3KX9A

Engineering a closed form of the archaeoglobus fulgidus ferritin by site directed mutagenesis
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
163
structure length
163
Chain Sequence
SISEKMVEALNRQINAEIYSAYLYLSMASYFDSIGLKGFSNWMRVQWQEELMHAMKMFDFVSERGGRVKLYAVEEPPSEWDSPLAAFEHVYEHEVNVTKRIHELVEMAMQEKDFATYNFLQWYVAEQVEEEASALDIVEKLRLIGEDAAALLFLDKELSLRQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ferritin
publication title The role of nonconserved residues of Archaeoglobus fulgidus ferritin on its unique structure and biophysical properties.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 72
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3kx9A00
4MKUA 3ERZA 4LQHA 2FG4A 1BFRA 5D8PA 1RYTA 2FHAA 4DYYA 2V2JA 5I4JA 3KA3A 3UOIA 3AF7X 1L8HA 1QGHA 3PVRB 2IU2A 3EZUA 4TOBA 1YUZA 1O9IA 2Z90A 3F32A 1JREA 3R2MA 3BVIA 3PVRA 3KX9A 2CHIA 1B71A 5J9VA 3MPSA 4M34A 1O9RA 1JI5A 4M33A 3FI6A 2OH3A 2IY4A 5ERJA 4M35A 1JTSA 4KVSA 4ISPA 2FKZA 3E6SA 3PWFA 4XKSA 4PG0A 5AXSA 4RC6B 3WVWA 4E6KA 1JYBA 4RC6A 1TKPA 3FVBA 2OC5A 5J8WA 5FEJA 4LYXA 2C2FA 3E1PA 3E1JA 4DASA 3R2RA 1TJOA 4LYUA 3AJQA 2ZA7A 1MOJA 4RC5B 3TA8A 2ZA8A 4ZJKA 4ERUA 4RC5A 1ZUJA 3GE4A 1S3QA 5FFAA 2QF9A 4IWJA 4KVQA 5JKMG 2HTNA 3F34A 5GU0X 5JKLG 2V2OA 4M32A 2CN6A 3ISFA 4IWKA 1QYBA 2F7NA 4ZKWA 4ISMA 4AM5A 3QB9A 1YV1A 5K53A 5E1UA 2WLUA 3E1QA 1DVBA 5D8YA 3E2CA 2YW7A 1BG7A 1NF4A 2C6RA 3RBCA 3BVFA 3GHQA 3Q4OA 3UOFA 2VZBA 3NOZX 4MY7A 1TKOA 2WTLA 2XJNA 4ZKHA 3WVVA 4MJYA 5JKMA 4DYUA 4EVEA 5JKLA 5CZUA 3R2KA 3QZ3A 2QQYA 2VXXA 2V2IA 4CVPA 4MN9A 2V15A 4CMYV 3F35A 5FFDA 3PWQC 4REUA 3Q4NA 2VXIA 4PG1A 1RCDA 3Q4QA 2BK6A 3KXUA 3PWQA 1Z4AA 2FJCA 3BT5A 4LQJA 4TOGA 1SQ3A 3E1OA 4XKUA 5E2DA 1YUXA 2Y3QA 3OGHA 5LBHA 4XGSA 3VNXA 3AJOA 2CHPA 4II4B 1KRQA 3A68A 4LQNA 1J30A 2JD70 4CY9A 1VEQA 2BKCA 4II4A 4KVRA 3AF8X 2C2UA 1LKOA 2FZFA 4TO9A 5GU2X 1OTKA 3IS8A 2GYDA 3ES3A 3Q4RA 3AJPA 4TOFA 3T9JA 2IB0A 4R42A 3A9QA 1Z6OA 1F33A 4DZ0A 2BJYA 1RCEA 3BKNA 4EVBA 4ITWA 4AM2A 1UVHA 1L8IA 1JKVA 4TW3A 2ZG8X 3SHXA 3FSEA 4CVTA 3E1LA 3PW8C 2BW1A 4XKTA 3E1MA 4TOHA 3AF9X 1BCFA 3PW8A 4A25A 1ZS3A 3O7SA 3EGMA 2ITBA 3RD0A 1IESA 1H96A 1R03A 2CIHA 2YJJA 4DE6A 2V2NA 5J8SA 4ZKXA 3F33A 1DATA 4RC7B 3SE1A 4PGIA 1JIGA 5D8RA 3AK8A 3QD8A 4Y08A 4RC7A 4ZLWA 3BVLA 2XKQA 2CF7A 3AK9A 1RCGA 3PZAA 3F39A 4ZL5A 1GWGA 1RCCA 3WNWA 1AEWA 1VELA 2XJMA 3QVDA 2Z6MA 3PVYB 2ZG9X 4P18A 4LPMA 1LKPA 1XZ1A 3PVYA 1FHAA 3HIUA 3WVUA 4CMYA 1HRSA 3R2HA 4ML5A 4CYAA 3U90A 5GU1X 1RCIA 4LPNA 2Z5PA 2JD80 2Z5RA 5FFCA 2D5KA 2FFXJ 5D8XA 3IQ1A 3KA4A 2C2JA 5GN8B 1XZ3A 4DYZA 5GU3X 5C6FA 2V2RA 3OJ5A 3KA6A 5GN8A 4Z5SA 4ZL6A 5K52A 1S30A 3KWOA 1LKMA 2ZA6A 3PW1B 3UNOA 5D8OA 1N1QA 5D8QA 4EVDA 4ETRA 2V2SA 2FG8A 3RE7A 4OYNA 3PW1A 4LQVA 2XGWA 4DI0A 4Z3BA 5JACA 3IS7A 2RBDA 4CVRA 3KA8A 5LS9A 2CLBA 3NP0X 4LPJA 2GYQA 2YW6A 4ZTTA 1UMNA 5D8SA 1JI4A 2WLAA 3BVKA 1NF6A 2V2PA 2V2MA 3QHBA 1LB3A 2HR5A 4AM4A 5GOUA 4RC8A 4YKHA 1NNQA 1JGCA 3O7RA 3F38A 3E6RA 3PVTB 1EUMA 4ITTA 3NP2X 2FL0A 5J93A 2UX1A 1TK6A 5FFBA 3PVTA 4CVSA 1MFRA 2CLUA 4IXKA 5LG2A 4CYBA 1NFVA 3R2OA 3R2SA 1JKUA 4MUDA 2X170 2YJKA 5IX6A 3RAVA 3BVEA 4PGKA 5CMQA 3KA9A 1SOFA 3EZ0A 2CN7A 2JD60 3E1NA 4TOEA 2G4HA 2CEIA 3HL1A 2Z5QA 2ZG7X 5HQOA 2V2LA 2ZURX 4U3GA 3SH6A 4ZMCA 3GVYA 5ERKA 5FFEA 1VLGA 3F37A 2PYBA 3SIDA 5LG8A 3F36A 3RGDA 3H7GA 5HJFA 4TODA 5CMRA 2W0OA 4TOCA 1F30A 2XJOA 1S2ZA 3ISEA 4DYXA 1Z6OM 5HJHA 3QHCA 1IERA 1DPSA 1VEIA 4EVCA 3R2LA 2GS4A 4QUWA 1VJXA 4TOAA 2C41A
chains in the Genus database with same CATH superfamily
3DBYA 4MKUA 3ERZA 4LQHA 2FG4A 1BFRA 5D8PA 1RYTA 2V8UA 2FHAA 4DYYA 2V2JA 5I4JA 3KA3A 3UOIA 3AF7X 1L8HA 1QGHA 3PVRB 2IU2A 3EZUA 4TOBA 1YUZA 1O9IA 2Z90A 3F32A 1JREA 3R2MA 3BVIA 3PVRA 3KX9A 2CHIA 1B71A 5J9VA 3MPSA 4M34A 1O9RA 1JI5A 4M33A 3FI6A 2OH3A 2IY4A 5ERJA 2Y44A 4M35A 1JTSA 4KVSA 4ISPA 2FKZA 3E6SA 3PWFA 4XKSA 3L0MA 2MGYA 4PG0A 5AXSA 4RC6B 3WVWA 4E6KA 1JYBA 4RC6A 1TKPA 3FVBA 2OC5A 5J8WA 5FEJA 2V8TA 4LYXA 2C2FA 3E1PA 3E1JA 4DASA 3R2RA 1TJOA 4LYUA 3AJQA 2ZA7A 1MOJA 4RC5B 3M6JA 3TA8A 2ZA8A 4ZJKA 4ERUA 4RC5A 1ZUJA 3GE4A 1S3QA 5FFAA 2QF9A 4IWJA 4KVQA 5JKMG 2HTNA 3F34A 5GU0X 3JZ9A 5JKLG 2V2OA 4M32A 2CN6A 3ISFA 4IWKA 1QYBA 2F7NA 4ZKWA 4ISMA 3KDQA 4AM5A 3QB9A 1YV1A 5K53A 5E1UA 2WLUA 3E1QA 1DVBA 5D8YA 3E2CA 2YW7A 1BG7A 3C1ZA 4W4LB 1NF4A 2C6RA 3RBCA 3BVFA 3GHQA 3Q4OA 3UOFA 2VZBA 3NOZX 4MY7A 1TKOA 2WTLA 2XJNA 4ZKHA 3WVVA 4MJYA 5JKMA 4DYUA 4EVEA 3LKDA 5JKLA 5CZUA 3R2KA 3QZ3A 2QQYA 2VXXA 2V2IA 4WJG4 4CVPA 4MN9A 4YXMA 2V15A 4CMYV 3F35A 5FFDA 3PWQC 4REUA 3Q4NA 2VXIA 4PG1A 1RCDA 3C1YA 3Q4QA 2BK6A 3KXUA 3PWQA 4YVZA 1Z4AA 2FJCA 3BT5A 3FRRA 4LQJA 4TOGA 1SQ3A 3E1OA 4XKUA 5E2DA 3C21A 1YUXA 2Y3QA 3OGHA 5LBHA 4XGSA 3VNXA 3AJOA 2CHPA 4II4B 1KRQA 3A68A 4LQNA 1J30A 2JD70 4CY9A 1VEQA 2BKCA 4II4A 4KVRA 3AF8X 2C2UA 1LKOA 3GGYA 2FZFA 4TO9A 5GU2X 1OTKA 3IS8A 2GYDA 3ES3A 3Q4RA 2OKCA 3AJPA 4TOFA 3T9JA 2IB0A 4R42A 3A9QA 1Z6OA 1F33A 4DZ0A 2BJYA 1RCEA 3BKNA 4EVBA 4ITWA 4AM2A 1UVHA 1L8IA 1JKVA 4TW3A 2ZG8X 3SHXA 3FSEA 4CVTA 3E1LA 3PW8C 3VV9A 2BW1A 3C23A 4XKTA 3E1MA 4TOHA 3AF9X 1BCFA 3PW8A 4A25A 1ZS3A 3O7SA 3EGMA 2ITBA 3RD0A 1IESA 4KXRB 1H96A 1R03A 4MXPA 2CIHA 2YJJA 4DE6A 2V2NA 3FRSA 5J8SA 4ZKXA 3F33A 2AR0A 1DATA 3D19A 4RC7B 3SE1A 4PGIA 1JIGA 5D8RA 3AK8A 3QD8A 4Y08A 4RC7A 4ZLWA 3BVLA 2XKQA 3VVAA 2CF7A 3AK9A 1RCGA 3PZAA 3F39A 4ZL5A 1GWGA 1RCCA 4X0JA 3WNWA 3GGZA 1AEWA 1VELA 2XJMA 3QVDA 2Z6MA 5HU6D 3PVYB 2ZG9X 4P18A 4LPMA 3KHKA 1LKPA 1XZ1A 2G38B 3PVYA 1FHAA 3HIUA 3WVUA 4CMYA 1HRSA 3R2HA 4ML5A 4CYAA 3U90A 5GU1X 1RCIA 4LPNA 2Z5PA 2JD80 2Z5RA 5FFCA 2D5KA 2FFXJ 5D8XA 4W4KB 3IQ1A 3KA4A 2C2JA 5GN8B 1XZ3A 4DYZA 5GU3X 5C6FA 2V2RA 3OJ5A 4E40A 3KA6A 5GN8A 4Z5SA 4ZL6A 5K52A 1S30A 3KWOA 1LKMA 2ZA6A 3PW1B 3UNOA 5D8OA 1N1QA 5D8QA 3N6OA 4EVDA 4ETRA 2V2SA 3JZAB 2FG8A 3RE7A 4OYNA 3PW1A 4LQVA 2XGWA 4DI0A 4Z3BA 5JACA 3IS7A 2RBDA 2WWXB 4CVRA 3KA8A 5LS9A 2CLBA 3NP0X 4LPJA 2GYQA 2YW6A 4ZTTA 1UMNA 5D8SA 1JI4A 2WLAA 3BVKA 1NF6A 2V2PA 2V2MA 3QHBA 1LB3A 2HR5A 4AM4A 5GOUA 4RC8A 4YKHA 1NNQA 1JGCA 3O7RA 3F38A 3E6RA 3PVTB 3V3KB 1EUMA 4ITTA 3NP2X 2FL0A 5J93A 2UX1A 1TK6A 5FFBA 3PVTA 4CVSA 1MFRA 2CLUA 4IXKA 5LG2A 3W54A 4CYBA 1NFVA 3R2OA 4YXJA 3R2SA 1JKUA 4MUDA 2X170 2YJKA 5IX6A 2N02A 3RAVA 3BVEA 4PGKA 5CMQA 3KA9A 1SOFA 3EZ0A 2CN7A 2JD60 3E1NA 4TOEA 2G4HA 2CEIA 3HL1A 2Z5QA 5JDOB 2CWLA 2ZG7X 5HQOA 2V2LA 2ZURX 4U3GA 3SH6A 3UFBA 4ZMCA 5JDOA 3GVYA 5ERKA 5FFEA 1VLGA 3F37A 2PYBA 3SIDA 5LG8A 3F36A 3RGDA 3H7GA 5HJFA 4TODA 5CMRA 2W0OA 4TOCA 1F30A 2XJOA 1S2ZA 3ISEA 4DYXA 1Z6OM 5HJHA 3QHCA 1IERA 1DPSA 1VEIA 4EVCA 3R2LA 2GS4A 4QUWA 1VJXA 4TOAA 2C41A
chains in the Genus database with same CATH topology
3DBYA 4MKUA 3ERZA 4LQHA 2FG4A 1BFRA 5D8PA 1RYTA 2V8UA 2FHAA 4DYYA 2V2JA 5I4JA 3KA3A 3UOIA 3AF7X 1L8HA 1QGHA 3PVRB 2IU2A 3EZUA 4TOBA 1YUZA 1O9IA 2Z90A 3F32A 1JREA 3R2MA 3BVIA 3PVRA 3KX9A 2CHIA 1B71A 5J9VA 3MPSA 4M34A 1O9RA 1JI5A 4M33A 3FI6A 2OH3A 2IY4A 5ERJA 2Y44A 4M35A 1JTSA 4KVSA 4ISPA 2FKZA 3E6SA 3PWFA 4XKSA 3L0MA 2MGYA 4PG0A 5AXSA 4RC6B 3WVWA 4E6KA 1JYBA 4RC6A 1TKPA 3FVBA 2OC5A 5J8WA 5FEJA 2V8TA 4LYXA 2C2FA 3E1PA 3E1JA 4DASA 3R2RA 1TJOA 4LYUA 3AJQA 2ZA7A 1MOJA 4RC5B 3M6JA 3TA8A 2ZA8A 4ZJKA 4ERUA 4RC5A 1ZUJA 3GE4A 1S3QA 5FFAA 2QF9A 4IWJA 4KVQA 5JKMG 2HTNA 3F34A 5GU0X 3JZ9A 5JKLG 2V2OA 4M32A 2CN6A 3ISFA 4IWKA 1QYBA 2F7NA 4ZKWA 4ISMA 3KDQA 4AM5A 3QB9A 1YV1A 5K53A 5E1UA 2WLUA 3E1QA 1DVBA 5D8YA 3E2CA 2YW7A 1BG7A 3C1ZA 4W4LB 1NF4A 2C6RA 3RBCA 3BVFA 3GHQA 3Q4OA 3UOFA 2VZBA 3NOZX 4MY7A 1TKOA 2WTLA 2XJNA 4ZKHA 3WVVA 4MJYA 5JKMA 4DYUA 4EVEA 3LKDA 5JKLA 5CZUA 3R2KA 3QZ3A 2QQYA 2VXXA 2V2IA 4WJG4 4CVPA 4MN9A 4YXMA 2V15A 4CMYV 3F35A 5FFDA 3PWQC 4REUA 3Q4NA 2VXIA 4PG1A 1RCDA 3C1YA 3Q4QA 2BK6A 3KXUA 3PWQA 4YVZA 1Z4AA 2FJCA 3BT5A 3FRRA 4LQJA 4TOGA 1SQ3A 3E1OA 4XKUA 5E2DA 3C21A 1YUXA 2Y3QA 3OGHA 5LBHA 4XGSA 3VNXA 3AJOA 2CHPA 4II4B 1KRQA 3A68A 4LQNA 1J30A 2JD70 4CY9A 1VEQA 2BKCA 4II4A 4KVRA 3AF8X 2C2UA 1LKOA 3GGYA 2FZFA 4TO9A 5GU2X 1OTKA 3IS8A 2GYDA 3ES3A 3Q4RA 2OKCA 3AJPA 4TOFA 3T9JA 2IB0A 4R42A 3A9QA 1Z6OA 1F33A 4DZ0A 2BJYA 1RCEA 3BKNA 4EVBA 4ITWA 4AM2A 1UVHA 1L8IA 1JKVA 4TW3A 2ZG8X 3SHXA 3FSEA 4CVTA 3E1LA 3PW8C 3VV9A 2BW1A 3C23A 4XKTA 3E1MA 4TOHA 3AF9X 1BCFA 3PW8A 4A25A 1ZS3A 3O7SA 3EGMA 2ITBA 3RD0A 1IESA 4KXRB 1H96A 1R03A 4MXPA 2CIHA 2YJJA 4DE6A 2V2NA 3FRSA 5J8SA 4ZKXA 3F33A 2AR0A 1DATA 3D19A 4RC7B 3SE1A 4PGIA 1JIGA 5D8RA 3AK8A 3QD8A 4Y08A 4RC7A 4ZLWA 3BVLA 2XKQA 3VVAA 2CF7A 3AK9A 1RCGA 3PZAA 3F39A 4ZL5A 1GWGA 1RCCA 4X0JA 3WNWA 3GGZA 1AEWA 1VELA 2XJMA 3QVDA 2Z6MA 5HU6D 3PVYB 2ZG9X 4P18A 4LPMA 3KHKA 1LKPA 1XZ1A 2G38B 3PVYA 1FHAA 3HIUA 3WVUA 4CMYA 1HRSA 3R2HA 4ML5A 4CYAA 3U90A 5GU1X 1RCIA 4LPNA 2Z5PA 2JD80 2Z5RA 5FFCA 2D5KA 2FFXJ 5D8XA 4W4KB 3IQ1A 3KA4A 2C2JA 5GN8B 1XZ3A 4DYZA 5GU3X 5C6FA 2V2RA 3OJ5A 4E40A 3KA6A 5GN8A 4Z5SA 4ZL6A 5K52A 1S30A 3KWOA 1LKMA 2ZA6A 3PW1B 3UNOA 5D8OA 1N1QA 5D8QA 3N6OA 4EVDA 4ETRA 2V2SA 3JZAB 2FG8A 3RE7A 4OYNA 3PW1A 4LQVA 2XGWA 4DI0A 4Z3BA 5JACA 3IS7A 2RBDA 2WWXB 4CVRA 3KA8A 5LS9A 2CLBA 3NP0X 4LPJA 2GYQA 2YW6A 4ZTTA 1UMNA 5D8SA 1JI4A 2WLAA 3BVKA 1NF6A 2V2PA 2V2MA 3QHBA 1LB3A 2HR5A 4AM4A 5GOUA 4RC8A 4YKHA 1NNQA 1JGCA 3O7RA 3F38A 3E6RA 3PVTB 3V3KB 1EUMA 4ITTA 3NP2X 2FL0A 5J93A 2UX1A 1TK6A 5FFBA 3PVTA 4CVSA 1MFRA 2CLUA 4IXKA 5LG2A 3W54A 4CYBA 1NFVA 3R2OA 4YXJA 3R2SA 1JKUA 4MUDA 2X170 2YJKA 5IX6A 2N02A 3RAVA 3BVEA 4PGKA 5CMQA 3KA9A 1SOFA 3EZ0A 2CN7A 2JD60 3E1NA 4TOEA 2G4HA 2CEIA 3HL1A 2Z5QA 5JDOB 2CWLA 2ZG7X 5HQOA 2V2LA 2ZURX 4U3GA 3SH6A 3UFBA 4ZMCA 5JDOA 3GVYA 5ERKA 5FFEA 1VLGA 3F37A 2PYBA 3SIDA 5LG8A 3F36A 3RGDA 3H7GA 5HJFA 4TODA 5CMRA 2W0OA 4TOCA 1F30A 2XJOA 1S2ZA 3ISEA 4DYXA 1Z6OM 5HJHA 3QHCA 1IERA 1DPSA 1VEIA 4EVCA 3R2LA 2GS4A 4QUWA 1VJXA 4TOAA 2C41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MKU A;  3ERZ A;  4LQH A;  2FG4 A;  1BFR A;  5D8P A;  1RYT A;  2FHA A;  4DYY A;  2V2J A;  5I4J A;  3KA3 A;  3UOI A;  3AF7 X;  1L8H A;  1QGH A;  3PVR B;  2IU2 A;  3EZU A;  4TOB A;  1YUZ A;  1O9I A;  2Z90 A;  3F32 A;  1JRE A;  3R2M A;  3BVI A;  3PVR A;  3KX9 A;  2CHI A;  1B71 A;  5J9V A;  3MPS A;  4M34 A;  1O9R A;  1JI5 A;  4M33 A;  3FI6 A;  2OH3 A;  2IY4 A;  5ERJ A;  4M35 A;  1JTS A;  4KVS A;  4ISP A;  2FKZ A;  3E6S A;  3PWF A;  4XKS A;  4PG0 A;  5AXS A;  4RC6 B;  3WVW A;  4E6K A;  1JYB A;  4RC6 A;  1TKP A;  3FVB A;  2OC5 A;  5J8W A;  5FEJ A;  4LYX A;  2C2F A;  3E1P A;  3E1J A;  4DAS A;  3R2R A;  1TJO A;  4LYU A;  3AJQ A;  2ZA7 A;  1MOJ A;  4RC5 B;  3TA8 A;  2ZA8 A;  4ZJK A;  4ERU A;  4RC5 A;  1ZUJ A;  3GE4 A;  1S3Q A;  5FFA A;  2QF9 A;  4IWJ A;  4KVQ A;  5JKM G;  2HTN A;  3F34 A;  5GU0 X;  5JKL G;  2V2O A;  4M32 A;  2CN6 A;  3ISF A;  4IWK A;  1QYB A;  2F7N A;  4ZKW A;  4ISM A;  4AM5 A;  3QB9 A;  1YV1 A;  5K53 A;  5E1U A;  2WLU A;  3E1Q A;  1DVB A;  5D8Y A;  3E2C A;  2YW7 A;  1BG7 A;  1NF4 A;  2C6R A;  3RBC A;  3BVF A;  3GHQ A;  3Q4O A;  3UOF A;  2VZB A;  3NOZ X;  4MY7 A;  1TKO A;  2WTL A;  2XJN A;  4ZKH A;  3WVV A;  4MJY A;  5JKM A;  4DYU A;  4EVE A;  5JKL A;  5CZU A;  3R2K A;  3QZ3 A;  2QQY A;  2VXX A;  2V2I A;  4CVP A;  4MN9 A;  2V15 A;  4CMY V;  3F35 A;  5FFD A;  3PWQ C;  4REU A;  3Q4N A;  2VXI A;  4PG1 A;  1RCD A;  3Q4Q A;  2BK6 A;  3KXU A;  3PWQ A;  1Z4A A;  2FJC A;  3BT5 A;  4LQJ A;  4TOG A;  1SQ3 A;  3E1O A;  4XKU A;  5E2D A;  1YUX A;  2Y3Q A;  3OGH A;  5LBH A;  4XGS A;  3VNX A;  3AJO A;  2CHP A;  4II4 B;  1KRQ A;  3A68 A;  4LQN A;  1J30 A;  2JD7 0;  4CY9 A;  1VEQ A;  2BKC A;  4II4 A;  4KVR A;  3AF8 X;  2C2U A;  1LKO A;  2FZF A;  4TO9 A;  5GU2 X;  1OTK A;  3IS8 A;  2GYD A;  3ES3 A;  3Q4R A;  3AJP A;  4TOF A;  3T9J A;  2IB0 A;  4R42 A;  3A9Q A;  1Z6O A;  1F33 A;  4DZ0 A;  2BJY A;  1RCE A;  3BKN A;  4EVB A;  4ITW A;  4AM2 A;  1UVH A;  1L8I A;  1JKV A;  4TW3 A;  2ZG8 X;  3SHX A;  3FSE A;  4CVT A;  3E1L A;  3PW8 C;  2BW1 A;  4XKT A;  3E1M A;  4TOH A;  3AF9 X;  1BCF A;  3PW8 A;  4A25 A;  1ZS3 A;  3O7S A;  3EGM A;  2ITB A;  3RD0 A;  1IES A;  1H96 A;  1R03 A;  2CIH A;  2YJJ A;  4DE6 A;  2V2N A;  5J8S A;  4ZKX A;  3F33 A;  1DAT A;  4RC7 B;  3SE1 A;  4PGI A;  1JIG A;  5D8R A;  3AK8 A;  3QD8 A;  4Y08 A;  4RC7 A;  4ZLW A;  3BVL A;  2XKQ A;  2CF7 A;  3AK9 A;  1RCG A;  3PZA A;  3F39 A;  4ZL5 A;  1GWG A;  1RCC A;  3WNW A;  1AEW A;  1VEL A;  2XJM A;  3QVD A;  2Z6M A;  3PVY B;  2ZG9 X;  4P18 A;  4LPM A;  1LKP A;  1XZ1 A;  3PVY A;  1FHA A;  3HIU A;  3WVU A;  4CMY A;  1HRS A;  3R2H A;  4ML5 A;  4CYA A;  3U90 A;  5GU1 X;  1RCI A;  4LPN A;  2Z5P A;  2JD8 0;  2Z5R A;  5FFC A;  2D5K A;  2FFX J;  5D8X A;  3IQ1 A;  3KA4 A;  2C2J A;  5GN8 B;  1XZ3 A;  4DYZ A;  5GU3 X;  5C6F A;  2V2R A;  3OJ5 A;  3KA6 A;  5GN8 A;  4Z5S A;  4ZL6 A;  5K52 A;  1S30 A;  3KWO A;  1LKM A;  2ZA6 A;  3PW1 B;  3UNO A;  5D8O A;  1N1Q A;  5D8Q A;  4EVD A;  4ETR A;  2V2S A;  2FG8 A;  3RE7 A;  4OYN A;  3PW1 A;  4LQV A;  2XGW A;  4DI0 A;  4Z3B A;  5JAC A;  3IS7 A;  2RBD A;  4CVR A;  3KA8 A;  5LS9 A;  2CLB A;  3NP0 X;  4LPJ A;  2GYQ A;  2YW6 A;  4ZTT A;  1UMN A;  5D8S A;  1JI4 A;  2WLA A;  3BVK A;  1NF6 A;  2V2P A;  2V2M A;  3QHB A;  1LB3 A;  2HR5 A;  4AM4 A;  5GOU A;  4RC8 A;  4YKH A;  1NNQ A;  1JGC A;  3O7R A;  3F38 A;  3E6R A;  3PVT B;  1EUM A;  4ITT A;  3NP2 X;  2FL0 A;  5J93 A;  2UX1 A;  1TK6 A;  5FFB A;  3PVT A;  4CVS A;  1MFR A;  2CLU A;  4IXK A;  5LG2 A;  4CYB A;  1NFV A;  3R2O A;  3R2S A;  1JKU A;  4MUD A;  2X17 0;  2YJK A;  5IX6 A;  3RAV A;  3BVE A;  4PGK A;  5CMQ A;  3KA9 A;  1SOF A;  3EZ0 A;  2CN7 A;  2JD6 0;  3E1N A;  4TOE A;  2G4H A;  2CEI A;  3HL1 A;  2Z5Q A;  2ZG7 X;  5HQO A;  2V2L A;  2ZUR X;  4U3G A;  3SH6 A;  4ZMC A;  3GVY A;  5ERK A;  5FFE A;  1VLG A;  3F37 A;  2PYB A;  3SID A;  5LG8 A;  3F36 A;  3RGD A;  3H7G A;  5HJF A;  4TOD A;  5CMR A;  2W0O A;  4TOC A;  1F30 A;  2XJO A;  1S2Z A;  3ISE A;  4DYX A;  1Z6O M;  5HJH A;  3QHC A;  1IER A;  1DPS A;  1VEI A;  4EVC A;  3R2L A;  2GS4 A;  4QUW A;  1VJX A;  4TOA A;  2C41 A; 
#chains in the Genus database with same CATH topology
 3DBY A;  4MKU A;  3ERZ A;  4LQH A;  2FG4 A;  1BFR A;  5D8P A;  1RYT A;  2V8U A;  2FHA A;  4DYY A;  2V2J A;  5I4J A;  3KA3 A;  3UOI A;  3AF7 X;  1L8H A;  1QGH A;  3PVR B;  2IU2 A;  3EZU A;  4TOB A;  1YUZ A;  1O9I A;  2Z90 A;  3F32 A;  1JRE A;  3R2M A;  3BVI A;  3PVR A;  3KX9 A;  2CHI A;  1B71 A;  5J9V A;  3MPS A;  4M34 A;  1O9R A;  1JI5 A;  4M33 A;  3FI6 A;  2OH3 A;  2IY4 A;  5ERJ A;  2Y44 A;  4M35 A;  1JTS A;  4KVS A;  4ISP A;  2FKZ A;  3E6S A;  3PWF A;  4XKS A;  3L0M A;  2MGY A;  4PG0 A;  5AXS A;  4RC6 B;  3WVW A;  4E6K A;  1JYB A;  4RC6 A;  1TKP A;  3FVB A;  2OC5 A;  5J8W A;  5FEJ A;  2V8T A;  4LYX A;  2C2F A;  3E1P A;  3E1J A;  4DAS A;  3R2R A;  1TJO A;  4LYU A;  3AJQ A;  2ZA7 A;  1MOJ A;  4RC5 B;  3M6J A;  3TA8 A;  2ZA8 A;  4ZJK A;  4ERU A;  4RC5 A;  1ZUJ A;  3GE4 A;  1S3Q A;  5FFA A;  2QF9 A;  4IWJ A;  4KVQ A;  5JKM G;  2HTN A;  3F34 A;  5GU0 X;  3JZ9 A;  5JKL G;  2V2O A;  4M32 A;  2CN6 A;  3ISF A;  4IWK A;  1QYB A;  2F7N A;  4ZKW A;  4ISM A;  3KDQ A;  4AM5 A;  3QB9 A;  1YV1 A;  5K53 A;  5E1U A;  2WLU A;  3E1Q A;  1DVB A;  5D8Y A;  3E2C A;  2YW7 A;  1BG7 A;  3C1Z A;  4W4L B;  1NF4 A;  2C6R A;  3RBC A;  3BVF A;  3GHQ A;  3Q4O A;  3UOF A;  2VZB A;  3NOZ X;  4MY7 A;  1TKO A;  2WTL A;  2XJN A;  4ZKH A;  3WVV A;  4MJY A;  5JKM A;  4DYU A;  4EVE A;  3LKD A;  5JKL A;  5CZU A;  3R2K A;  3QZ3 A;  2QQY A;  2VXX A;  2V2I A;  4WJG 4;  4CVP A;  4MN9 A;  4YXM A;  2V15 A;  4CMY V;  3F35 A;  5FFD A;  3PWQ C;  4REU A;  3Q4N A;  2VXI A;  4PG1 A;  1RCD A;  3C1Y A;  3Q4Q A;  2BK6 A;  3KXU A;  3PWQ A;  4YVZ A;  1Z4A A;  2FJC A;  3BT5 A;  3FRR A;  4LQJ A;  4TOG A;  1SQ3 A;  3E1O A;  4XKU A;  5E2D A;  3C21 A;  1YUX A;  2Y3Q A;  3OGH A;  5LBH A;  4XGS A;  3VNX A;  3AJO A;  2CHP A;  4II4 B;  1KRQ A;  3A68 A;  4LQN A;  1J30 A;  2JD7 0;  4CY9 A;  1VEQ A;  2BKC A;  4II4 A;  4KVR A;  3AF8 X;  2C2U A;  1LKO A;  3GGY A;  2FZF A;  4TO9 A;  5GU2 X;  1OTK A;  3IS8 A;  2GYD A;  3ES3 A;  3Q4R A;  2OKC A;  3AJP A;  4TOF A;  3T9J A;  2IB0 A;  4R42 A;  3A9Q A;  1Z6O A;  1F33 A;  4DZ0 A;  2BJY A;  1RCE A;  3BKN A;  4EVB A;  4ITW A;  4AM2 A;  1UVH A;  1L8I A;  1JKV A;  4TW3 A;  2ZG8 X;  3SHX A;  3FSE A;  4CVT A;  3E1L A;  3PW8 C;  3VV9 A;  2BW1 A;  3C23 A;  4XKT A;  3E1M A;  4TOH A;  3AF9 X;  1BCF A;  3PW8 A;  4A25 A;  1ZS3 A;  3O7S A;  3EGM A;  2ITB A;  3RD0 A;  1IES A;  4KXR B;  1H96 A;  1R03 A;  4MXP A;  2CIH A;  2YJJ A;  4DE6 A;  2V2N A;  3FRS A;  5J8S A;  4ZKX A;  3F33 A;  2AR0 A;  1DAT A;  3D19 A;  4RC7 B;  3SE1 A;  4PGI A;  1JIG A;  5D8R A;  3AK8 A;  3QD8 A;  4Y08 A;  4RC7 A;  4ZLW A;  3BVL A;  2XKQ A;  3VVA A;  2CF7 A;  3AK9 A;  1RCG A;  3PZA A;  3F39 A;  4ZL5 A;  1GWG A;  1RCC A;  4X0J A;  3WNW A;  3GGZ A;  1AEW A;  1VEL A;  2XJM A;  3QVD A;  2Z6M A;  5HU6 D;  3PVY B;  2ZG9 X;  4P18 A;  4LPM A;  3KHK A;  1LKP A;  1XZ1 A;  2G38 B;  3PVY A;  1FHA A;  3HIU A;  3WVU A;  4CMY A;  1HRS A;  3R2H A;  4ML5 A;  4CYA A;  3U90 A;  5GU1 X;  1RCI A;  4LPN A;  2Z5P A;  2JD8 0;  2Z5R A;  5FFC A;  2D5K A;  2FFX J;  5D8X A;  4W4K B;  3IQ1 A;  3KA4 A;  2C2J A;  5GN8 B;  1XZ3 A;  4DYZ A;  5GU3 X;  5C6F A;  2V2R A;  3OJ5 A;  4E40 A;  3KA6 A;  5GN8 A;  4Z5S A;  4ZL6 A;  5K52 A;  1S30 A;  3KWO A;  1LKM A;  2ZA6 A;  3PW1 B;  3UNO A;  5D8O A;  1N1Q A;  5D8Q A;  3N6O A;  4EVD A;  4ETR A;  2V2S A;  3JZA B;  2FG8 A;  3RE7 A;  4OYN A;  3PW1 A;  4LQV A;  2XGW A;  4DI0 A;  4Z3B A;  5JAC A;  3IS7 A;  2RBD A;  2WWX B;  4CVR A;  3KA8 A;  5LS9 A;  2CLB A;  3NP0 X;  4LPJ A;  2GYQ A;  2YW6 A;  4ZTT A;  1UMN A;  5D8S A;  1JI4 A;  2WLA A;  3BVK A;  1NF6 A;  2V2P A;  2V2M A;  3QHB A;  1LB3 A;  2HR5 A;  4AM4 A;  5GOU A;  4RC8 A;  4YKH A;  1NNQ A;  1JGC A;  3O7R A;  3F38 A;  3E6R A;  3PVT B;  3V3K B;  1EUM A;  4ITT A;  3NP2 X;  2FL0 A;  5J93 A;  2UX1 A;  1TK6 A;  5FFB A;  3PVT A;  4CVS A;  1MFR A;  2CLU A;  4IXK A;  5LG2 A;  3W54 A;  4CYB A;  1NFV A;  3R2O A;  4YXJ A;  3R2S A;  1JKU A;  4MUD A;  2X17 0;  2YJK A;  5IX6 A;  2N02 A;  3RAV A;  3BVE A;  4PGK A;  5CMQ A;  3KA9 A;  1SOF A;  3EZ0 A;  2CN7 A;  2JD6 0;  3E1N A;  4TOE A;  2G4H A;  2CEI A;  3HL1 A;  2Z5Q A;  5JDO B;  2CWL A;  2ZG7 X;  5HQO A;  2V2L A;  2ZUR X;  4U3G A;  3SH6 A;  3UFB A;  4ZMC A;  5JDO A;  3GVY A;  5ERK A;  5FFE A;  1VLG A;  3F37 A;  2PYB A;  3SID A;  5LG8 A;  3F36 A;  3RGD A;  3H7G A;  5HJF A;  4TOD A;  5CMR A;  2W0O A;  4TOC A;  1F30 A;  2XJO A;  1S2Z A;  3ISE A;  4DYX A;  1Z6O M;  5HJH A;  3QHC A;  1IER A;  1DPS A;  1VEI A;  4EVC A;  3R2L A;  2GS4 A;  4QUW A;  1VJX A;  4TOA A;  2C41 A; 
#chains in the Genus database with same CATH homology
 3DBY A;  4MKU A;  3ERZ A;  4LQH A;  2FG4 A;  1BFR A;  5D8P A;  1RYT A;  2V8U A;  2FHA A;  4DYY A;  2V2J A;  5I4J A;  3KA3 A;  3UOI A;  3AF7 X;  1L8H A;  1QGH A;  3PVR B;  2IU2 A;  3EZU A;  4TOB A;  1YUZ A;  1O9I A;  2Z90 A;  3F32 A;  1JRE A;  3R2M A;  3BVI A;  3PVR A;  3KX9 A;  2CHI A;  1B71 A;  5J9V A;  3MPS A;  4M34 A;  1O9R A;  1JI5 A;  4M33 A;  3FI6 A;  2OH3 A;  2IY4 A;  5ERJ A;  2Y44 A;  4M35 A;  1JTS A;  4KVS A;  4ISP A;  2FKZ A;  3E6S A;  3PWF A;  4XKS A;  3L0M A;  2MGY A;  4PG0 A;  5AXS A;  4RC6 B;  3WVW A;  4E6K A;  1JYB A;  4RC6 A;  1TKP A;  3FVB A;  2OC5 A;  5J8W A;  5FEJ A;  2V8T A;  4LYX A;  2C2F A;  3E1P A;  3E1J A;  4DAS A;  3R2R A;  1TJO A;  4LYU A;  3AJQ A;  2ZA7 A;  1MOJ A;  4RC5 B;  3M6J A;  3TA8 A;  2ZA8 A;  4ZJK A;  4ERU A;  4RC5 A;  1ZUJ A;  3GE4 A;  1S3Q A;  5FFA A;  2QF9 A;  4IWJ A;  4KVQ A;  5JKM G;  2HTN A;  3F34 A;  5GU0 X;  3JZ9 A;  5JKL G;  2V2O A;  4M32 A;  2CN6 A;  3ISF A;  4IWK A;  1QYB A;  2F7N A;  4ZKW A;  4ISM A;  3KDQ A;  4AM5 A;  3QB9 A;  1YV1 A;  5K53 A;  5E1U A;  2WLU A;  3E1Q A;  1DVB A;  5D8Y A;  3E2C A;  2YW7 A;  1BG7 A;  3C1Z A;  4W4L B;  1NF4 A;  2C6R A;  3RBC A;  3BVF A;  3GHQ A;  3Q4O A;  3UOF A;  2VZB A;  3NOZ X;  4MY7 A;  1TKO A;  2WTL A;  2XJN A;  4ZKH A;  3WVV A;  4MJY A;  5JKM A;  4DYU A;  4EVE A;  3LKD A;  5JKL A;  5CZU A;  3R2K A;  3QZ3 A;  2QQY A;  2VXX A;  2V2I A;  4WJG 4;  4CVP A;  4MN9 A;  4YXM A;  2V15 A;  4CMY V;  3F35 A;  5FFD A;  3PWQ C;  4REU A;  3Q4N A;  2VXI A;  4PG1 A;  1RCD A;  3C1Y A;  3Q4Q A;  2BK6 A;  3KXU A;  3PWQ A;  4YVZ A;  1Z4A A;  2FJC A;  3BT5 A;  3FRR A;  4LQJ A;  4TOG A;  1SQ3 A;  3E1O A;  4XKU A;  5E2D A;  3C21 A;  1YUX A;  2Y3Q A;  3OGH A;  5LBH A;  4XGS A;  3VNX A;  3AJO A;  2CHP A;  4II4 B;  1KRQ A;  3A68 A;  4LQN A;  1J30 A;  2JD7 0;  4CY9 A;  1VEQ A;  2BKC A;  4II4 A;  4KVR A;  3AF8 X;  2C2U A;  1LKO A;  3GGY A;  2FZF A;  4TO9 A;  5GU2 X;  1OTK A;  3IS8 A;  2GYD A;  3ES3 A;  3Q4R A;  2OKC A;  3AJP A;  4TOF A;  3T9J A;  2IB0 A;  4R42 A;  3A9Q A;  1Z6O A;  1F33 A;  4DZ0 A;  2BJY A;  1RCE A;  3BKN A;  4EVB A;  4ITW A;  4AM2 A;  1UVH A;  1L8I A;  1JKV A;  4TW3 A;  2ZG8 X;  3SHX A;  3FSE A;  4CVT A;  3E1L A;  3PW8 C;  3VV9 A;  2BW1 A;  3C23 A;  4XKT A;  3E1M A;  4TOH A;  3AF9 X;  1BCF A;  3PW8 A;  4A25 A;  1ZS3 A;  3O7S A;  3EGM A;  2ITB A;  3RD0 A;  1IES A;  4KXR B;  1H96 A;  1R03 A;  4MXP A;  2CIH A;  2YJJ A;  4DE6 A;  2V2N A;  3FRS A;  5J8S A;  4ZKX A;  3F33 A;  2AR0 A;  1DAT A;  3D19 A;  4RC7 B;  3SE1 A;  4PGI A;  1JIG A;  5D8R A;  3AK8 A;  3QD8 A;  4Y08 A;  4RC7 A;  4ZLW A;  3BVL A;  2XKQ A;  3VVA A;  2CF7 A;  3AK9 A;  1RCG A;  3PZA A;  3F39 A;  4ZL5 A;  1GWG A;  1RCC A;  4X0J A;  3WNW A;  3GGZ A;  1AEW A;  1VEL A;  2XJM A;  3QVD A;  2Z6M A;  5HU6 D;  3PVY B;  2ZG9 X;  4P18 A;  4LPM A;  3KHK A;  1LKP A;  1XZ1 A;  2G38 B;  3PVY A;  1FHA A;  3HIU A;  3WVU A;  4CMY A;  1HRS A;  3R2H A;  4ML5 A;  4CYA A;  3U90 A;  5GU1 X;  1RCI A;  4LPN A;  2Z5P A;  2JD8 0;  2Z5R A;  5FFC A;  2D5K A;  2FFX J;  5D8X A;  4W4K B;  3IQ1 A;  3KA4 A;  2C2J A;  5GN8 B;  1XZ3 A;  4DYZ A;  5GU3 X;  5C6F A;  2V2R A;  3OJ5 A;  4E40 A;  3KA6 A;  5GN8 A;  4Z5S A;  4ZL6 A;  5K52 A;  1S30 A;  3KWO A;  1LKM A;  2ZA6 A;  3PW1 B;  3UNO A;  5D8O A;  1N1Q A;  5D8Q A;  3N6O A;  4EVD A;  4ETR A;  2V2S A;  3JZA B;  2FG8 A;  3RE7 A;  4OYN A;  3PW1 A;  4LQV A;  2XGW A;  4DI0 A;  4Z3B A;  5JAC A;  3IS7 A;  2RBD A;  2WWX B;  4CVR A;  3KA8 A;  5LS9 A;  2CLB A;  3NP0 X;  4LPJ A;  2GYQ A;  2YW6 A;  4ZTT A;  1UMN A;  5D8S A;  1JI4 A;  2WLA A;  3BVK A;  1NF6 A;  2V2P A;  2V2M A;  3QHB A;  1LB3 A;  2HR5 A;  4AM4 A;  5GOU A;  4RC8 A;  4YKH A;  1NNQ A;  1JGC A;  3O7R A;  3F38 A;  3E6R A;  3PVT B;  3V3K B;  1EUM A;  4ITT A;  3NP2 X;  2FL0 A;  5J93 A;  2UX1 A;  1TK6 A;  5FFB A;  3PVT A;  4CVS A;  1MFR A;  2CLU A;  4IXK A;  5LG2 A;  3W54 A;  4CYB A;  1NFV A;  3R2O A;  4YXJ A;  3R2S A;  1JKU A;  4MUD A;  2X17 0;  2YJK A;  5IX6 A;  2N02 A;  3RAV A;  3BVE A;  4PGK A;  5CMQ A;  3KA9 A;  1SOF A;  3EZ0 A;  2CN7 A;  2JD6 0;  3E1N A;  4TOE A;  2G4H A;  2CEI A;  3HL1 A;  2Z5Q A;  5JDO B;  2CWL A;  2ZG7 X;  5HQO A;  2V2L A;  2ZUR X;  4U3G A;  3SH6 A;  3UFB A;  4ZMC A;  5JDO A;  3GVY A;  5ERK A;  5FFE A;  1VLG A;  3F37 A;  2PYB A;  3SID A;  5LG8 A;  3F36 A;  3RGD A;  3H7G A;  5HJF A;  4TOD A;  5CMR A;  2W0O A;  4TOC A;  1F30 A;  2XJO A;  1S2Z A;  3ISE A;  4DYX A;  1Z6O M;  5HJH A;  3QHC A;  1IER A;  1DPS A;  1VEI A;  4EVC A;  3R2L A;  2GS4 A;  4QUW A;  1VJX A;  4TOA A;  2C41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...