3PVTB

The phenylacetyl-coa monooxygenase paaac subcomplex with 3-hydroxybutanoyl-coa
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
237
structure length
237
Chain Sequence
SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Phenylacetic acid degradation protein paaA
publication title Structural and Functional Studies of the Escherichia coli Phenylacetyl-CoA Monooxygenase Complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 237
sequence length 237
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pvtB00
3WVVA 2PYBA 4ZLWA 3IS7A 3PWQC 5J8WA 3SH6A 4MKUA 5D8PA 4TOBA 2C2FA 3E2CA 2YJJA 4E6KA 5C6FA 5LBHA 1HRSA 4TOEA 3PWQA 5GU2X 2XJMA 4RC7A 3R2KA 4CVPA 5FFBA 2FG4A 3KA4A 4MN9A 4CYBA 5JACA 3QB9A 5D8RA 3F34A 4TOAA 1JI4A 1F33A 1LKOA 1UMNA 3AF9X 3RE7A 1N1QA 4ETRA 1SOFA 2C2UA 2CHIA 3BVFA 4ISMA 3PW1A 3Q4RA 4MUDA 1DPSA 2HTNA 4TOCA 2V2OA 2V2SA 4ZKWA 2FJCA 2Z5RA 4DI0A 1S2ZA 4PG0A 5ERJA 2V2MA 3KXUA 4LYXA 4U3GA 3HL1A 4M35A 4YKHA 4CVTA 3KA3A 3BVIA 2UX1A 4QUWA 4ZL6A 2ITBA 2VXIA 1NFVA 4TOHA 2WLUA 1B71A 4ITTA 2V2NA 4P18A 1Z6OA 1MFRA 1H96A 2HR5A 3PVRB 3PVYB 1Z6OM 5GU1X 1O9IA 3AJPA 5D8YA 4RC6B 1JIGA 4DASA 1TKPA 2V2IA 3WNWA 5D8OA 4AM4A 3E1PA 5LG8A 4CMYV 3T9JA 4II4B 4RC8A 2FFXJ 2CF7A 2YJKA 2JD80 2OC5A 2F7NA 2V2LA 3R2RA 1TKOA 4EVCA 3MPSA 2V2JA 1DATA 1TK6A 1S3QA 1GWGA 2RBDA 3F33A 3BVLA 3F35A 3KA8A 3R2OA 5J8SA 2XKQA 5J93A 5FFDA 3NP0X 4REUA 5FFAA 4CMYA 2FKZA 3EGMA 4TW3A 1FHAA 3F37A 3PVYA 3PVRA 1O9RA 4IXKA 4ITWA 1JKUA 2ZURX 3KX9A 3AK8A 3QD8A 4LQHA 4RC6A 5JKLG 1RYTA 1JI5A 1F30A 5HQOA 4MY7A 3BVKA 4II4A 4EVDA 3GVYA 3E1QA 1XZ3A 1BG7A 4LYUA 4LQVA 1JREA 4CVRA 5D8SA 5JKLA 3F38A 2GYDA 2WTLA 4TODA 5IX6A 1L8HA 3PW8C 4LQNA 4ZKHA 5GOUA 2X170 3IQ1A 5JKMG 5K53A 5GN8A 1AEWA 3E1OA 4R42A 2YW6A 4ZL5A 3F39A 1IERA 1VJXA 3PVTB 1YV1A 3SIDA 1JGCA 4DZ0A 2CLBA 3PW8A 3RBCA 2CN7A 2ZG8X 3QVDA 2CLUA 5FFCA 3QZ3A 5FEJA 4KVRA 2CN6A 2IU2A 5CZUA 1VLGA 1TJOA 2FHAA 4KVSA 3AF8X 3WVUA 1Z4AA 3ES3A 3PZAA 4XGSA 3R2HA 3AJQA 3EZUA 3NP2X 5CMRA 2VXXA 4IWJA 1JTSA 3PWFA 3WVWA 2CHPA 3ISEA 3Q4OA 2GYQA 4OYNA 3PVTA 1RCGA 2Z5PA 4XKUA 3VNXA 5D8XA 3OGHA 2C6RA 1YUZA 3A9QA 2ZA6A 1IESA 2CEIA 4ML5A 2XJOA 3RGDA 4M32A 5FFEA 3H7GA 4DYUA 3Q4NA 1KRQA 4DYYA 1SQ3A 2ZG7X 1XZ1A 4Z3BA 4A25A 4RC5B 1L8IA 3AK9A 4CY9A 3U90A 1JKVA 1UVHA 3O7RA 3UNOA 1ZS3A 3SHXA 2CIHA 4EVEA 4PGKA 5K52A 1VEQA 2JD70 1JYBA 2Z5QA 2V2PA 2C2JA 4PGIA 4CVSA 3PW1B 4IWKA 3RAVA 5CMQA 3UOIA 4PG1A 3E1JA 3ISFA 1VEIA 1S30A 4RC5A 3KWOA 2ZA7A 5I4JA 5J9VA 3E6SA 2IY4A 3F36A 2Z6MA 3ERZA 1OTKA 2G4HA 4ZJKA 1LB3A 5LS9A 1LKMA 2FL0A 1VELA 2ZG9X 3AJOA 2OH3A 4KVQA 3R2MA 2JD60 4ERUA 2QF9A 2XGWA 3SE1A 2GS4A 3BKNA 1BFRA 3OJ5A 3EZ0A 4TOFA 5E2DA 3UOFA 4ZKXA 2W0OA 5JKMA 3GHQA 4Y08A 2BJYA 4LPMA 4DYZA 1BCFA 3R2LA 4LPNA 4AM5A 2ZA8A 1R03A 3E1LA 2D5KA 1NF4A 3FVBA 1QYBA 4DYXA 3FI6A 4TOGA 4ZMCA 1NF6A 3GE4A 3O7SA 1NNQA 4XKSA 2V15A 4M34A 1RCEA 1RCCA 3KA6A 3F32A 3QHBA 2IB0A 2BW1A 4CYAA 1YUXA 3A68A 5E1UA 3HIUA 5AXSA 2FG8A 2XJNA 4XKTA 4MJYA 3AF7X 3BT5A 5GU0X 5HJHA 4M33A 4Z5SA 2BK6A 4LPJA 2C41A 2Z90A 1ZUJA 2FZFA 2YW7A 3FSEA 2BKCA 2Y3QA 3BVEA 3Q4QA 1LKPA 4EVBA 2V2RA 1RCIA 1J30A 3E1MA 5GU3X 4RC7B 1DVBA 3IS8A 3E6RA 1QGHA 4ZTTA 4LQJA 2VZBA 5HJFA 4AM2A 1RCDA 5LG2A 1MOJA 3TA8A 2WLAA 3R2SA 4TO9A 4ISPA 3NOZX 5GN8B 3QHCA 3RD0A 5ERKA 5D8QA 3KA9A 2QQYA 4DE6A 1EUMA 3E1NA
chains in the Genus database with same CATH superfamily
3WVVA 2PYBA 4ZLWA 3IS7A 3PWQC 3DBYA 3C23A 5J8WA 3SH6A 4MKUA 2OKCA 5D8PA 4TOBA 2C2FA 3E2CA 2YJJA 5JDOA 4E6KA 5C6FA 5LBHA 1HRSA 4TOEA 3PWQA 5GU2X 2XJMA 4RC7A 3R2KA 4CVPA 5FFBA 2FG4A 3KA4A 4MN9A 4CYBA 5JACA 3QB9A 5D8RA 3F34A 4TOAA 1JI4A 1F33A 1LKOA 1UMNA 3VVAA 3AF9X 3RE7A 1N1QA 4ETRA 1SOFA 2C2UA 2CHIA 3BVFA 3V3KB 4ISMA 3PW1A 4W4LB 3Q4RA 4MUDA 1DPSA 2HTNA 4TOCA 4E40A 2V2OA 2V2SA 4ZKWA 2FJCA 2Z5RA 4DI0A 1S2ZA 4PG0A 5ERJA 2V2MA 3KXUA 4LYXA 4U3GA 3HL1A 4M35A 4YKHA 4CVTA 3KA3A 3BVIA 2UX1A 4QUWA 4ZL6A 3W54A 2ITBA 2VXIA 1NFVA 4TOHA 2WLUA 1B71A 4ITTA 2V2NA 4P18A 3D19A 1Z6OA 1MFRA 1H96A 4YVZA 2HR5A 3PVRB 3PVYB 1Z6OM 5GU1X 1O9IA 3AJPA 5D8YA 5HU6D 4YXMA 4RC6B 1JIGA 4DASA 3L0MA 1TKPA 2V2IA 3WNWA 5D8OA 4AM4A 3E1PA 5LG8A 4CMYV 3T9JA 4II4B 4RC8A 2FFXJ 2CF7A 2YJKA 2JD80 2OC5A 2F7NA 2V2LA 3R2RA 1TKOA 4EVCA 3MPSA 2V2JA 1DATA 1TK6A 1S3QA 1GWGA 2RBDA 3F33A 3BVLA 3F35A 3KA8A 3R2OA 5J8SA 2XKQA 5J93A 5FFDA 3NP0X 4REUA 5FFAA 4CMYA 2FKZA 3EGMA 4TW3A 1FHAA 3F37A 3PVYA 3PVRA 1O9RA 4IXKA 4ITWA 1JKUA 2ZURX 3C1YA 3KX9A 3AK8A 3QD8A 4LQHA 4RC6A 5JKLG 1RYTA 1JI5A 3FRRA 1F30A 5HQOA 4MY7A 4MXPA 3BVKA 4II4A 4EVDA 3GVYA 3E1QA 1XZ3A 1BG7A 3GGZA 4LYUA 4LQVA 1JREA 4CVRA 5D8SA 5JKLA 3F38A 2GYDA 2WTLA 4TODA 4YXJA 5IX6A 1L8HA 3PW8C 2WWXB 3VV9A 4LQNA 4ZKHA 5GOUA 2X170 3IQ1A 5JKMG 5K53A 5GN8A 1AEWA 3E1OA 4R42A 2YW6A 4ZL5A 3F39A 1IERA 1VJXA 3PVTB 1YV1A 3SIDA 1JGCA 4DZ0A 2CLBA 3PW8A 3RBCA 2CN7A 3KHKA 2ZG8X 3QVDA 2CLUA 5FFCA 3QZ3A 3GGYA 4KXRB 5FEJA 4KVRA 2CN6A 2IU2A 5CZUA 1VLGA 1TJOA 2FHAA 4KVSA 3AF8X 3WVUA 1Z4AA 3ES3A 3PZAA 4XGSA 2G38B 3R2HA 3AJQA 3EZUA 3NP2X 5CMRA 2VXXA 3FRSA 4IWJA 1JTSA 3C21A 3PWFA 3WVWA 2CHPA 3ISEA 3Q4OA 2GYQA 3UFBA 4OYNA 3PVTA 1RCGA 2Z5PA 4XKUA 2Y44A 3VNXA 5D8XA 3OGHA 2C6RA 1YUZA 3A9QA 2ZA6A 1IESA 2CEIA 4ML5A 2XJOA 3RGDA 4M32A 5FFEA 3H7GA 4DYUA 3Q4NA 1KRQA 4DYYA 1SQ3A 2ZG7X 1XZ1A 4Z3BA 4A25A 4RC5B 3KDQA 1L8IA 3AK9A 5JDOB 3M6JA 4CY9A 3U90A 1JKVA 1UVHA 3O7RA 3UNOA 1ZS3A 3SHXA 2CIHA 4EVEA 4PGKA 2N02A 2V8UA 5K52A 1VEQA 2JD70 1JYBA 2Z5QA 2CWLA 2V2PA 2C2JA 4PGIA 3JZ9A 4CVSA 3PW1B 4IWKA 3RAVA 5CMQA 3UOIA 4PG1A 3E1JA 3ISFA 1VEIA 1S30A 2V8TA 4RC5A 3KWOA 2ZA7A 5I4JA 5J9VA 3E6SA 3C1ZA 2IY4A 3F36A 2Z6MA 3ERZA 1OTKA 2G4HA 4ZJKA 1LB3A 5LS9A 1LKMA 2FL0A 1VELA 2ZG9X 3AJOA 2OH3A 4KVQA 3R2MA 2JD60 2MGYA 4ERUA 2QF9A 2XGWA 3SE1A 2GS4A 3BKNA 1BFRA 3OJ5A 3EZ0A 4TOFA 5E2DA 3UOFA 4ZKXA 2W0OA 5JKMA 3GHQA 4Y08A 4WJG4 2BJYA 4LPMA 4DYZA 1BCFA 3R2LA 4LPNA 4AM5A 2ZA8A 1R03A 3E1LA 3LKDA 2D5KA 1NF4A 3FVBA 1QYBA 4DYXA 3FI6A 4TOGA 4ZMCA 1NF6A 3GE4A 3O7SA 1NNQA 4XKSA 2V15A 4M34A 1RCEA 1RCCA 3KA6A 3F32A 3QHBA 2IB0A 2BW1A 4CYAA 1YUXA 3A68A 5E1UA 3HIUA 5AXSA 2FG8A 2XJNA 4XKTA 4MJYA 3AF7X 3BT5A 5GU0X 5HJHA 4M33A 4Z5SA 2BK6A 4LPJA 2C41A 2Z90A 3JZAB 1ZUJA 2FZFA 2YW7A 3FSEA 2BKCA 2Y3QA 3BVEA 3Q4QA 4W4KB 1LKPA 4EVBA 2V2RA 1RCIA 1J30A 3E1MA 5GU3X 4RC7B 1DVBA 3IS8A 4X0JA 3E6RA 1QGHA 4ZTTA 4LQJA 2VZBA 5HJFA 4AM2A 1RCDA 5LG2A 1MOJA 3TA8A 2WLAA 2AR0A 3N6OA 3R2SA 4TO9A 4ISPA 3NOZX 5GN8B 3QHCA 3RD0A 5ERKA 5D8QA 3KA9A 2QQYA 4DE6A 1EUMA 3E1NA
chains in the Genus database with same CATH topology
3WVVA 2PYBA 4ZLWA 3IS7A 3PWQC 3DBYA 3C23A 5J8WA 3SH6A 4MKUA 2OKCA 5D8PA 4TOBA 2C2FA 3E2CA 2YJJA 5JDOA 4E6KA 5C6FA 5LBHA 1HRSA 4TOEA 3PWQA 5GU2X 2XJMA 4RC7A 3R2KA 4CVPA 5FFBA 2FG4A 3KA4A 4MN9A 4CYBA 5JACA 3QB9A 5D8RA 3F34A 4TOAA 1JI4A 1F33A 1LKOA 1UMNA 3VVAA 3AF9X 3RE7A 1N1QA 4ETRA 1SOFA 2C2UA 2CHIA 3BVFA 3V3KB 4ISMA 3PW1A 4W4LB 3Q4RA 4MUDA 1DPSA 2HTNA 4TOCA 4E40A 2V2OA 2V2SA 4ZKWA 2FJCA 2Z5RA 4DI0A 1S2ZA 4PG0A 5ERJA 2V2MA 3KXUA 4LYXA 4U3GA 3HL1A 4M35A 4YKHA 4CVTA 3KA3A 3BVIA 2UX1A 4QUWA 4ZL6A 3W54A 2ITBA 2VXIA 1NFVA 4TOHA 2WLUA 1B71A 4ITTA 2V2NA 4P18A 3D19A 1Z6OA 1MFRA 1H96A 4YVZA 2HR5A 3PVRB 3PVYB 1Z6OM 5GU1X 1O9IA 3AJPA 5D8YA 5HU6D 4YXMA 4RC6B 1JIGA 4DASA 3L0MA 1TKPA 2V2IA 3WNWA 5D8OA 4AM4A 3E1PA 5LG8A 4CMYV 3T9JA 4II4B 4RC8A 2FFXJ 2CF7A 2YJKA 2JD80 2OC5A 2F7NA 2V2LA 3R2RA 1TKOA 4EVCA 3MPSA 2V2JA 1DATA 1TK6A 1S3QA 1GWGA 2RBDA 3F33A 3BVLA 3F35A 3KA8A 3R2OA 5J8SA 2XKQA 5J93A 5FFDA 3NP0X 4REUA 5FFAA 4CMYA 2FKZA 3EGMA 4TW3A 1FHAA 3F37A 3PVYA 3PVRA 1O9RA 4IXKA 4ITWA 1JKUA 2ZURX 3C1YA 3KX9A 3AK8A 3QD8A 4LQHA 4RC6A 5JKLG 1RYTA 1JI5A 3FRRA 1F30A 5HQOA 4MY7A 4MXPA 3BVKA 4II4A 4EVDA 3GVYA 3E1QA 1XZ3A 1BG7A 3GGZA 4LYUA 4LQVA 1JREA 4CVRA 5D8SA 5JKLA 3F38A 2GYDA 2WTLA 4TODA 4YXJA 5IX6A 1L8HA 3PW8C 2WWXB 3VV9A 4LQNA 4ZKHA 5GOUA 2X170 3IQ1A 5JKMG 5K53A 5GN8A 1AEWA 3E1OA 4R42A 2YW6A 4ZL5A 3F39A 1IERA 1VJXA 3PVTB 1YV1A 3SIDA 1JGCA 4DZ0A 2CLBA 3PW8A 3RBCA 2CN7A 3KHKA 2ZG8X 3QVDA 2CLUA 5FFCA 3QZ3A 3GGYA 4KXRB 5FEJA 4KVRA 2CN6A 2IU2A 5CZUA 1VLGA 1TJOA 2FHAA 4KVSA 3AF8X 3WVUA 1Z4AA 3ES3A 3PZAA 4XGSA 2G38B 3R2HA 3AJQA 3EZUA 3NP2X 5CMRA 2VXXA 3FRSA 4IWJA 1JTSA 3C21A 3PWFA 3WVWA 2CHPA 3ISEA 3Q4OA 2GYQA 3UFBA 4OYNA 3PVTA 1RCGA 2Z5PA 4XKUA 2Y44A 3VNXA 5D8XA 3OGHA 2C6RA 1YUZA 3A9QA 2ZA6A 1IESA 2CEIA 4ML5A 2XJOA 3RGDA 4M32A 5FFEA 3H7GA 4DYUA 3Q4NA 1KRQA 4DYYA 1SQ3A 2ZG7X 1XZ1A 4Z3BA 4A25A 4RC5B 3KDQA 1L8IA 3AK9A 5JDOB 3M6JA 4CY9A 3U90A 1JKVA 1UVHA 3O7RA 3UNOA 1ZS3A 3SHXA 2CIHA 4EVEA 4PGKA 2N02A 2V8UA 5K52A 1VEQA 2JD70 1JYBA 2Z5QA 2CWLA 2V2PA 2C2JA 4PGIA 3JZ9A 4CVSA 3PW1B 4IWKA 3RAVA 5CMQA 3UOIA 4PG1A 3E1JA 3ISFA 1VEIA 1S30A 2V8TA 4RC5A 3KWOA 2ZA7A 5I4JA 5J9VA 3E6SA 3C1ZA 2IY4A 3F36A 2Z6MA 3ERZA 1OTKA 2G4HA 4ZJKA 1LB3A 5LS9A 1LKMA 2FL0A 1VELA 2ZG9X 3AJOA 2OH3A 4KVQA 3R2MA 2JD60 2MGYA 4ERUA 2QF9A 2XGWA 3SE1A 2GS4A 3BKNA 1BFRA 3OJ5A 3EZ0A 4TOFA 5E2DA 3UOFA 4ZKXA 2W0OA 5JKMA 3GHQA 4Y08A 4WJG4 2BJYA 4LPMA 4DYZA 1BCFA 3R2LA 4LPNA 4AM5A 2ZA8A 1R03A 3E1LA 3LKDA 2D5KA 1NF4A 3FVBA 1QYBA 4DYXA 3FI6A 4TOGA 4ZMCA 1NF6A 3GE4A 3O7SA 1NNQA 4XKSA 2V15A 4M34A 1RCEA 1RCCA 3KA6A 3F32A 3QHBA 2IB0A 2BW1A 4CYAA 1YUXA 3A68A 5E1UA 3HIUA 5AXSA 2FG8A 2XJNA 4XKTA 4MJYA 3AF7X 3BT5A 5GU0X 5HJHA 4M33A 4Z5SA 2BK6A 4LPJA 2C41A 2Z90A 3JZAB 1ZUJA 2FZFA 2YW7A 3FSEA 2BKCA 2Y3QA 3BVEA 3Q4QA 4W4KB 1LKPA 4EVBA 2V2RA 1RCIA 1J30A 3E1MA 5GU3X 4RC7B 1DVBA 3IS8A 4X0JA 3E6RA 1QGHA 4ZTTA 4LQJA 2VZBA 5HJFA 4AM2A 1RCDA 5LG2A 1MOJA 3TA8A 2WLAA 2AR0A 3N6OA 3R2SA 4TO9A 4ISPA 3NOZX 5GN8B 3QHCA 3RD0A 5ERKA 5D8QA 3KA9A 2QQYA 4DE6A 1EUMA 3E1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVV A;  2PYB A;  4ZLW A;  3IS7 A;  3PWQ C;  5J8W A;  3SH6 A;  4MKU A;  5D8P A;  4TOB A;  2C2F A;  3E2C A;  2YJJ A;  4E6K A;  5C6F A;  5LBH A;  1HRS A;  4TOE A;  3PWQ A;  5GU2 X;  2XJM A;  4RC7 A;  3R2K A;  4CVP A;  5FFB A;  2FG4 A;  3KA4 A;  4MN9 A;  4CYB A;  5JAC A;  3QB9 A;  5D8R A;  3F34 A;  4TOA A;  1JI4 A;  1F33 A;  1LKO A;  1UMN A;  3AF9 X;  3RE7 A;  1N1Q A;  4ETR A;  1SOF A;  2C2U A;  2CHI A;  3BVF A;  4ISM A;  3PW1 A;  3Q4R A;  4MUD A;  1DPS A;  2HTN A;  4TOC A;  2V2O A;  2V2S A;  4ZKW A;  2FJC A;  2Z5R A;  4DI0 A;  1S2Z A;  4PG0 A;  5ERJ A;  2V2M A;  3KXU A;  4LYX A;  4U3G A;  3HL1 A;  4M35 A;  4YKH A;  4CVT A;  3KA3 A;  3BVI A;  2UX1 A;  4QUW A;  4ZL6 A;  2ITB A;  2VXI A;  1NFV A;  4TOH A;  2WLU A;  1B71 A;  4ITT A;  2V2N A;  4P18 A;  1Z6O A;  1MFR A;  1H96 A;  2HR5 A;  3PVR B;  3PVY B;  1Z6O M;  5GU1 X;  1O9I A;  3AJP A;  5D8Y A;  4RC6 B;  1JIG A;  4DAS A;  1TKP A;  2V2I A;  3WNW A;  5D8O A;  4AM4 A;  3E1P A;  5LG8 A;  4CMY V;  3T9J A;  4II4 B;  4RC8 A;  2FFX J;  2CF7 A;  2YJK A;  2JD8 0;  2OC5 A;  2F7N A;  2V2L A;  3R2R A;  1TKO A;  4EVC A;  3MPS A;  2V2J A;  1DAT A;  1TK6 A;  1S3Q A;  1GWG A;  2RBD A;  3F33 A;  3BVL A;  3F35 A;  3KA8 A;  3R2O A;  5J8S A;  2XKQ A;  5J93 A;  5FFD A;  3NP0 X;  4REU A;  5FFA A;  4CMY A;  2FKZ A;  3EGM A;  4TW3 A;  1FHA A;  3F37 A;  3PVY A;  3PVR A;  1O9R A;  4IXK A;  4ITW A;  1JKU A;  2ZUR X;  3KX9 A;  3AK8 A;  3QD8 A;  4LQH A;  4RC6 A;  5JKL G;  1RYT A;  1JI5 A;  1F30 A;  5HQO A;  4MY7 A;  3BVK A;  4II4 A;  4EVD A;  3GVY A;  3E1Q A;  1XZ3 A;  1BG7 A;  4LYU A;  4LQV A;  1JRE A;  4CVR A;  5D8S A;  5JKL A;  3F38 A;  2GYD A;  2WTL A;  4TOD A;  5IX6 A;  1L8H A;  3PW8 C;  4LQN A;  4ZKH A;  5GOU A;  2X17 0;  3IQ1 A;  5JKM G;  5K53 A;  5GN8 A;  1AEW A;  3E1O A;  4R42 A;  2YW6 A;  4ZL5 A;  3F39 A;  1IER A;  1VJX A;  3PVT B;  1YV1 A;  3SID A;  1JGC A;  4DZ0 A;  2CLB A;  3PW8 A;  3RBC A;  2CN7 A;  2ZG8 X;  3QVD A;  2CLU A;  5FFC A;  3QZ3 A;  5FEJ A;  4KVR A;  2CN6 A;  2IU2 A;  5CZU A;  1VLG A;  1TJO A;  2FHA A;  4KVS A;  3AF8 X;  3WVU A;  1Z4A A;  3ES3 A;  3PZA A;  4XGS A;  3R2H A;  3AJQ A;  3EZU A;  3NP2 X;  5CMR A;  2VXX A;  4IWJ A;  1JTS A;  3PWF A;  3WVW A;  2CHP A;  3ISE A;  3Q4O A;  2GYQ A;  4OYN A;  3PVT A;  1RCG A;  2Z5P A;  4XKU A;  3VNX A;  5D8X A;  3OGH A;  2C6R A;  1YUZ A;  3A9Q A;  2ZA6 A;  1IES A;  2CEI A;  4ML5 A;  2XJO A;  3RGD A;  4M32 A;  5FFE A;  3H7G A;  4DYU A;  3Q4N A;  1KRQ A;  4DYY A;  1SQ3 A;  2ZG7 X;  1XZ1 A;  4Z3B A;  4A25 A;  4RC5 B;  1L8I A;  3AK9 A;  4CY9 A;  3U90 A;  1JKV A;  1UVH A;  3O7R A;  3UNO A;  1ZS3 A;  3SHX A;  2CIH A;  4EVE A;  4PGK A;  5K52 A;  1VEQ A;  2JD7 0;  1JYB A;  2Z5Q A;  2V2P A;  2C2J A;  4PGI A;  4CVS A;  3PW1 B;  4IWK A;  3RAV A;  5CMQ A;  3UOI A;  4PG1 A;  3E1J A;  3ISF A;  1VEI A;  1S30 A;  4RC5 A;  3KWO A;  2ZA7 A;  5I4J A;  5J9V A;  3E6S A;  2IY4 A;  3F36 A;  2Z6M A;  3ERZ A;  1OTK A;  2G4H A;  4ZJK A;  1LB3 A;  5LS9 A;  1LKM A;  2FL0 A;  1VEL A;  2ZG9 X;  3AJO A;  2OH3 A;  4KVQ A;  3R2M A;  2JD6 0;  4ERU A;  2QF9 A;  2XGW A;  3SE1 A;  2GS4 A;  3BKN A;  1BFR A;  3OJ5 A;  3EZ0 A;  4TOF A;  5E2D A;  3UOF A;  4ZKX A;  2W0O A;  5JKM A;  3GHQ A;  4Y08 A;  2BJY A;  4LPM A;  4DYZ A;  1BCF A;  3R2L A;  4LPN A;  4AM5 A;  2ZA8 A;  1R03 A;  3E1L A;  2D5K A;  1NF4 A;  3FVB A;  1QYB A;  4DYX A;  3FI6 A;  4TOG A;  4ZMC A;  1NF6 A;  3GE4 A;  3O7S A;  1NNQ A;  4XKS A;  2V15 A;  4M34 A;  1RCE A;  1RCC A;  3KA6 A;  3F32 A;  3QHB A;  2IB0 A;  2BW1 A;  4CYA A;  1YUX A;  3A68 A;  5E1U A;  3HIU A;  5AXS A;  2FG8 A;  2XJN A;  4XKT A;  4MJY A;  3AF7 X;  3BT5 A;  5GU0 X;  5HJH A;  4M33 A;  4Z5S A;  2BK6 A;  4LPJ A;  2C41 A;  2Z90 A;  1ZUJ A;  2FZF A;  2YW7 A;  3FSE A;  2BKC A;  2Y3Q A;  3BVE A;  3Q4Q A;  1LKP A;  4EVB A;  2V2R A;  1RCI A;  1J30 A;  3E1M A;  5GU3 X;  4RC7 B;  1DVB A;  3IS8 A;  3E6R A;  1QGH A;  4ZTT A;  4LQJ A;  2VZB A;  5HJF A;  4AM2 A;  1RCD A;  5LG2 A;  1MOJ A;  3TA8 A;  2WLA A;  3R2S A;  4TO9 A;  4ISP A;  3NOZ X;  5GN8 B;  3QHC A;  3RD0 A;  5ERK A;  5D8Q A;  3KA9 A;  2QQY A;  4DE6 A;  1EUM A;  3E1N A; 
#chains in the Genus database with same CATH topology
 3WVV A;  2PYB A;  4ZLW A;  3IS7 A;  3PWQ C;  3DBY A;  3C23 A;  5J8W A;  3SH6 A;  4MKU A;  2OKC A;  5D8P A;  4TOB A;  2C2F A;  3E2C A;  2YJJ A;  5JDO A;  4E6K A;  5C6F A;  5LBH A;  1HRS A;  4TOE A;  3PWQ A;  5GU2 X;  2XJM A;  4RC7 A;  3R2K A;  4CVP A;  5FFB A;  2FG4 A;  3KA4 A;  4MN9 A;  4CYB A;  5JAC A;  3QB9 A;  5D8R A;  3F34 A;  4TOA A;  1JI4 A;  1F33 A;  1LKO A;  1UMN A;  3VVA A;  3AF9 X;  3RE7 A;  1N1Q A;  4ETR A;  1SOF A;  2C2U A;  2CHI A;  3BVF A;  3V3K B;  4ISM A;  3PW1 A;  4W4L B;  3Q4R A;  4MUD A;  1DPS A;  2HTN A;  4TOC A;  4E40 A;  2V2O A;  2V2S A;  4ZKW A;  2FJC A;  2Z5R A;  4DI0 A;  1S2Z A;  4PG0 A;  5ERJ A;  2V2M A;  3KXU A;  4LYX A;  4U3G A;  3HL1 A;  4M35 A;  4YKH A;  4CVT A;  3KA3 A;  3BVI A;  2UX1 A;  4QUW A;  4ZL6 A;  3W54 A;  2ITB A;  2VXI A;  1NFV A;  4TOH A;  2WLU A;  1B71 A;  4ITT A;  2V2N A;  4P18 A;  3D19 A;  1Z6O A;  1MFR A;  1H96 A;  4YVZ A;  2HR5 A;  3PVR B;  3PVY B;  1Z6O M;  5GU1 X;  1O9I A;  3AJP A;  5D8Y A;  5HU6 D;  4YXM A;  4RC6 B;  1JIG A;  4DAS A;  3L0M A;  1TKP A;  2V2I A;  3WNW A;  5D8O A;  4AM4 A;  3E1P A;  5LG8 A;  4CMY V;  3T9J A;  4II4 B;  4RC8 A;  2FFX J;  2CF7 A;  2YJK A;  2JD8 0;  2OC5 A;  2F7N A;  2V2L A;  3R2R A;  1TKO A;  4EVC A;  3MPS A;  2V2J A;  1DAT A;  1TK6 A;  1S3Q A;  1GWG A;  2RBD A;  3F33 A;  3BVL A;  3F35 A;  3KA8 A;  3R2O A;  5J8S A;  2XKQ A;  5J93 A;  5FFD A;  3NP0 X;  4REU A;  5FFA A;  4CMY A;  2FKZ A;  3EGM A;  4TW3 A;  1FHA A;  3F37 A;  3PVY A;  3PVR A;  1O9R A;  4IXK A;  4ITW A;  1JKU A;  2ZUR X;  3C1Y A;  3KX9 A;  3AK8 A;  3QD8 A;  4LQH A;  4RC6 A;  5JKL G;  1RYT A;  1JI5 A;  3FRR A;  1F30 A;  5HQO A;  4MY7 A;  4MXP A;  3BVK A;  4II4 A;  4EVD A;  3GVY A;  3E1Q A;  1XZ3 A;  1BG7 A;  3GGZ A;  4LYU A;  4LQV A;  1JRE A;  4CVR A;  5D8S A;  5JKL A;  3F38 A;  2GYD A;  2WTL A;  4TOD A;  4YXJ A;  5IX6 A;  1L8H A;  3PW8 C;  2WWX B;  3VV9 A;  4LQN A;  4ZKH A;  5GOU A;  2X17 0;  3IQ1 A;  5JKM G;  5K53 A;  5GN8 A;  1AEW A;  3E1O A;  4R42 A;  2YW6 A;  4ZL5 A;  3F39 A;  1IER A;  1VJX A;  3PVT B;  1YV1 A;  3SID A;  1JGC A;  4DZ0 A;  2CLB A;  3PW8 A;  3RBC A;  2CN7 A;  3KHK A;  2ZG8 X;  3QVD A;  2CLU A;  5FFC A;  3QZ3 A;  3GGY A;  4KXR B;  5FEJ A;  4KVR A;  2CN6 A;  2IU2 A;  5CZU A;  1VLG A;  1TJO A;  2FHA A;  4KVS A;  3AF8 X;  3WVU A;  1Z4A A;  3ES3 A;  3PZA A;  4XGS A;  2G38 B;  3R2H A;  3AJQ A;  3EZU A;  3NP2 X;  5CMR A;  2VXX A;  3FRS A;  4IWJ A;  1JTS A;  3C21 A;  3PWF A;  3WVW A;  2CHP A;  3ISE A;  3Q4O A;  2GYQ A;  3UFB A;  4OYN A;  3PVT A;  1RCG A;  2Z5P A;  4XKU A;  2Y44 A;  3VNX A;  5D8X A;  3OGH A;  2C6R A;  1YUZ A;  3A9Q A;  2ZA6 A;  1IES A;  2CEI A;  4ML5 A;  2XJO A;  3RGD A;  4M32 A;  5FFE A;  3H7G A;  4DYU A;  3Q4N A;  1KRQ A;  4DYY A;  1SQ3 A;  2ZG7 X;  1XZ1 A;  4Z3B A;  4A25 A;  4RC5 B;  3KDQ A;  1L8I A;  3AK9 A;  5JDO B;  3M6J A;  4CY9 A;  3U90 A;  1JKV A;  1UVH A;  3O7R A;  3UNO A;  1ZS3 A;  3SHX A;  2CIH A;  4EVE A;  4PGK A;  2N02 A;  2V8U A;  5K52 A;  1VEQ A;  2JD7 0;  1JYB A;  2Z5Q A;  2CWL A;  2V2P A;  2C2J A;  4PGI A;  3JZ9 A;  4CVS A;  3PW1 B;  4IWK A;  3RAV A;  5CMQ A;  3UOI A;  4PG1 A;  3E1J A;  3ISF A;  1VEI A;  1S30 A;  2V8T A;  4RC5 A;  3KWO A;  2ZA7 A;  5I4J A;  5J9V A;  3E6S A;  3C1Z A;  2IY4 A;  3F36 A;  2Z6M A;  3ERZ A;  1OTK A;  2G4H A;  4ZJK A;  1LB3 A;  5LS9 A;  1LKM A;  2FL0 A;  1VEL A;  2ZG9 X;  3AJO A;  2OH3 A;  4KVQ A;  3R2M A;  2JD6 0;  2MGY A;  4ERU A;  2QF9 A;  2XGW A;  3SE1 A;  2GS4 A;  3BKN A;  1BFR A;  3OJ5 A;  3EZ0 A;  4TOF A;  5E2D A;  3UOF A;  4ZKX A;  2W0O A;  5JKM A;  3GHQ A;  4Y08 A;  4WJG 4;  2BJY A;  4LPM A;  4DYZ A;  1BCF A;  3R2L A;  4LPN A;  4AM5 A;  2ZA8 A;  1R03 A;  3E1L A;  3LKD A;  2D5K A;  1NF4 A;  3FVB A;  1QYB A;  4DYX A;  3FI6 A;  4TOG A;  4ZMC A;  1NF6 A;  3GE4 A;  3O7S A;  1NNQ A;  4XKS A;  2V15 A;  4M34 A;  1RCE A;  1RCC A;  3KA6 A;  3F32 A;  3QHB A;  2IB0 A;  2BW1 A;  4CYA A;  1YUX A;  3A68 A;  5E1U A;  3HIU A;  5AXS A;  2FG8 A;  2XJN A;  4XKT A;  4MJY A;  3AF7 X;  3BT5 A;  5GU0 X;  5HJH A;  4M33 A;  4Z5S A;  2BK6 A;  4LPJ A;  2C41 A;  2Z90 A;  3JZA B;  1ZUJ A;  2FZF A;  2YW7 A;  3FSE A;  2BKC A;  2Y3Q A;  3BVE A;  3Q4Q A;  4W4K B;  1LKP A;  4EVB A;  2V2R A;  1RCI A;  1J30 A;  3E1M A;  5GU3 X;  4RC7 B;  1DVB A;  3IS8 A;  4X0J A;  3E6R A;  1QGH A;  4ZTT A;  4LQJ A;  2VZB A;  5HJF A;  4AM2 A;  1RCD A;  5LG2 A;  1MOJ A;  3TA8 A;  2WLA A;  2AR0 A;  3N6O A;  3R2S A;  4TO9 A;  4ISP A;  3NOZ X;  5GN8 B;  3QHC A;  3RD0 A;  5ERK A;  5D8Q A;  3KA9 A;  2QQY A;  4DE6 A;  1EUM A;  3E1N A; 
#chains in the Genus database with same CATH homology
 3WVV A;  2PYB A;  4ZLW A;  3IS7 A;  3PWQ C;  3DBY A;  3C23 A;  5J8W A;  3SH6 A;  4MKU A;  2OKC A;  5D8P A;  4TOB A;  2C2F A;  3E2C A;  2YJJ A;  5JDO A;  4E6K A;  5C6F A;  5LBH A;  1HRS A;  4TOE A;  3PWQ A;  5GU2 X;  2XJM A;  4RC7 A;  3R2K A;  4CVP A;  5FFB A;  2FG4 A;  3KA4 A;  4MN9 A;  4CYB A;  5JAC A;  3QB9 A;  5D8R A;  3F34 A;  4TOA A;  1JI4 A;  1F33 A;  1LKO A;  1UMN A;  3VVA A;  3AF9 X;  3RE7 A;  1N1Q A;  4ETR A;  1SOF A;  2C2U A;  2CHI A;  3BVF A;  3V3K B;  4ISM A;  3PW1 A;  4W4L B;  3Q4R A;  4MUD A;  1DPS A;  2HTN A;  4TOC A;  4E40 A;  2V2O A;  2V2S A;  4ZKW A;  2FJC A;  2Z5R A;  4DI0 A;  1S2Z A;  4PG0 A;  5ERJ A;  2V2M A;  3KXU A;  4LYX A;  4U3G A;  3HL1 A;  4M35 A;  4YKH A;  4CVT A;  3KA3 A;  3BVI A;  2UX1 A;  4QUW A;  4ZL6 A;  3W54 A;  2ITB A;  2VXI A;  1NFV A;  4TOH A;  2WLU A;  1B71 A;  4ITT A;  2V2N A;  4P18 A;  3D19 A;  1Z6O A;  1MFR A;  1H96 A;  4YVZ A;  2HR5 A;  3PVR B;  3PVY B;  1Z6O M;  5GU1 X;  1O9I A;  3AJP A;  5D8Y A;  5HU6 D;  4YXM A;  4RC6 B;  1JIG A;  4DAS A;  3L0M A;  1TKP A;  2V2I A;  3WNW A;  5D8O A;  4AM4 A;  3E1P A;  5LG8 A;  4CMY V;  3T9J A;  4II4 B;  4RC8 A;  2FFX J;  2CF7 A;  2YJK A;  2JD8 0;  2OC5 A;  2F7N A;  2V2L A;  3R2R A;  1TKO A;  4EVC A;  3MPS A;  2V2J A;  1DAT A;  1TK6 A;  1S3Q A;  1GWG A;  2RBD A;  3F33 A;  3BVL A;  3F35 A;  3KA8 A;  3R2O A;  5J8S A;  2XKQ A;  5J93 A;  5FFD A;  3NP0 X;  4REU A;  5FFA A;  4CMY A;  2FKZ A;  3EGM A;  4TW3 A;  1FHA A;  3F37 A;  3PVY A;  3PVR A;  1O9R A;  4IXK A;  4ITW A;  1JKU A;  2ZUR X;  3C1Y A;  3KX9 A;  3AK8 A;  3QD8 A;  4LQH A;  4RC6 A;  5JKL G;  1RYT A;  1JI5 A;  3FRR A;  1F30 A;  5HQO A;  4MY7 A;  4MXP A;  3BVK A;  4II4 A;  4EVD A;  3GVY A;  3E1Q A;  1XZ3 A;  1BG7 A;  3GGZ A;  4LYU A;  4LQV A;  1JRE A;  4CVR A;  5D8S A;  5JKL A;  3F38 A;  2GYD A;  2WTL A;  4TOD A;  4YXJ A;  5IX6 A;  1L8H A;  3PW8 C;  2WWX B;  3VV9 A;  4LQN A;  4ZKH A;  5GOU A;  2X17 0;  3IQ1 A;  5JKM G;  5K53 A;  5GN8 A;  1AEW A;  3E1O A;  4R42 A;  2YW6 A;  4ZL5 A;  3F39 A;  1IER A;  1VJX A;  3PVT B;  1YV1 A;  3SID A;  1JGC A;  4DZ0 A;  2CLB A;  3PW8 A;  3RBC A;  2CN7 A;  3KHK A;  2ZG8 X;  3QVD A;  2CLU A;  5FFC A;  3QZ3 A;  3GGY A;  4KXR B;  5FEJ A;  4KVR A;  2CN6 A;  2IU2 A;  5CZU A;  1VLG A;  1TJO A;  2FHA A;  4KVS A;  3AF8 X;  3WVU A;  1Z4A A;  3ES3 A;  3PZA A;  4XGS A;  2G38 B;  3R2H A;  3AJQ A;  3EZU A;  3NP2 X;  5CMR A;  2VXX A;  3FRS A;  4IWJ A;  1JTS A;  3C21 A;  3PWF A;  3WVW A;  2CHP A;  3ISE A;  3Q4O A;  2GYQ A;  3UFB A;  4OYN A;  3PVT A;  1RCG A;  2Z5P A;  4XKU A;  2Y44 A;  3VNX A;  5D8X A;  3OGH A;  2C6R A;  1YUZ A;  3A9Q A;  2ZA6 A;  1IES A;  2CEI A;  4ML5 A;  2XJO A;  3RGD A;  4M32 A;  5FFE A;  3H7G A;  4DYU A;  3Q4N A;  1KRQ A;  4DYY A;  1SQ3 A;  2ZG7 X;  1XZ1 A;  4Z3B A;  4A25 A;  4RC5 B;  3KDQ A;  1L8I A;  3AK9 A;  5JDO B;  3M6J A;  4CY9 A;  3U90 A;  1JKV A;  1UVH A;  3O7R A;  3UNO A;  1ZS3 A;  3SHX A;  2CIH A;  4EVE A;  4PGK A;  2N02 A;  2V8U A;  5K52 A;  1VEQ A;  2JD7 0;  1JYB A;  2Z5Q A;  2CWL A;  2V2P A;  2C2J A;  4PGI A;  3JZ9 A;  4CVS A;  3PW1 B;  4IWK A;  3RAV A;  5CMQ A;  3UOI A;  4PG1 A;  3E1J A;  3ISF A;  1VEI A;  1S30 A;  2V8T A;  4RC5 A;  3KWO A;  2ZA7 A;  5I4J A;  5J9V A;  3E6S A;  3C1Z A;  2IY4 A;  3F36 A;  2Z6M A;  3ERZ A;  1OTK A;  2G4H A;  4ZJK A;  1LB3 A;  5LS9 A;  1LKM A;  2FL0 A;  1VEL A;  2ZG9 X;  3AJO A;  2OH3 A;  4KVQ A;  3R2M A;  2JD6 0;  2MGY A;  4ERU A;  2QF9 A;  2XGW A;  3SE1 A;  2GS4 A;  3BKN A;  1BFR A;  3OJ5 A;  3EZ0 A;  4TOF A;  5E2D A;  3UOF A;  4ZKX A;  2W0O A;  5JKM A;  3GHQ A;  4Y08 A;  4WJG 4;  2BJY A;  4LPM A;  4DYZ A;  1BCF A;  3R2L A;  4LPN A;  4AM5 A;  2ZA8 A;  1R03 A;  3E1L A;  3LKD A;  2D5K A;  1NF4 A;  3FVB A;  1QYB A;  4DYX A;  3FI6 A;  4TOG A;  4ZMC A;  1NF6 A;  3GE4 A;  3O7S A;  1NNQ A;  4XKS A;  2V15 A;  4M34 A;  1RCE A;  1RCC A;  3KA6 A;  3F32 A;  3QHB A;  2IB0 A;  2BW1 A;  4CYA A;  1YUX A;  3A68 A;  5E1U A;  3HIU A;  5AXS A;  2FG8 A;  2XJN A;  4XKT A;  4MJY A;  3AF7 X;  3BT5 A;  5GU0 X;  5HJH A;  4M33 A;  4Z5S A;  2BK6 A;  4LPJ A;  2C41 A;  2Z90 A;  3JZA B;  1ZUJ A;  2FZF A;  2YW7 A;  3FSE A;  2BKC A;  2Y3Q A;  3BVE A;  3Q4Q A;  4W4K B;  1LKP A;  4EVB A;  2V2R A;  1RCI A;  1J30 A;  3E1M A;  5GU3 X;  4RC7 B;  1DVB A;  3IS8 A;  4X0J A;  3E6R A;  1QGH A;  4ZTT A;  4LQJ A;  2VZB A;  5HJF A;  4AM2 A;  1RCD A;  5LG2 A;  1MOJ A;  3TA8 A;  2WLA A;  2AR0 A;  3N6O A;  3R2S A;  4TO9 A;  4ISP A;  3NOZ X;  5GN8 B;  3QHC A;  3RD0 A;  5ERK A;  5D8Q A;  3KA9 A;  2QQY A;  4DE6 A;  1EUM A;  3E1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...