ML5A 2YW6A 5JKLG 4Z5SA 2VXIA 3QHBA 1NFVA 3QZ3A 4QUWA 4TOFA 3SH6A 4TOAA 3Q4QA 3E1MA 2Z6MA 3BT5A 4R42A 2Z90A 4RC5B 4CVSA 5LBHA 1YUXA 3QD8A 1Z6OM 1F33A 3KWOA 1JI4A 3PVRA 1VJXA 4KVQA 3OGHA 5D8OA 4XKTA 3IQ1A 2V2JA 5CMQA 5GU1X 4XKUA 4ZJKA 3PW1B 2C2JA 1XZ3A 3ISEA 2OC5A 3AJOA 3F36A 4RC5A 4PG1A 4DZ0A 4EVBA 5ERJA 4DYZA 3RD0A 2PYBA 3VNXA 2GS4A 4CYAA 1JYBA 3PWQC 2D5KA 2V2NA 1MFRA 2ZG8X 2CEIA 4RC8A 3PW1A 2IB0A 5HJFA 1VEIA 2XJMA 3SE1A 3KX9A 1R03A 4DYYA 3WVVA 2ZURX 1BG7A 1ZS3A 3EZ0A 3SIDA 1RCCA 1Z4AA 5GU0X 3F34A 3F35A 1RCDA 4CVRA 2BJYA 2C41A 1UMNA 1MOJA 5FFAA 5D8SA 5E1UA 2C2UA 3GHQA 3BVIA 4EVEA 1VLGA 1RCGA 3E1OA 2ZA6A 5J8SA 5I4JA 3RGDA 2QF9A 4TOGA 5GN8B 2ZG9X 1DVBA 5CZUA 2HR5A 2Z5QA 2YJJA 4IXKA 1QGHA 3Q4RA 2CHIA 2YJKA 4OYNA 3KXUA 2V2MA 4EVDA 1RCEA 5D8QA 2FL0A 5GOUA 3R2HA 4M34A 4MUDA 3QVDA 4LQNA 1SQ3A 1JKUA 4ZL5A 5GN8A 4DI0A 1JIGA 4IWKA 1JGCA 3NP2X 4AM4A 4XGSA 1NF6A 2V2PA 3F33A 1B71A 5JKMA 4CMYV 4ZMCA 5LG8A 2CIHA 1IERA 2W0OA 4RC7B 1Z6OA 3ISFA 4TODA 3BVFA 3BVEA 1AEWA 3KA6A 3UOIA 1QYBA 1O9RA 3QHCA 2ZG7X 1BCFA 1BFRA 5D8XA 4RC7A 2V2IA 3Q4OA 3RBCA 2FHAA 1LKPA 2ITBA 3MPSA 5LG2A 3AF8X 4E6KA 1J30A 4M35A 5D8YA 2FKZA 4MKUA 4DYXA 2FFXJ 2FJCA 2FG8A 5J9VA 4LYXA 5JKLA 2G4HA 5FFEA 2WTLA 4MN9A 2BKCA 3ES3A 1EUMA 3R2LA 4LYUA 1SOFA 5FFBA 2XKQA 4ETRA 2BK6A 1LKOA 4TW3A 3F38A 1JI5A 2HTNA 3F32A 3PW8C 3E2CA 5E2DA 3F37A 3FVBA 5LS9A 4LQJA 4ZTTA 1TKPA 2XJOA 1S3QA 4YKHA 5K52A 4TOBA 2CN6A 2ZA7A 4RC6B 1LKMA 2JD80 3KA9A 3AJQA 2V2SA 5HQOA 3A9QA 3HL1A 2WLAA 4DE6A 4II4B 5FEJA 1JREA 4ISPA 1S2ZA 2Y3QA 2YW7A 3T9JA 1DPSA 4CMYA
chains in the Genus database with same CATH superfamily
5JKMG 2CLBA 2Z5RA 4MJYA 1ZUJA 3AJPA 4M33A 1VEQA 4A25A 3F39A 2OH3A 3FI6A 3D19A 3WNWA 3AF7X 4PGIA 4YVZA 1HRSA 3PVYB 3E1JA 1GWGA 2WLUA 3RAVA 3OJ5A 3AK8A 4PGKA 1JTSA 5HJHA 1IESA 4II4A 5FFDA 1YV1A 3VVAA 3KA3A 3R2RA 4PG0A 5JDOB 1OTKA 3DBYA 3PZAA 3GVYA 2X170 3AF9X 4DYUA 4LQHA 2V8UA 3KA8A 4M32A 3U90A 2FZFA 2RBDA 5AXSA 3KA4A 3E1QA 3TA8A 4IWJA 1TK6A 3BVLA 4CY9A 3E6SA 3UOFA 5JDOA 5D8RA 1NF4A 3PVTB 1DATA 3C1YA 3E6RA 4XKSA 2UX1A 1RYTA 1L8IA 1TKOA 4E40A 5IX6A 2ZA8A 2N02A 4YXMA 5GU3X 4ISMA 3L0MA 2BW1A 4KVRA 3NP0X 4LPJA 3M6JA 3VV9A 4AM5A 3E1PA 3C1ZA 1TJOA 5CMRA 1F30A 3WVWA 3PVTA 1YUZA 1NNQA 3PWQA 3AK9A 4ZKHA 3EZUA 2VXXA 1O9IA 2IU2A 4LQVA 3NOZX 4CVPA 3HIUA 3O7SA 2JD70 4LPMA 4ZKXA 4Z3BA 4TOEA 2JD60 5D8PA 4KVSA 2XJNA 3PW8A 3FRRA 2IY4A 3GGZA 1N1QA 5JACA 2G38B 3IS7A 3EGMA 3R2SA 3R2KA 4ZL6A 2V2LA 2Z5PA 3E1LA 4W4LB 4CYBA 3QB9A 4Y08A 3A68A 3Q4NA 3UNOA 1UVHA 3H7GA 4ERUA 4MY7A 1FHAA 1JKVA 2V2RA 4ITWA 4REUA 5GU2X 4TO9A 2GYDA 3IS8A 3PWFA 2C6RA 5C6FA 3BKNA 3E1NA 4P18A 4TOHA 5ERKA 2FG4A 5FFCA 2QQYA 4EVCA 1H96A 2V15A 4RC6A 5J93A 4WJG4 5J8WA 3FSEA 4X0JA 1KRQA 1S30A 2CLUA 1LB3A 3RE7A 3SHXA 2V2OA 4ZLWA 2F7NA 4AM2A 2C2FA 3JZAB 4LPNA 3PVYA 2VZBA 4U3GA 3R2MA 2CF7A 4ZKWA 4DASA 3O7RA 4CVTA 1RCIA 3R2OA 5K53A 1VELA 4ITTA 2GYQA 3BVKA 2XGWA 3WVUA 2CHPA 3ERZA 1L8HA 2V8TA 3GE4A 4TOCA 3PVRB 1XZ1A 2CN7A 4ML5A 2Y44A 2YW6A 5JKLG 4Z5SA 2VXIA 3QHBA 1NFVA 3QZ3A 4QUWA 4TOFA 3SH6A 4TOAA 3Q4QA 3E1MA 2Z6MA 3BT5A 3UFBA 4R42A 2Z90A 3V3KB 4RC5B 4CVSA 5LBHA 1YUXA 3QD8A 1Z6OM 1F33A 2WWXB 3KWOA 1JI4A 3PVRA 3C23A 1VJXA 4KVQA 3OGHA 5D8OA 4XKTA 3IQ1A 2V2JA 5CMQA 5GU1X 4XKUA 4ZJKA 3PW1B 2C2JA 1XZ3A 3ISEA 2OC5A 3AJOA 3F36A 4RC5A 4PG1A 4DZ0A 3KHKA 4EVBA 5ERJA 4DYZA 3RD0A 2PYBA 3VNXA 2GS4A 4CYAA 1JYBA 3PWQC 2D5KA 2V2NA 1MFRA 2ZG8X 2CEIA 4RC8A 3PW1A 2IB0A 5HJFA 1VEIA 2MGYA 2XJMA 3SE1A 3KX9A 1R03A 4DYYA 3WVVA 2CWLA 2ZURX 1BG7A 1ZS3A 3EZ0A 3SIDA 2OKCA 1RCCA 3KDQA 1Z4AA 5GU0X 3F34A 3F35A 4YXJA 1RCDA 4CVRA 2BJYA 2C41A 1UMNA 1MOJA 5FFAA 3FRSA 5D8SA 5E1UA 2C2UA 3GHQA 3BVIA 4EVEA 1VLGA 1RCGA 3E1OA 4KXRB 2ZA6A 5J8SA 5I4JA 3RGDA 2QF9A 4TOGA 5GN8B 2ZG9X 1DVBA 5CZUA 2HR5A 2Z5QA 2YJJA 4IXKA 1QGHA 3Q4RA 2CHIA 2YJKA 4OYNA 3KXUA 2V2MA 4EVDA 1RCEA 5D8QA 2FL0A 5GOUA 3R2HA 4M34A 4MUDA 3QVDA 4LQNA 1SQ3A 1JKUA 4ZL5A 5GN8A 4DI0A 1JIGA 4IWKA 1JGCA 3NP2X 4AM4A 4XGSA 1NF6A 2V2PA 3W54A 3F33A 3C21A 1B71A 5JKMA 4MXPA 4CMYV 4ZMCA 5LG8A 2CIHA 3GGYA 1IERA 2W0OA 4RC7B 1Z6OA 3ISFA 4TODA 3BVFA 3BVEA 1AEWA 3KA6A 3UOIA 1QYBA 1O9RA 3QHCA 2ZG7X 1BCFA 1BFRA 5D8XA 4RC7A 2V2IA 3LKDA 3Q4OA 3RBCA 2FHAA 1LKPA 2ITBA 3MPSA 5LG2A 3AF8X 4E6KA 1J30A 4M35A 5D8YA 2FKZA 4MKUA 4DYXA 4W4KB 2FFXJ 2FJCA 2FG8A 5J9VA 4LYXA 5JKLA 2G4HA 5FFEA 2WTLA 4MN9A 2BKCA 5HU6D 3ES3A 1EUMA 3R2LA 4LYUA 1SOFA 5FFBA 2XKQA 4ETRA 3JZ9A 2BK6A 1LKOA 4TW3A 3F38A 2AR0A 1JI5A 3N6OA 2HTNA 3F32A 3PW8C 3E2CA 5E2DA 3F37A 3FVBA 5LS9A 4LQJA 4ZTTA 1TKPA 2XJOA 1S3QA 4YKHA 5K52A 4TOBA 2CN6A 2ZA7A 4RC6B 1LKMA 2JD80 3KA9A 3AJQA 2V2SA 5HQOA 3A9QA 3HL1A 2WLAA 4DE6A 4II4B 5FEJA 1JREA 4ISPA 1S2ZA 2Y3QA 2YW7A 3T9JA 1DPSA 4CMYA
chains in the Genus database with same CATH topology
5JKMG 2CLBA 2Z5RA 4MJYA 1ZUJA 3AJPA 4M33A 1VEQA 4A25A 3F39A 2OH3A 3FI6A 3D19A 3WNWA 3AF7X 4PGIA 4YVZA 1HRSA 3PVYB 3E1JA 1GWGA 2WLUA 3RAVA 3OJ5A 3AK8A 4PGKA 1JTSA 5HJHA 1IESA 4II4A 5FFDA 1YV1A 3VVAA 3KA3A 3R2RA 4PG0A 5JDOB 1OTKA 3DBYA 3PZAA 3GVYA 2X170 3AF9X 4DYUA 4LQHA 2V8UA 3KA8A 4M32A 3U90A 2FZFA 2RBDA 5AXSA 3KA4A 3E1QA 3TA8A 4IWJA 1TK6A 3BVLA 4CY9A 3E6SA 3UOFA 5JDOA 5D8RA 1NF4A 3PVTB 1DATA 3C1YA 3E6RA 4XKSA 2UX1A 1RYTA 1L8IA 1TKOA 4E40A 5IX6A 2ZA8A 2N02A 4YXMA 5GU3X 4ISMA 3L0MA 2BW1A 4KVRA 3NP0X 4LPJA 3M6JA 3VV9A 4AM5A 3E1PA 3C1ZA 1TJOA 5CMRA 1F30A 3WVWA 3PVTA 1YUZA 1NNQA 3PWQA 3AK9A 4ZKHA 3EZUA 2VXXA 1O9IA 2IU2A 4LQVA 3NOZX 4CVPA 3HIUA 3O7SA 2JD70 4LPMA 4ZKXA 4Z3BA 4TOEA 2JD60 5D8PA 4KVSA 2XJNA 3PW8A 3FRRA 2IY4A 3GGZA 1N1QA 5JACA 2G38B 3IS7A 3EGMA 3R2SA 3R2KA 4ZL6A 2V2LA 2Z5PA 3E1LA 4W4LB 4CYBA 3QB9A 4Y08A 3A68A 3Q4NA 3UNOA 1UVHA 3H7GA 4ERUA 4MY7A 1FHAA 1JKVA 2V2RA 4ITWA 4REUA 5GU2X 4TO9A 2GYDA 3IS8A 3PWFA 2C6RA 5C6FA 3BKNA 3E1NA 4P18A 4TOHA 5ERKA 2FG4A 5FFCA 2QQYA 4EVCA 1H96A 2V15A 4RC6A 5J93A 4WJG4 5J8WA 3FSEA 4X0JA 1KRQA 1S30A 2CLUA 1LB3A 3RE7A 3SHXA 2V2OA 4ZLWA 2F7NA 4AM2A 2C2FA 3JZAB 4LPNA 3PVYA 2VZBA 4U3GA 3R2MA 2CF7A 4ZKWA 4DASA 3O7RA 4CVTA 1RCIA 3R2OA 5K53A 1VELA 4ITTA 2GYQA 3BVKA 2XGWA 3WVUA 2CHPA 3ERZA 1L8HA 2V8TA 3GE4A 4TOCA 3PVRB 1XZ1A 2CN7A 4ML5A 2Y44A 2YW6A 5JKLG 4Z5SA 2VXIA 3QHBA 1NFVA 3QZ3A 4QUWA 4TOFA 3SH6A 4TOAA 3Q4QA 3E1MA 2Z6MA 3BT5A 3UFBA 4R42A 2Z90A 3V3KB 4RC5B 4CVSA 5LBHA 1YUXA 3QD8A 1Z6OM 1F33A 2WWXB 3KWOA 1JI4A 3PVRA 3C23A 1VJXA 4KVQA 3OGHA 5D8OA 4XKTA 3IQ1A 2V2JA 5CMQA 5GU1X 4XKUA 4ZJKA 3PW1B 2C2JA 1XZ3A 3ISEA 2OC5A 3AJOA 3F36A 4RC5A 4PG1A 4DZ0A 3KHKA 4EVBA 5ERJA 4DYZA 3RD0A 2PYBA 3VNXA 2GS4A 4CYAA 1JYBA 3PWQC 2D5KA 2V2NA 1MFRA 2ZG8X 2CEIA 4RC8A 3PW1A 2IB0A 5HJFA 1VEIA 2MGYA 2XJMA 3SE1A 3KX9A 1R03A 4DYYA 3WVVA 2CWLA 2ZURX 1BG7A 1ZS3A 3EZ0A 3SIDA 2OKCA 1RCCA 3KDQA 1Z4AA 5GU0X 3F34A 3F35A 4YXJA 1RCDA 4CVRA 2BJYA 2C41A 1UMNA 1MOJA 5FFAA 3FRSA 5D8SA 5E1UA 2C2UA 3GHQA 3BVIA 4EVEA 1VLGA 1RCGA 3E1OA 4KXRB 2ZA6A 5J8SA 5I4JA 3RGDA 2QF9A 4TOGA 5GN8B 2ZG9X 1DVBA 5CZUA 2HR5A 2Z5QA 2YJJA 4IXKA 1QGHA 3Q4RA 2CHIA 2YJKA 4OYNA 3KXUA 2V2MA 4EVDA 1RCEA 5D8QA 2FL0A 5GOUA 3R2HA 4M34A 4MUDA 3QVDA 4LQNA 1SQ3A 1JKUA 4ZL5A 5GN8A 4DI0A 1JIGA 4IWKA 1JGCA 3NP2X 4AM4A 4XGSA 1NF6A 2V2PA 3W54A 3F33A 3C21A 1B71A 5JKMA 4MXPA 4CMYV 4ZMCA 5LG8A 2CIHA 3GGYA 1IERA 2W0OA 4RC7B 1Z6OA 3ISFA 4TODA 3BVFA 3BVEA 1AEWA 3KA6A 3UOIA 1QYBA 1O9RA 3QHCA 2ZG7X 1BCFA 1BFRA 5D8XA 4RC7A 2V2IA 3LKDA 3Q4OA 3RBCA 2FHAA 1LKPA 2ITBA 3MPSA 5LG2A 3AF8X 4E6KA 1J30A 4M35A 5D8YA 2FKZA 4MKUA 4DYXA 4W4KB 2FFXJ 2FJCA 2FG8A 5J9VA 4LYXA 5JKLA 2G4HA 5FFEA 2WTLA 4MN9A 2BKCA 5HU6D 3ES3A 1EUMA 3R2LA 4LYUA 1SOFA 5FFBA 2XKQA 4ETRA 3JZ9A 2BK6A 1LKOA 4TW3A 3F38A 2AR0A 1JI5A 3N6OA 2HTNA 3F32A 3PW8C 3E2CA 5E2DA 3F37A 3FVBA 5LS9A 4LQJA 4ZTTA 1TKPA 2XJOA 1S3QA 4YKHA 5K52A 4TOBA 2CN6A 2ZA7A 4RC6B 1LKMA 2JD80 3KA9A 3AJQA 2V2SA 5HQOA 3A9QA 3HL1A 2WLAA 4DE6A 4II4B 5FEJA 1JREA 4ISPA 1S2ZA 2Y3QA 2YW7A 3T9JA 1DPSA 4CMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JKM G;  2CLB A;  2Z5R A;  4MJY A;  1ZUJ A;  3AJP A;  4M33 A;  1VEQ A;  4A25 A;  3F39 A;  2OH3 A;  3FI6 A;  3WNW A;  3AF7 X;  4PGI A;  1HRS A;  3PVY B;  3E1J A;  1GWG A;  2WLU A;  3RAV A;  3OJ5 A;  3AK8 A;  4PGK A;  1JTS A;  5HJH A;  1IES A;  4II4 A;  5FFD A;  1YV1 A;  3KA3 A;  3R2R A;  4PG0 A;  1OTK A;  3PZA A;  3GVY A;  2X17 0;  3AF9 X;  4DYU A;  4LQH A;  3KA8 A;  4M32 A;  3U90 A;  2FZF A;  2RBD A;  5AXS A;  3KA4 A;  3E1Q A;  3TA8 A;  4IWJ A;  1TK6 A;  3BVL A;  4CY9 A;  3E6S A;  3UOF A;  5D8R A;  1NF4 A;  3PVT B;  1DAT A;  3E6R A;  4XKS A;  2UX1 A;  1RYT A;  1L8I A;  1TKO A;  5IX6 A;  2ZA8 A;  5GU3 X;  4ISM A;  2BW1 A;  4KVR A;  3NP0 X;  4LPJ A;  4AM5 A;  3E1P A;  1TJO A;  5CMR A;  1F30 A;  3WVW A;  3PVT A;  1YUZ A;  1NNQ A;  3PWQ A;  3AK9 A;  4ZKH A;  3EZU A;  2VXX A;  1O9I A;  2IU2 A;  4LQV A;  3NOZ X;  4CVP A;  3HIU A;  3O7S A;  2JD7 0;  4LPM A;  4ZKX A;  4Z3B A;  4TOE A;  2JD6 0;  5D8P A;  4KVS A;  2XJN A;  3PW8 A;  2IY4 A;  1N1Q A;  5JAC A;  3IS7 A;  3EGM A;  3R2S A;  3R2K A;  4ZL6 A;  2V2L A;  2Z5P A;  3E1L A;  4CYB A;  3QB9 A;  4Y08 A;  3A68 A;  3Q4N A;  3UNO A;  1UVH A;  3H7G A;  4ERU A;  4MY7 A;  1FHA A;  1JKV A;  2V2R A;  4ITW A;  4REU A;  5GU2 X;  4TO9 A;  2GYD A;  3IS8 A;  3PWF A;  2C6R A;  5C6F A;  3BKN A;  3E1N A;  4P18 A;  4TOH A;  5ERK A;  2FG4 A;  5FFC A;  2QQY A;  4EVC A;  1H96 A;  2V15 A;  4RC6 A;  5J93 A;  5J8W A;  3FSE A;  1KRQ A;  1S30 A;  2CLU A;  1LB3 A;  3RE7 A;  3SHX A;  2V2O A;  4ZLW A;  2F7N A;  4AM2 A;  2C2F A;  4LPN A;  3PVY A;  2VZB A;  4U3G A;  3R2M A;  2CF7 A;  4ZKW A;  4DAS A;  3O7R A;  4CVT A;  1RCI A;  3R2O A;  5K53 A;  1VEL A;  4ITT A;  2GYQ A;  3BVK A;  2XGW A;  3WVU A;  2CHP A;  3ERZ A;  1L8H A;  3GE4 A;  4TOC A;  3PVR B;  1XZ1 A;  2CN7 A;  4ML5 A;  2YW6 A;  5JKL G;  4Z5S A;  2VXI A;  3QHB A;  1NFV A;  3QZ3 A;  4QUW A;  4TOF A;  3SH6 A;  4TOA A;  3Q4Q A;  3E1M A;  2Z6M A;  3BT5 A;  4R42 A;  2Z90 A;  4RC5 B;  4CVS A;  5LBH A;  1YUX A;  3QD8 A;  1Z6O M;  1F33 A;  3KWO A;  1JI4 A;  3PVR A;  1VJX A;  4KVQ A;  3OGH A;  5D8O A;  4XKT A;  3IQ1 A;  2V2J A;  5CMQ A;  5GU1 X;  4XKU A;  4ZJK A;  3PW1 B;  2C2J A;  1XZ3 A;  3ISE A;  2OC5 A;  3AJO A;  3F36 A;  4RC5 A;  4PG1 A;  4DZ0 A;  4EVB A;  5ERJ A;  4DYZ A;  3RD0 A;  2PYB A;  3VNX A;  2GS4 A;  4CYA A;  1JYB A;  3PWQ C;  2D5K A;  2V2N A;  1MFR A;  2ZG8 X;  2CEI A;  4RC8 A;  3PW1 A;  2IB0 A;  5HJF A;  1VEI A;  2XJM A;  3SE1 A;  3KX9 A;  1R03 A;  4DYY A;  3WVV A;  2ZUR X;  1BG7 A;  1ZS3 A;  3EZ0 A;  3SID A;  1RCC A;  1Z4A A;  5GU0 X;  3F34 A;  3F35 A;  1RCD A;  4CVR A;  2BJY A;  2C41 A;  1UMN A;  1MOJ A;  5FFA A;  5D8S A;  5E1U A;  2C2U A;  3GHQ A;  3BVI A;  4EVE A;  1VLG A;  1RCG A;  3E1O A;  2ZA6 A;  5J8S A;  5I4J A;  3RGD A;  2QF9 A;  4TOG A;  5GN8 B;  2ZG9 X;  1DVB A;  5CZU A;  2HR5 A;  2Z5Q A;  2YJJ A;  4IXK A;  1QGH A;  3Q4R A;  2CHI A;  2YJK A;  4OYN A;  3KXU A;  2V2M A;  4EVD A;  1RCE A;  5D8Q A;  2FL0 A;  5GOU A;  3R2H A;  4M34 A;  4MUD A;  3QVD A;  4LQN A;  1SQ3 A;  1JKU A;  4ZL5 A;  5GN8 A;  4DI0 A;  1JIG A;  4IWK A;  1JGC A;  3NP2 X;  4AM4 A;  4XGS A;  1NF6 A;  2V2P A;  3F33 A;  1B71 A;  5JKM A;  4CMY V;  4ZMC A;  5LG8 A;  2CIH A;  1IER A;  2W0O A;  4RC7 B;  1Z6O A;  3ISF A;  4TOD A;  3BVF A;  3BVE A;  1AEW A;  3KA6 A;  3UOI A;  1QYB A;  1O9R A;  3QHC A;  2ZG7 X;  1BCF A;  1BFR A;  5D8X A;  4RC7 A;  2V2I A;  3Q4O A;  3RBC A;  2FHA A;  1LKP A;  2ITB A;  3MPS A;  5LG2 A;  3AF8 X;  4E6K A;  1J30 A;  4M35 A;  5D8Y A;  2FKZ A;  4MKU A;  4DYX A;  2FFX J;  2FJC A;  2FG8 A;  5J9V A;  4LYX A;  5JKL A;  2G4H A;  5FFE A;  2WTL A;  4MN9 A;  2BKC A;  3ES3 A;  1EUM A;  3R2L A;  4LYU A;  1SOF A;  5FFB A;  2XKQ A;  4ETR A;  2BK6 A;  1LKO A;  4TW3 A;  3F38 A;  1JI5 A;  2HTN A;  3F32 A;  3PW8 C;  3E2C A;  5E2D A;  3F37 A;  3FVB A;  5LS9 A;  4LQJ A;  4ZTT A;  1TKP A;  2XJO A;  1S3Q A;  4YKH A;  5K52 A;  4TOB A;  2CN6 A;  2ZA7 A;  4RC6 B;  1LKM A;  2JD8 0;  3KA9 A;  3AJQ A;  2V2S A;  5HQO A;  3A9Q A;  3HL1 A;  2WLA A;  4DE6 A;  4II4 B;  5FEJ A;  1JRE A;  4ISP A;  1S2Z A;  2Y3Q A;  2YW7 A;  3T9J A;  1DPS A;  4CMY A; 
#chains in the Genus database with same CATH topology
 5JKM G;  2CLB A;  2Z5R A;  4MJY A;  1ZUJ A;  3AJP A;  4M33 A;  1VEQ A;  4A25 A;  3F39 A;  2OH3 A;  3FI6 A;  3D19 A;  3WNW A;  3AF7 X;  4PGI A;  4YVZ A;  1HRS A;  3PVY B;  3E1J A;  1GWG A;  2WLU A;  3RAV A;  3OJ5 A;  3AK8 A;  4PGK A;  1JTS A;  5HJH A;  1IES A;  4II4 A;  5FFD A;  1YV1 A;  3VVA A;  3KA3 A;  3R2R A;  4PG0 A;  5JDO B;  1OTK A;  3DBY A;  3PZA A;  3GVY A;  2X17 0;  3AF9 X;  4DYU A;  4LQH A;  2V8U A;  3KA8 A;  4M32 A;  3U90 A;  2FZF A;  2RBD A;  5AXS A;  3KA4 A;  3E1Q A;  3TA8 A;  4IWJ A;  1TK6 A;  3BVL A;  4CY9 A;  3E6S A;  3UOF A;  5JDO A;  5D8R A;  1NF4 A;  3PVT B;  1DAT A;  3C1Y A;  3E6R A;  4XKS A;  2UX1 A;  1RYT A;  1L8I A;  1TKO A;  4E40 A;  5IX6 A;  2ZA8 A;  2N02 A;  4YXM A;  5GU3 X;  4ISM A;  3L0M A;  2BW1 A;  4KVR A;  3NP0 X;  4LPJ A;  3M6J A;  3VV9 A;  4AM5 A;  3E1P A;  3C1Z A;  1TJO A;  5CMR A;  1F30 A;  3WVW A;  3PVT A;  1YUZ A;  1NNQ A;  3PWQ A;  3AK9 A;  4ZKH A;  3EZU A;  2VXX A;  1O9I A;  2IU2 A;  4LQV A;  3NOZ X;  4CVP A;  3HIU A;  3O7S A;  2JD7 0;  4LPM A;  4ZKX A;  4Z3B A;  4TOE A;  2JD6 0;  5D8P A;  4KVS A;  2XJN A;  3PW8 A;  3FRR A;  2IY4 A;  3GGZ A;  1N1Q A;  5JAC A;  2G38 B;  3IS7 A;  3EGM A;  3R2S A;  3R2K A;  4ZL6 A;  2V2L A;  2Z5P A;  3E1L A;  4W4L B;  4CYB A;  3QB9 A;  4Y08 A;  3A68 A;  3Q4N A;  3UNO A;  1UVH A;  3H7G A;  4ERU A;  4MY7 A;  1FHA A;  1JKV A;  2V2R A;  4ITW A;  4REU A;  5GU2 X;  4TO9 A;  2GYD A;  3IS8 A;  3PWF A;  2C6R A;  5C6F A;  3BKN A;  3E1N A;  4P18 A;  4TOH A;  5ERK A;  2FG4 A;  5FFC A;  2QQY A;  4EVC A;  1H96 A;  2V15 A;  4RC6 A;  5J93 A;  4WJG 4;  5J8W A;  3FSE A;  4X0J A;  1KRQ A;  1S30 A;  2CLU A;  1LB3 A;  3RE7 A;  3SHX A;  2V2O A;  4ZLW A;  2F7N A;  4AM2 A;  2C2F A;  3JZA B;  4LPN A;  3PVY A;  2VZB A;  4U3G A;  3R2M A;  2CF7 A;  4ZKW A;  4DAS A;  3O7R A;  4CVT A;  1RCI A;  3R2O A;  5K53 A;  1VEL A;  4ITT A;  2GYQ A;  3BVK A;  2XGW A;  3WVU A;  2CHP A;  3ERZ A;  1L8H A;  2V8T A;  3GE4 A;  4TOC A;  3PVR B;  1XZ1 A;  2CN7 A;  4ML5 A;  2Y44 A;  2YW6 A;  5JKL G;  4Z5S A;  2VXI A;  3QHB A;  1NFV A;  3QZ3 A;  4QUW A;  4TOF A;  3SH6 A;  4TOA A;  3Q4Q A;  3E1M A;  2Z6M A;  3BT5 A;  3UFB A;  4R42 A;  2Z90 A;  3V3K B;  4RC5 B;  4CVS A;  5LBH A;  1YUX A;  3QD8 A;  1Z6O M;  1F33 A;  2WWX B;  3KWO A;  1JI4 A;  3PVR A;  3C23 A;  1VJX A;  4KVQ A;  3OGH A;  5D8O A;  4XKT A;  3IQ1 A;  2V2J A;  5CMQ A;  5GU1 X;  4XKU A;  4ZJK A;  3PW1 B;  2C2J A;  1XZ3 A;  3ISE A;  2OC5 A;  3AJO A;  3F36 A;  4RC5 A;  4PG1 A;  4DZ0 A;  3KHK A;  4EVB A;  5ERJ A;  4DYZ A;  3RD0 A;  2PYB A;  3VNX A;  2GS4 A;  4CYA A;  1JYB A;  3PWQ C;  2D5K A;  2V2N A;  1MFR A;  2ZG8 X;  2CEI A;  4RC8 A;  3PW1 A;  2IB0 A;  5HJF A;  1VEI A;  2MGY A;  2XJM A;  3SE1 A;  3KX9 A;  1R03 A;  4DYY A;  3WVV A;  2CWL A;  2ZUR X;  1BG7 A;  1ZS3 A;  3EZ0 A;  3SID A;  2OKC A;  1RCC A;  3KDQ A;  1Z4A A;  5GU0 X;  3F34 A;  3F35 A;  4YXJ A;  1RCD A;  4CVR A;  2BJY A;  2C41 A;  1UMN A;  1MOJ A;  5FFA A;  3FRS A;  5D8S A;  5E1U A;  2C2U A;  3GHQ A;  3BVI A;  4EVE A;  1VLG A;  1RCG A;  3E1O A;  4KXR B;  2ZA6 A;  5J8S A;  5I4J A;  3RGD A;  2QF9 A;  4TOG A;  5GN8 B;  2ZG9 X;  1DVB A;  5CZU A;  2HR5 A;  2Z5Q A;  2YJJ A;  4IXK A;  1QGH A;  3Q4R A;  2CHI A;  2YJK A;  4OYN A;  3KXU A;  2V2M A;  4EVD A;  1RCE A;  5D8Q A;  2FL0 A;  5GOU A;  3R2H A;  4M34 A;  4MUD A;  3QVD A;  4LQN A;  1SQ3 A;  1JKU A;  4ZL5 A;  5GN8 A;  4DI0 A;  1JIG A;  4IWK A;  1JGC A;  3NP2 X;  4AM4 A;  4XGS A;  1NF6 A;  2V2P A;  3W54 A;  3F33 A;  3C21 A;  1B71 A;  5JKM A;  4MXP A;  4CMY V;  4ZMC A;  5LG8 A;  2CIH A;  3GGY A;  1IER A;  2W0O A;  4RC7 B;  1Z6O A;  3ISF A;  4TOD A;  3BVF A;  3BVE A;  1AEW A;  3KA6 A;  3UOI A;  1QYB A;  1O9R A;  3QHC A;  2ZG7 X;  1BCF A;  1BFR A;  5D8X A;  4RC7 A;  2V2I A;  3LKD A;  3Q4O A;  3RBC A;  2FHA A;  1LKP A;  2ITB A;  3MPS A;  5LG2 A;  3AF8 X;  4E6K A;  1J30 A;  4M35 A;  5D8Y A;  2FKZ A;  4MKU A;  4DYX A;  4W4K B;  2FFX J;  2FJC A;  2FG8 A;  5J9V A;  4LYX A;  5JKL A;  2G4H A;  5FFE A;  2WTL A;  4MN9 A;  2BKC A;  5HU6 D;  3ES3 A;  1EUM A;  3R2L A;  4LYU A;  1SOF A;  5FFB A;  2XKQ A;  4ETR A;  3JZ9 A;  2BK6 A;  1LKO A;  4TW3 A;  3F38 A;  2AR0 A;  1JI5 A;  3N6O A;  2HTN A;  3F32 A;  3PW8 C;  3E2C A;  5E2D A;  3F37 A;  3FVB A;  5LS9 A;  4LQJ A;  4ZTT A;  1TKP A;  2XJO A;  1S3Q A;  4YKH A;  5K52 A;  4TOB A;  2CN6 A;  2ZA7 A;  4RC6 B;  1LKM A;  2JD8 0;  3KA9 A;  3AJQ A;  2V2S A;  5HQO A;  3A9Q A;  3HL1 A;  2WLA A;  4DE6 A;  4II4 B;  5FEJ A;  1JRE A;  4ISP A;  1S2Z A;  2Y3Q A;  2YW7 A;  3T9J A;  1DPS A;  4CMY A; 
#chains in the Genus database with same CATH homology
 5JKM G;  2CLB A;  2Z5R A;  4MJY A;  1ZUJ A;  3AJP A;  4M33 A;  1VEQ A;  4A25 A;  3F39 A;  2OH3 A;  3FI6 A;  3D19 A;  3WNW A;  3AF7 X;  4PGI A;  4YVZ A;  1HRS A;  3PVY B;  3E1J A;  1GWG A;  2WLU A;  3RAV A;  3OJ5 A;  3AK8 A;  4PGK A;  1JTS A;  5HJH A;  1IES A;  4II4 A;  5FFD A;  1YV1 A;  3VVA A;  3KA3 A;  3R2R A;  4PG0 A;  5JDO B;  1OTK A;  3DBY A;  3PZA A;  3GVY A;  2X17 0;  3AF9 X;  4DYU A;  4LQH A;  2V8U A;  3KA8 A;  4M32 A;  3U90 A;  2FZF A;  2RBD A;  5AXS A;  3KA4 A;  3E1Q A;  3TA8 A;  4IWJ A;  1TK6 A;  3BVL A;  4CY9 A;  3E6S A;  3UOF A;  5JDO A;  5D8R A;  1NF4 A;  3PVT B;  1DAT A;  3C1Y A;  3E6R A;  4XKS A;  2UX1 A;  1RYT A;  1L8I A;  1TKO A;  4E40 A;  5IX6 A;  2ZA8 A;  2N02 A;  4YXM A;  5GU3 X;  4ISM A;  3L0M A;  2BW1 A;  4KVR A;  3NP0 X;  4LPJ A;  3M6J A;  3VV9 A;  4AM5 A;  3E1P A;  3C1Z A;  1TJO A;  5CMR A;  1F30 A;  3WVW A;  3PVT A;  1YUZ A;  1NNQ A;  3PWQ A;  3AK9 A;  4ZKH A;  3EZU A;  2VXX A;  1O9I A;  2IU2 A;  4LQV A;  3NOZ X;  4CVP A;  3HIU A;  3O7S A;  2JD7 0;  4LPM A;  4ZKX A;  4Z3B A;  4TOE A;  2JD6 0;  5D8P A;  4KVS A;  2XJN A;  3PW8 A;  3FRR A;  2IY4 A;  3GGZ A;  1N1Q A;  5JAC A;  2G38 B;  3IS7 A;  3EGM A;  3R2S A;  3R2K A;  4ZL6 A;  2V2L A;  2Z5P A;  3E1L A;  4W4L B;  4CYB A;  3QB9 A;  4Y08 A;  3A68 A;  3Q4N A;  3UNO A;  1UVH A;  3H7G A;  4ERU A;  4MY7 A;  1FHA A;  1JKV A;  2V2R A;  4ITW A;  4REU A;  5GU2 X;  4TO9 A;  2GYD A;  3IS8 A;  3PWF A;  2C6R A;  5C6F A;  3BKN A;  3E1N A;  4P18 A;  4TOH A;  5ERK A;  2FG4 A;  5FFC A;  2QQY A;  4EVC A;  1H96 A;  2V15 A;  4RC6 A;  5J93 A;  4WJG 4;  5J8W A;  3FSE A;  4X0J A;  1KRQ A;  1S30 A;  2CLU A;  1LB3 A;  3RE7 A;  3SHX A;  2V2O A;  4ZLW A;  2F7N A;  4AM2 A;  2C2F A;  3JZA B;  4LPN A;  3PVY A;  2VZB A;  4U3G A;  3R2M A;  2CF7 A;  4ZKW A;  4DAS A;  3O7R A;  4CVT A;  1RCI A;  3R2O A;  5K53 A;  1VEL A;  4ITT A;  2GYQ A;  3BVK A;  2XGW A;  3WVU A;  2CHP A;  3ERZ A;  1L8H A;  2V8T A;  3GE4 A;  4TOC A;  3PVR B;  1XZ1 A;  2CN7 A;  4ML5 A;  2Y44 A;  2YW6 A;  5JKL G;  4Z5S A;  2VXI A;  3QHB A;  1NFV A;  3QZ3 A;  4QUW A;  4TOF A;  3SH6 A;  4TOA A;  3Q4Q A;  3E1M A;  2Z6M A;  3BT5 A;  3UFB A;  4R42 A;  2Z90 A;  3V3K B;  4RC5 B;  4CVS A;  5LBH A;  1YUX A;  3QD8 A;  1Z6O M;  1F33 A;  2WWX B;  3KWO A;  1JI4 A;  3PVR A;  3C23 A;  1VJX A;  4KVQ A;  3OGH A;  5D8O A;  4XKT A;  3IQ1 A;  2V2J A;  5CMQ A;  5GU1 X;  4XKU A;  4ZJK A;  3PW1 B;  2C2J A;  1XZ3 A;  3ISE A;  2OC5 A;  3AJO A;  3F36 A;  4RC5 A;  4PG1 A;  4DZ0 A;  3KHK A;  4EVB A;  5ERJ A;  4DYZ A;  3RD0 A;  2PYB A;  3VNX A;  2GS4 A;  4CYA A;  1JYB A;  3PWQ C;  2D5K A;  2V2N A;  1MFR A;  2ZG8 X;  2CEI A;  4RC8 A;  3PW1 A;  2IB0 A;  5HJF A;  1VEI A;  2MGY A;  2XJM A;  3SE1 A;  3KX9 A;  1R03 A;  4DYY A;  3WVV A;  2CWL A;  2ZUR X;  1BG7 A;  1ZS3 A;  3EZ0 A;  3SID A;  2OKC A;  1RCC A;  3KDQ A;  1Z4A A;  5GU0 X;  3F34 A;  3F35 A;  4YXJ A;  1RCD A;  4CVR A;  2BJY A;  2C41 A;  1UMN A;  1MOJ A;  5FFA A;  3FRS A;  5D8S A;  5E1U A;  2C2U A;  3GHQ A;  3BVI A;  4EVE A;  1VLG A;  1RCG A;  3E1O A;  4KXR B;  2ZA6 A;  5J8S A;  5I4J A;  3RGD A;  2QF9 A;  4TOG A;  5GN8 B;  2ZG9 X;  1DVB A;  5CZU A;  2HR5 A;  2Z5Q A;  2YJJ A;  4IXK A;  1QGH A;  3Q4R A;  2CHI A;  2YJK A;  4OYN A;  3KXU A;  2V2M A;  4EVD A;  1RCE A;  5D8Q A;  2FL0 A;  5GOU A;  3R2H A;  4M34 A;  4MUD A;  3QVD A;  4LQN A;  1SQ3 A;  1JKU A;  4ZL5 A;  5GN8 A;  4DI0 A;  1JIG A;  4IWK A;  1JGC A;  3NP2 X;  4AM4 A;  4XGS A;  1NF6 A;  2V2P A;  3W54 A;  3F33 A;  3C21 A;  1B71 A;  5JKM A;  4MXP A;  4CMY V;  4ZMC A;  5LG8 A;  2CIH A;  3GGY A;  1IER A;  2W0O A;  4RC7 B;  1Z6O A;  3ISF A;  4TOD A;  3BVF A;  3BVE A;  1AEW A;  3KA6 A;  3UOI A;  1QYB A;  1O9R A;  3QHC A;  2ZG7 X;  1BCF A;  1BFR A;  5D8X A;  4RC7 A;  2V2I A;  3LKD A;  3Q4O A;  3RBC A;  2FHA A;  1LKP A;  2ITB A;  3MPS A;  5LG2 A;  3AF8 X;  4E6K A;  1J30 A;  4M35 A;  5D8Y A;  2FKZ A;  4MKU A;  4DYX A;  4W4K B;  2FFX J;  2FJC A;  2FG8 A;  5J9V A;  4LYX A;  5JKL A;  2G4H A;  5FFE A;  2WTL A;  4MN9 A;  2BKC A;  5HU6 D;  3ES3 A;  1EUM A;  3R2L A;  4LYU A;  1SOF A;  5FFB A;  2XKQ A;  4ETR A;  3JZ9 A;  2BK6 A;  1LKO A;  4TW3 A;  3F38 A;  2AR0 A;  1JI5 A;  3N6O A;  2HTN A;  3F32 A;  3PW8 C;  3E2C A;  5E2D A;  3F37 A;  3FVB A;  5LS9 A;  4LQJ A;  4ZTT A;  1TKP A;  2XJO A;  1S3Q A;  4YKH A;  5K52 A;  4TOB A;  2CN6 A;  2ZA7 A;  4RC6 B;  1LKM A;  2JD8 0;  3KA9 A;  3AJQ A;  2V2S A;  5HQO A;  3A9Q A;  3HL1 A;  2WLA A;  4DE6 A;  4II4 B;  5FEJ A;  1JRE A;  4ISP A;  1S2Z A;  2Y3Q A;  2YW7 A;  3T9J A;  1DPS A;  4CMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...