3PVTB

The phenylacetyl-coa monooxygenase paaac subcomplex with 3-hydroxybutanoyl-coa
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
237
structure length
237
Chain Sequence
b'SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylacetic acid degradation protein paaA
publication title Structural and Functional Studies of the Escherichia coli Phenylacetyl-CoA Monooxygenase Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 237
sequence length 237
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pvtB00
3AJOA 3F32A 1O9IA 2CLUA 3KA8A 3PVRB 5FEJA 3PW1B 2WLAA 3BVEA 5JKLG 1HRSA 3ES3A 1IESA 5HJFA 1DATA 1ZUJA 2ZG8X 1VEIA 4MUDA 2XGWA 2G4HA 5GOUA 4DYYA 1VJXA 1SQ3A 1YUZA 2HTNA 3PWQA 1XZ3A 3WVUA 4DE6A 3GVYA 4TW3A 1IERA 3QVDA 4M32A 3QB9A 1R03A 1NF6A 3BVLA 4DYUA 1BG7A 3R2KA 3AK8A 3SE1A 1F30A 2GYQA 3E6SA 3NP0X 3RD0A 3PVTA 3RBCA 4DASA 2OH3A 3IQ1A 2CN7A 4PGKA 2YW6A 3E1OA 3SHXA 3QHBA 2QF9A 3TA8A 3O7SA 4CY9A 1MOJA 3BVFA 2ZURX 2V2MA 2ZG7X 5D8RA 3FVBA 5CZUA 3T9JA 4TOBA 1LB3A 4ISMA 4IXKA 1VELA 1JIGA 5JKLA 3BVIA 3E1LA 3O7RA 2CF7A 3KA4A 2Z5QA 4LYUA 4RC6A 4ERUA 4RC5A 5JKMA 5D8XA 3AJPA 1JI5A 4MN9A 2IB0A 5CMQA 1LKOA 1Z4AA 2JD60 3HIUA 3WVWA 3BT5A 5IX6A 5LG2A 4DYXA 4TOGA 4QUWA 4LPMA 3R2MA 1DVBA 1RCDA 4ETRA 4XKUA 4ZTTA 3SIDA 2CEIA 3KWOA 2UX1A 2WLUA 3QHCA 1AEWA 2YJJA 3F34A 4TOAA 4ITTA 3Q4OA 1TKPA 2JD70 2Y3QA 1MFRA 1NFVA 2FHAA 2YJKA 3UOFA 5HQOA 5HJHA 3QD8A 2ZA8A 4U3GA 3Q4QA 2X170 4TODA 5GU2X 5JACA 2HR5A 3H7GA 3R2LA 2OC5A 2C6RA 5JKMG 4EVBA 4LPNA 3R2RA 4EVCA 2BK6A 5GN8B 4DZ0A 3UNOA 1RYTA 2FFXJ 2XKQA 4ISPA 3R2SA 3A9QA 4ZMCA 3EZ0A 4LQHA 4PG0A 4TOEA 1RCIA 1F33A 3PVRA 4MJYA 1JYBA 3PW1A 4PGIA 2XJMA 3F33A 2D5KA 4MKUA 4II4B 2ZG9X 4CYBA 4CVTA 4MY7A 2GS4A 3F35A 1JGCA 3PVYA 5GU3X 3RAVA 4CYAA 3KA9A 4RC7A 4KVSA 4ZKHA 1UMNA 3BVKA 2V15A 2V2IA 2PYBA 2V2LA 3RE7A 4ZLWA 2Z5PA 5FFCA 5CMRA 3F38A 3PW8C 3E1PA 3MPSA 4REUA 5AXSA 4TO9A 4RC5B 1JTSA 2CHIA 3BKNA 3AF9X 3E1MA 1QYBA 1YV1A 4CVRA 5D8YA 1S30A 3F37A 5LG8A 2V2OA 1RCGA 1O9RA 2C41A 2FG8A 1RCEA 3QZ3A 5J9VA 3NOZX 5K52A 3KXUA 3FI6A 2CHPA 2IY4A 3EGMA 2Z5RA 1S3QA 3ERZA 3VNXA 4E6KA 4ML5A 2F7NA 4LQNA 2C2FA 4KVQA 4KVRA 2FJCA 2WTLA 2XJNA 3AK9A 1OTKA 2ZA6A 1S2ZA 1RCCA 1LKMA 5E1UA 2V2RA 2GYDA 4M33A 4AM5A 4OYNA 4ZL5A 2BW1A 1L8HA 3GE4A 3AF8X 1BFRA 2C2UA 1H96A 3HL1A 4M35A 4YKHA 3E1NA 4IWKA 1QGHA 1UVHA 2YW7A 3IS7A 4M34A 3R2HA 5GU0X 2W0OA 3PWQC 2FZFA 1FHAA 2Z90A 3Q4NA 5J8SA 5D8SA 1KRQA 3PWFA 4P18A 4DYZA 3AJQA 4AM4A 4TOFA 4LYXA 3U90A 3RGDA 2Z6MA 5D8OA 3FSEA 3Q4RA 3PVTB 4ITWA 1YUXA 3UOIA 2BJYA 4LQJA 3PVYB 3E2CA 1SOFA 3ISFA 4XKSA 4RC7B 5J8WA 4CMYV 3NP2X 5LS9A 3KA6A 5D8PA 1VEQA 3E1QA 5D8QA 3KA3A 5GN8A 3PZAA 2VZBA 1BCFA 4CVPA 3EZUA 1Z6OM 1TK6A 2CIHA 4Z5SA 2ITBA 3WVVA 1JKUA 4RC6B 2BKCA 4EVDA 4II4A 4XGSA 5J93A 3E1JA 3ISEA 4AM2A 4LQVA 4ZKXA 4RC8A 4DI0A 1NF4A 5FFBA 3WNWA 3SH6A 4IWJA 3OJ5A 1EUMA 1VLGA 1DPSA 4TOHA 5FFAA 5K53A 4XKTA 2CLBA 1JKVA 3A68A 4PG1A 3R2OA 4EVEA 2IU2A 3OGHA 4A25A 3PW8A 2JD80 5LBHA 2VXXA 5FFEA 3GHQA 2C2JA 2V2SA 5ERKA 1L8IA 1XZ1A 5FFDA 2V2PA 1B71A 5E2DA 1TJOA 2V2NA 1TKOA 3E6RA 3F36A 2RBDA 4R42A 5I4JA 3F39A 1JREA 2FL0A 4TOCA 4ZJKA 2FKZA 4LPJA 5GU1X 1ZS3A 4CVSA 4CMYA 1LKPA 2VXIA 4ZL6A 2QQYA 2CN6A 3KX9A 1J30A 1GWGA 5C6FA 2ZA7A 4Y08A 1Z6OA 1N1QA 4Z3BA 4ZKWA 1JI4A 2V2JA 5ERJA 3AF7X 3IS8A 2XJOA 1NNQA 2FG4A
chains in the Genus database with same CATH superfamily
3AJOA 3F32A 1O9IA 2CLUA 3KA8A 3PVRB 5FEJA 3PW1B 2WLAA 3BVEA 5JKLG 1HRSA 3ES3A 1IESA 5HJFA 3KDQA 1DATA 1ZUJA 2ZG8X 4X0JA 1VEIA 4MUDA 2XGWA 2G4HA 5GOUA 4DYYA 1VJXA 1SQ3A 1YUZA 2HTNA 3PWQA 1XZ3A 3WVUA 4DE6A 3GVYA 4TW3A 1IERA 2G38B 3QVDA 4M32A 3QB9A 1R03A 1NF6A 3BVLA 3V3KB 4DYUA 1BG7A 3R2KA 3AK8A 3SE1A 1F30A 2GYQA 3E6SA 3NP0X 3RD0A 3PVTA 3RBCA 4DASA 2OH3A 3IQ1A 2CN7A 4PGKA 2YW6A 3E1OA 3SHXA 3QHBA 2QF9A 3TA8A 3JZAB 3O7SA 3DBYA 4CY9A 1MOJA 3BVFA 2ZURX 2V2MA 2ZG7X 5D8RA 3FVBA 5CZUA 3T9JA 4TOBA 1LB3A 4ISMA 4IXKA 1VELA 1JIGA 5JKLA 3BVIA 3E1LA 3O7RA 2CF7A 3KA4A 2Z5QA 4LYUA 4RC6A 4ERUA 4RC5A 5JKMA 5D8XA 3AJPA 1JI5A 4MN9A 2IB0A 5CMQA 1LKOA 1Z4AA 2JD60 3HIUA 3WVWA 3C1YA 3BT5A 5IX6A 4KXRB 5LG2A 4DYXA 4TOGA 4QUWA 4YVZA 4LPMA 3R2MA 1DVBA 1RCDA 4ETRA 4XKUA 4ZTTA 3SIDA 5JDOA 2CEIA 3KWOA 2UX1A 2WLUA 3QHCA 1AEWA 2YJJA 3F34A 4TOAA 2OKCA 4ITTA 3Q4OA 1TKPA 3GGYA 2JD70 2Y3QA 3GGZA 1MFRA 5HU6D 1NFVA 2FHAA 2YJKA 3UOFA 5HQOA 5HJHA 3QD8A 2ZA8A 4U3GA 3Q4QA 2X170 4TODA 5GU2X 5JACA 2HR5A 3H7GA 3R2LA 2OC5A 2C6RA 5JKMG 4EVBA 4LPNA 3R2RA 3KHKA 2BK6A 5GN8B 4EVCA 4DZ0A 3UNOA 1RYTA 2FFXJ 2XKQA 4ISPA 3R2SA 3A9QA 4ZMCA 3EZ0A 4LQHA 4PG0A 4TOEA 1RCIA 1F33A 3PVRA 4MJYA 1JYBA 3PW1A 4PGIA 2XJMA 3F33A 2D5KA 4MKUA 4II4B 2ZG9X 4CYBA 4CVTA 4MY7A 3VV9A 2GS4A 3F35A 1JGCA 3PVYA 5GU3X 3RAVA 4CYAA 3KA9A 4RC7A 2Y44A 4KVSA 4ZKHA 1UMNA 3BVKA 2V15A 2V2IA 2PYBA 2V2LA 3RE7A 4ZLWA 2Z5PA 2V8UA 3C23A 5FFCA 5CMRA 3F38A 3PW8C 3E1PA 3MPSA 4REUA 5AXSA 4TO9A 4RC5B 1JTSA 2CHIA 3BKNA 3AF9X 3E1MA 4W4KB 1QYBA 1YV1A 4CVRA 5D8YA 1S30A 3F37A 5LG8A 2V2OA 1RCGA 1O9RA 2C41A 2FG8A 1RCEA 3QZ3A 5J9VA 2WWXB 3NOZX 5K52A 3KXUA 3FI6A 2CHPA 2IY4A 3EGMA 2Z5RA 1S3QA 3ERZA 3VNXA 4E6KA 4ML5A 2F7NA 4LQNA 2C2FA 4KVQA 4WJG4 4KVRA 2FJCA 2WTLA 2XJNA 3AK9A 1OTKA 2ZA6A 3VVAA 1S2ZA 1RCCA 1LKMA 5E1UA 2V2RA 2GYDA 4M33A 4AM5A 4OYNA 4ZL5A 2BW1A 1L8HA 3GE4A 3AF8X 1BFRA 2C2UA 1H96A 3HL1A 4M35A 4YKHA 4W4LB 3N6OA 3E1NA 4IWKA 1QGHA 1UVHA 2YW7A 3IS7A 4M34A 3R2HA 5GU0X 2W0OA 3PWQC 2FZFA 1FHAA 2Z90A 3Q4NA 5J8SA 5D8SA 1KRQA 3PWFA 4P18A 4DYZA 3AJQA 4AM4A 4MXPA 4TOFA 4E40A 4LYXA 3U90A 3RGDA 2Z6MA 5D8OA 3FSEA 3Q4RA 3PVTB 4ITWA 1YUXA 3UOIA 2BJYA 4LQJA 3PVYB 3E2CA 1SOFA 3ISFA 4XKSA 4RC7B 5J8WA 4CMYV 3NP2X 5LS9A 3KA6A 2MGYA 5D8PA 1VEQA 3E1QA 3D19A 5D8QA 3KA3A 5GN8A 3PZAA 2N02A 2VZBA 1BCFA 4CVPA 3EZUA 1Z6OM 1TK6A 2CIHA 4Z5SA 3FRRA 2ITBA 3WVVA 1JKUA 4RC6B 2BKCA 4EVDA 4II4A 4XGSA 5J93A 3E1JA 3ISEA 4AM2A 4LQVA 2CWLA 3C21A 4ZKXA 4RC8A 4DI0A 1NF4A 5FFBA 2V8TA 3WNWA 3SH6A 4IWJA 3OJ5A 1EUMA 3C1ZA 1VLGA 1DPSA 4TOHA 5FFAA 5K53A 4XKTA 2CLBA 1JKVA 3A68A 4PG1A 3R2OA 4EVEA 2IU2A 4YXMA 3OGHA 3W54A 4A25A 3PW8A 2JD80 5JDOB 5LBHA 2VXXA 5FFEA 3GHQA 2C2JA 2V2SA 3UFBA 3JZ9A 5ERKA 1L8IA 1XZ1A 5FFDA 2V2PA 1B71A 5E2DA 4YXJA 1TJOA 2AR0A 3LKDA 2V2NA 1TKOA 3E6RA 3F36A 2RBDA 4R42A 5I4JA 3F39A 1JREA 2FL0A 4TOCA 4ZJKA 2FKZA 4LPJA 5GU1X 1ZS3A 4CVSA 4CMYA 1LKPA 2VXIA 3FRSA 4ZL6A 2QQYA 2CN6A 3KX9A 1J30A 1GWGA 5C6FA 2ZA7A 4Y08A 1Z6OA 1N1QA 4Z3BA 4ZKWA 1JI4A 2V2JA 5ERJA 3AF7X 3IS8A 3L0MA 3M6JA 2XJOA 1NNQA 2FG4A
chains in the Genus database with same CATH topology
3AJOA 3F32A 1O9IA 2CLUA 3KA8A 3PVRB 5FEJA 3PW1B 2WLAA 3BVEA 5JKLG 1HRSA 3ES3A 1IESA 5HJFA 3KDQA 1DATA 1ZUJA 2ZG8X 4X0JA 1VEIA 4MUDA 2XGWA 2G4HA 5GOUA 4DYYA 1VJXA 1SQ3A 1YUZA 2HTNA 3PWQA 1XZ3A 3WVUA 4DE6A 3GVYA 4TW3A 1IERA 2G38B 3QVDA 4M32A 3QB9A 1R03A 1NF6A 3BVLA 3V3KB 4DYUA 1BG7A 3R2KA 3AK8A 3SE1A 1F30A 2GYQA 3E6SA 3NP0X 3RD0A 3PVTA 3RBCA 4DASA 2OH3A 3IQ1A 2CN7A 4PGKA 2YW6A 3E1OA 3SHXA 3QHBA 2QF9A 3TA8A 3JZAB 3O7SA 3DBYA 4CY9A 1MOJA 3BVFA 2ZURX 2V2MA 2ZG7X 5D8RA 3FVBA 5CZUA 3T9JA 4TOBA 1LB3A 4ISMA 4IXKA 1VELA 1JIGA 5JKLA 3BVIA 3E1LA 3O7RA 2CF7A 3KA4A 2Z5QA 4LYUA 4RC6A 4ERUA 4RC5A 5JKMA 5D8XA 3AJPA 1JI5A 4MN9A 2IB0A 5CMQA 1LKOA 1Z4AA 2JD60 3HIUA 3WVWA 3C1YA 3BT5A 5IX6A 4KXRB 5LG2A 4DYXA 4TOGA 4QUWA 4YVZA 4LPMA 3R2MA 1DVBA 1RCDA 4ETRA 4XKUA 4ZTTA 3SIDA 5JDOA 2CEIA 3KWOA 2UX1A 2WLUA 3QHCA 1AEWA 2YJJA 3F34A 4TOAA 2OKCA 4ITTA 3Q4OA 1TKPA 3GGYA 2JD70 2Y3QA 3GGZA 1MFRA 5HU6D 1NFVA 2FHAA 2YJKA 3UOFA 5HQOA 5HJHA 3QD8A 2ZA8A 4U3GA 3Q4QA 2X170 4TODA 5GU2X 5JACA 2HR5A 3H7GA 3R2LA 2OC5A 2C6RA 5JKMG 4EVBA 4LPNA 3R2RA 3KHKA 2BK6A 5GN8B 4EVCA 4DZ0A 3UNOA 1RYTA 2FFXJ 2XKQA 4ISPA 3R2SA 3A9QA 4ZMCA 3EZ0A 4LQHA 4PG0A 4TOEA 1RCIA 1F33A 3PVRA 4MJYA 1JYBA 3PW1A 4PGIA 2XJMA 3F33A 2D5KA 4MKUA 4II4B 2ZG9X 4CYBA 4CVTA 4MY7A 3VV9A 2GS4A 3F35A 1JGCA 3PVYA 5GU3X 3RAVA 4CYAA 3KA9A 4RC7A 2Y44A 4KVSA 4ZKHA 1UMNA 3BVKA 2V15A 2V2IA 2PYBA 2V2LA 3RE7A 4ZLWA 2Z5PA 2V8UA 3C23A 5FFCA 5CMRA 3F38A 3PW8C 3E1PA 3MPSA 4REUA 5AXSA 4TO9A 4RC5B 1JTSA 2CHIA 3BKNA 3AF9X 3E1MA 4W4KB 1QYBA 1YV1A 4CVRA 5D8YA 1S30A 3F37A 5LG8A 2V2OA 1RCGA 1O9RA 2C41A 2FG8A 1RCEA 3QZ3A 5J9VA 2WWXB 3NOZX 5K52A 3KXUA 3FI6A 2CHPA 2IY4A 3EGMA 2Z5RA 1S3QA 3ERZA 3VNXA 4E6KA 4ML5A 2F7NA 4LQNA 2C2FA 4KVQA 4WJG4 4KVRA 2FJCA 2WTLA 2XJNA 3AK9A 1OTKA 2ZA6A 3VVAA 1S2ZA 1RCCA 1LKMA 5E1UA 2V2RA 2GYDA 4M33A 4AM5A 4OYNA 4ZL5A 2BW1A 1L8HA 3GE4A 3AF8X 1BFRA 2C2UA 1H96A 3HL1A 4M35A 4YKHA 4W4LB 3N6OA 3E1NA 4IWKA 1QGHA 1UVHA 2YW7A 3IS7A 4M34A 3R2HA 5GU0X 2W0OA 3PWQC 2FZFA 1FHAA 2Z90A 3Q4NA 5J8SA 5D8SA 1KRQA 3PWFA 4P18A 4DYZA 3AJQA 4AM4A 4MXPA 4TOFA 4E40A 4LYXA 3U90A 3RGDA 2Z6MA 5D8OA 3FSEA 3Q4RA 3PVTB 4ITWA 1YUXA 3UOIA 2BJYA 4LQJA 3PVYB 3E2CA 1SOFA 3ISFA 4XKSA 4RC7B 5J8WA 4CMYV 3NP2X 5LS9A 3KA6A 2MGYA 5D8PA 1VEQA 3E1QA 3D19A 5D8QA 3KA3A 5GN8A 3PZAA 2N02A 2VZBA 1BCFA 4CVPA 3EZUA 1Z6OM 1TK6A 2CIHA 4Z5SA 3FRRA 2ITBA 3WVVA 1JKUA 4RC6B 2BKCA 4EVDA 4II4A 4XGSA 5J93A 3E1JA 3ISEA 4AM2A 4LQVA 2CWLA 3C21A 4ZKXA 4RC8A 4DI0A 1NF4A 5FFBA 2V8TA 3WNWA 3SH6A 4IWJA 3OJ5A 1EUMA 3C1ZA 1VLGA 1DPSA 4TOHA 5FFAA 5K53A 4XKTA 2CLBA 1JKVA 3A68A 4PG1A 3R2OA 4EVEA 2IU2A 4YXMA 3OGHA 3W54A 4A25A 3PW8A 2JD80 5JDOB 5LBHA 2VXXA 5FFEA 3GHQA 2C2JA 2V2SA 3UFBA 3JZ9A 5ERKA 1L8IA 1XZ1A 5FFDA 2V2PA 1B71A 5E2DA 4YXJA 1TJOA 2AR0A 3LKDA 2V2NA 1TKOA 3E6RA 3F36A 2RBDA 4R42A 5I4JA 3F39A 1JREA 2FL0A 4TOCA 4ZJKA 2FKZA 4LPJA 5GU1X 1ZS3A 4CVSA 4CMYA 1LKPA 2VXIA 3FRSA 4ZL6A 2QQYA 2CN6A 3KX9A 1J30A 1GWGA 5C6FA 2ZA7A 4Y08A 1Z6OA 1N1QA 4Z3BA 4ZKWA 1JI4A 2V2JA 5ERJA 3AF7X 3IS8A 3L0MA 3M6JA 2XJOA 1NNQA 2FG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJO A;  3F32 A;  1O9I A;  2CLU A;  3KA8 A;  3PVR B;  5FEJ A;  3PW1 B;  2WLA A;  3BVE A;  5JKL G;  1HRS A;  3ES3 A;  1IES A;  5HJF A;  1DAT A;  1ZUJ A;  2ZG8 X;  1VEI A;  4MUD A;  2XGW A;  2G4H A;  5GOU A;  4DYY A;  1VJX A;  1SQ3 A;  1YUZ A;  2HTN A;  3PWQ A;  1XZ3 A;  3WVU A;  4DE6 A;  3GVY A;  4TW3 A;  1IER A;  3QVD A;  4M32 A;  3QB9 A;  1R03 A;  1NF6 A;  3BVL A;  4DYU A;  1BG7 A;  3R2K A;  3AK8 A;  3SE1 A;  1F30 A;  2GYQ A;  3E6S A;  3NP0 X;  3RD0 A;  3PVT A;  3RBC A;  4DAS A;  2OH3 A;  3IQ1 A;  2CN7 A;  4PGK A;  2YW6 A;  3E1O A;  3SHX A;  3QHB A;  2QF9 A;  3TA8 A;  3O7S A;  4CY9 A;  1MOJ A;  3BVF A;  2ZUR X;  2V2M A;  2ZG7 X;  5D8R A;  3FVB A;  5CZU A;  3T9J A;  4TOB A;  1LB3 A;  4ISM A;  4IXK A;  1VEL A;  1JIG A;  5JKL A;  3BVI A;  3E1L A;  3O7R A;  2CF7 A;  3KA4 A;  2Z5Q A;  4LYU A;  4RC6 A;  4ERU A;  4RC5 A;  5JKM A;  5D8X A;  3AJP A;  1JI5 A;  4MN9 A;  2IB0 A;  5CMQ A;  1LKO A;  1Z4A A;  2JD6 0;  3HIU A;  3WVW A;  3BT5 A;  5IX6 A;  5LG2 A;  4DYX A;  4TOG A;  4QUW A;  4LPM A;  3R2M A;  1DVB A;  1RCD A;  4ETR A;  4XKU A;  4ZTT A;  3SID A;  2CEI A;  3KWO A;  2UX1 A;  2WLU A;  3QHC A;  1AEW A;  2YJJ A;  3F34 A;  4TOA A;  4ITT A;  3Q4O A;  1TKP A;  2JD7 0;  2Y3Q A;  1MFR A;  1NFV A;  2FHA A;  2YJK A;  3UOF A;  5HQO A;  5HJH A;  3QD8 A;  2ZA8 A;  4U3G A;  3Q4Q A;  2X17 0;  4TOD A;  5GU2 X;  5JAC A;  2HR5 A;  3H7G A;  3R2L A;  2OC5 A;  2C6R A;  5JKM G;  4EVB A;  4LPN A;  3R2R A;  4EVC A;  2BK6 A;  5GN8 B;  4DZ0 A;  3UNO A;  1RYT A;  2FFX J;  2XKQ A;  4ISP A;  3R2S A;  3A9Q A;  4ZMC A;  3EZ0 A;  4LQH A;  4PG0 A;  4TOE A;  1RCI A;  1F33 A;  3PVR A;  4MJY A;  1JYB A;  3PW1 A;  4PGI A;  2XJM A;  3F33 A;  2D5K A;  4MKU A;  4II4 B;  2ZG9 X;  4CYB A;  4CVT A;  4MY7 A;  2GS4 A;  3F35 A;  1JGC A;  3PVY A;  5GU3 X;  3RAV A;  4CYA A;  3KA9 A;  4RC7 A;  4KVS A;  4ZKH A;  1UMN A;  3BVK A;  2V15 A;  2V2I A;  2PYB A;  2V2L A;  3RE7 A;  4ZLW A;  2Z5P A;  5FFC A;  5CMR A;  3F38 A;  3PW8 C;  3E1P A;  3MPS A;  4REU A;  5AXS A;  4TO9 A;  4RC5 B;  1JTS A;  2CHI A;  3BKN A;  3AF9 X;  3E1M A;  1QYB A;  1YV1 A;  4CVR A;  5D8Y A;  1S30 A;  3F37 A;  5LG8 A;  2V2O A;  1RCG A;  1O9R A;  2C41 A;  2FG8 A;  1RCE A;  3QZ3 A;  5J9V A;  3NOZ X;  5K52 A;  3KXU A;  3FI6 A;  2CHP A;  2IY4 A;  3EGM A;  2Z5R A;  1S3Q A;  3ERZ A;  3VNX A;  4E6K A;  4ML5 A;  2F7N A;  4LQN A;  2C2F A;  4KVQ A;  4KVR A;  2FJC A;  2WTL A;  2XJN A;  3AK9 A;  1OTK A;  2ZA6 A;  1S2Z A;  1RCC A;  1LKM A;  5E1U A;  2V2R A;  2GYD A;  4M33 A;  4AM5 A;  4OYN A;  4ZL5 A;  2BW1 A;  1L8H A;  3GE4 A;  3AF8 X;  1BFR A;  2C2U A;  1H96 A;  3HL1 A;  4M35 A;  4YKH A;  3E1N A;  4IWK A;  1QGH A;  1UVH A;  2YW7 A;  3IS7 A;  4M34 A;  3R2H A;  5GU0 X;  2W0O A;  3PWQ C;  2FZF A;  1FHA A;  2Z90 A;  3Q4N A;  5J8S A;  5D8S A;  1KRQ A;  3PWF A;  4P18 A;  4DYZ A;  3AJQ A;  4AM4 A;  4TOF A;  4LYX A;  3U90 A;  3RGD A;  2Z6M A;  5D8O A;  3FSE A;  3Q4R A;  3PVT B;  4ITW A;  1YUX A;  3UOI A;  2BJY A;  4LQJ A;  3PVY B;  3E2C A;  1SOF A;  3ISF A;  4XKS A;  4RC7 B;  5J8W A;  4CMY V;  3NP2 X;  5LS9 A;  3KA6 A;  5D8P A;  1VEQ A;  3E1Q A;  5D8Q A;  3KA3 A;  5GN8 A;  3PZA A;  2VZB A;  1BCF A;  4CVP A;  3EZU A;  1Z6O M;  1TK6 A;  2CIH A;  4Z5S A;  2ITB A;  3WVV A;  1JKU A;  4RC6 B;  2BKC A;  4EVD A;  4II4 A;  4XGS A;  5J93 A;  3E1J A;  3ISE A;  4AM2 A;  4LQV A;  4ZKX A;  4RC8 A;  4DI0 A;  1NF4 A;  5FFB A;  3WNW A;  3SH6 A;  4IWJ A;  3OJ5 A;  1EUM A;  1VLG A;  1DPS A;  4TOH A;  5FFA A;  5K53 A;  4XKT A;  2CLB A;  1JKV A;  3A68 A;  4PG1 A;  3R2O A;  4EVE A;  2IU2 A;  3OGH A;  4A25 A;  3PW8 A;  2JD8 0;  5LBH A;  2VXX A;  5FFE A;  3GHQ A;  2C2J A;  2V2S A;  5ERK A;  1L8I A;  1XZ1 A;  5FFD A;  2V2P A;  1B71 A;  5E2D A;  1TJO A;  2V2N A;  1TKO A;  3E6R A;  3F36 A;  2RBD A;  4R42 A;  5I4J A;  3F39 A;  1JRE A;  2FL0 A;  4TOC A;  4ZJK A;  2FKZ A;  4LPJ A;  5GU1 X;  1ZS3 A;  4CVS A;  4CMY A;  1LKP A;  2VXI A;  4ZL6 A;  2QQY A;  2CN6 A;  3KX9 A;  1J30 A;  1GWG A;  5C6F A;  2ZA7 A;  4Y08 A;  1Z6O A;  1N1Q A;  4Z3B A;  4ZKW A;  1JI4 A;  2V2J A;  5ERJ A;  3AF7 X;  3IS8 A;  2XJO A;  1NNQ A;  2FG4 A; 
#chains in the Genus database with same CATH topology
 3AJO A;  3F32 A;  1O9I A;  2CLU A;  3KA8 A;  3PVR B;  5FEJ A;  3PW1 B;  2WLA A;  3BVE A;  5JKL G;  1HRS A;  3ES3 A;  1IES A;  5HJF A;  3KDQ A;  1DAT A;  1ZUJ A;  2ZG8 X;  4X0J A;  1VEI A;  4MUD A;  2XGW A;  2G4H A;  5GOU A;  4DYY A;  1VJX A;  1SQ3 A;  1YUZ A;  2HTN A;  3PWQ A;  1XZ3 A;  3WVU A;  4DE6 A;  3GVY A;  4TW3 A;  1IER A;  2G38 B;  3QVD A;  4M32 A;  3QB9 A;  1R03 A;  1NF6 A;  3BVL A;  3V3K B;  4DYU A;  1BG7 A;  3R2K A;  3AK8 A;  3SE1 A;  1F30 A;  2GYQ A;  3E6S A;  3NP0 X;  3RD0 A;  3PVT A;  3RBC A;  4DAS A;  2OH3 A;  3IQ1 A;  2CN7 A;  4PGK A;  2YW6 A;  3E1O A;  3SHX A;  3QHB A;  2QF9 A;  3TA8 A;  3JZA B;  3O7S A;  3DBY A;  4CY9 A;  1MOJ A;  3BVF A;  2ZUR X;  2V2M A;  2ZG7 X;  5D8R A;  3FVB A;  5CZU A;  3T9J A;  4TOB A;  1LB3 A;  4ISM A;  4IXK A;  1VEL A;  1JIG A;  5JKL A;  3BVI A;  3E1L A;  3O7R A;  2CF7 A;  3KA4 A;  2Z5Q A;  4LYU A;  4RC6 A;  4ERU A;  4RC5 A;  5JKM A;  5D8X A;  3AJP A;  1JI5 A;  4MN9 A;  2IB0 A;  5CMQ A;  1LKO A;  1Z4A A;  2JD6 0;  3HIU A;  3WVW A;  3C1Y A;  3BT5 A;  5IX6 A;  4KXR B;  5LG2 A;  4DYX A;  4TOG A;  4QUW A;  4YVZ A;  4LPM A;  3R2M A;  1DVB A;  1RCD A;  4ETR A;  4XKU A;  4ZTT A;  3SID A;  5JDO A;  2CEI A;  3KWO A;  2UX1 A;  2WLU A;  3QHC A;  1AEW A;  2YJJ A;  3F34 A;  4TOA A;  2OKC A;  4ITT A;  3Q4O A;  1TKP A;  3GGY A;  2JD7 0;  2Y3Q A;  3GGZ A;  1MFR A;  5HU6 D;  1NFV A;  2FHA A;  2YJK A;  3UOF A;  5HQO A;  5HJH A;  3QD8 A;  2ZA8 A;  4U3G A;  3Q4Q A;  2X17 0;  4TOD A;  5GU2 X;  5JAC A;  2HR5 A;  3H7G A;  3R2L A;  2OC5 A;  2C6R A;  5JKM G;  4EVB A;  4LPN A;  3R2R A;  3KHK A;  2BK6 A;  5GN8 B;  4EVC A;  4DZ0 A;  3UNO A;  1RYT A;  2FFX J;  2XKQ A;  4ISP A;  3R2S A;  3A9Q A;  4ZMC A;  3EZ0 A;  4LQH A;  4PG0 A;  4TOE A;  1RCI A;  1F33 A;  3PVR A;  4MJY A;  1JYB A;  3PW1 A;  4PGI A;  2XJM A;  3F33 A;  2D5K A;  4MKU A;  4II4 B;  2ZG9 X;  4CYB A;  4CVT A;  4MY7 A;  3VV9 A;  2GS4 A;  3F35 A;  1JGC A;  3PVY A;  5GU3 X;  3RAV A;  4CYA A;  3KA9 A;  4RC7 A;  2Y44 A;  4KVS A;  4ZKH A;  1UMN A;  3BVK A;  2V15 A;  2V2I A;  2PYB A;  2V2L A;  3RE7 A;  4ZLW A;  2Z5P A;  2V8U A;  3C23 A;  5FFC A;  5CMR A;  3F38 A;  3PW8 C;  3E1P A;  3MPS A;  4REU A;  5AXS A;  4TO9 A;  4RC5 B;  1JTS A;  2CHI A;  3BKN A;  3AF9 X;  3E1M A;  4W4K B;  1QYB A;  1YV1 A;  4CVR A;  5D8Y A;  1S30 A;  3F37 A;  5LG8 A;  2V2O A;  1RCG A;  1O9R A;  2C41 A;  2FG8 A;  1RCE A;  3QZ3 A;  5J9V A;  2WWX B;  3NOZ X;  5K52 A;  3KXU A;  3FI6 A;  2CHP A;  2IY4 A;  3EGM A;  2Z5R A;  1S3Q A;  3ERZ A;  3VNX A;  4E6K A;  4ML5 A;  2F7N A;  4LQN A;  2C2F A;  4KVQ A;  4WJG 4;  4KVR A;  2FJC A;  2WTL A;  2XJN A;  3AK9 A;  1OTK A;  2ZA6 A;  3VVA A;  1S2Z A;  1RCC A;  1LKM A;  5E1U A;  2V2R A;  2GYD A;  4M33 A;  4AM5 A;  4OYN A;  4ZL5 A;  2BW1 A;  1L8H A;  3GE4 A;  3AF8 X;  1BFR A;  2C2U A;  1H96 A;  3HL1 A;  4M35 A;  4YKH A;  4W4L B;  3N6O A;  3E1N A;  4IWK A;  1QGH A;  1UVH A;  2YW7 A;  3IS7 A;  4M34 A;  3R2H A;  5GU0 X;  2W0O A;  3PWQ C;  2FZF A;  1FHA A;  2Z90 A;  3Q4N A;  5J8S A;  5D8S A;  1KRQ A;  3PWF A;  4P18 A;  4DYZ A;  3AJQ A;  4AM4 A;  4MXP A;  4TOF A;  4E40 A;  4LYX A;  3U90 A;  3RGD A;  2Z6M A;  5D8O A;  3FSE A;  3Q4R A;  3PVT B;  4ITW A;  1YUX A;  3UOI A;  2BJY A;  4LQJ A;  3PVY B;  3E2C A;  1SOF A;  3ISF A;  4XKS A;  4RC7 B;  5J8W A;  4CMY V;  3NP2 X;  5LS9 A;  3KA6 A;  2MGY A;  5D8P A;  1VEQ A;  3E1Q A;  3D19 A;  5D8Q A;  3KA3 A;  5GN8 A;  3PZA A;  2N02 A;  2VZB A;  1BCF A;  4CVP A;  3EZU A;  1Z6O M;  1TK6 A;  2CIH A;  4Z5S A;  3FRR A;  2ITB A;  3WVV A;  1JKU A;  4RC6 B;  2BKC A;  4EVD A;  4II4 A;  4XGS A;  5J93 A;  3E1J A;  3ISE A;  4AM2 A;  4LQV A;  2CWL A;  3C21 A;  4ZKX A;  4RC8 A;  4DI0 A;  1NF4 A;  5FFB A;  2V8T A;  3WNW A;  3SH6 A;  4IWJ A;  3OJ5 A;  1EUM A;  3C1Z A;  1VLG A;  1DPS A;  4TOH A;  5FFA A;  5K53 A;  4XKT A;  2CLB A;  1JKV A;  3A68 A;  4PG1 A;  3R2O A;  4EVE A;  2IU2 A;  4YXM A;  3OGH A;  3W54 A;  4A25 A;  3PW8 A;  2JD8 0;  5JDO B;  5LBH A;  2VXX A;  5FFE A;  3GHQ A;  2C2J A;  2V2S A;  3UFB A;  3JZ9 A;  5ERK A;  1L8I A;  1XZ1 A;  5FFD A;  2V2P A;  1B71 A;  5E2D A;  4YXJ A;  1TJO A;  2AR0 A;  3LKD A;  2V2N A;  1TKO A;  3E6R A;  3F36 A;  2RBD A;  4R42 A;  5I4J A;  3F39 A;  1JRE A;  2FL0 A;  4TOC A;  4ZJK A;  2FKZ A;  4LPJ A;  5GU1 X;  1ZS3 A;  4CVS A;  4CMY A;  1LKP A;  2VXI A;  3FRS A;  4ZL6 A;  2QQY A;  2CN6 A;  3KX9 A;  1J30 A;  1GWG A;  5C6F A;  2ZA7 A;  4Y08 A;  1Z6O A;  1N1Q A;  4Z3B A;  4ZKW A;  1JI4 A;  2V2J A;  5ERJ A;  3AF7 X;  3IS8 A;  3L0M A;  3M6J A;  2XJO A;  1NNQ A;  2FG4 A; 
#chains in the Genus database with same CATH homology
 3AJO A;  3F32 A;  1O9I A;  2CLU A;  3KA8 A;  3PVR B;  5FEJ A;  3PW1 B;  2WLA A;  3BVE A;  5JKL G;  1HRS A;  3ES3 A;  1IES A;  5HJF A;  3KDQ A;  1DAT A;  1ZUJ A;  2ZG8 X;  4X0J A;  1VEI A;  4MUD A;  2XGW A;  2G4H A;  5GOU A;  4DYY A;  1VJX A;  1SQ3 A;  1YUZ A;  2HTN A;  3PWQ A;  1XZ3 A;  3WVU A;  4DE6 A;  3GVY A;  4TW3 A;  1IER A;  2G38 B;  3QVD A;  4M32 A;  3QB9 A;  1R03 A;  1NF6 A;  3BVL A;  3V3K B;  4DYU A;  1BG7 A;  3R2K A;  3AK8 A;  3SE1 A;  1F30 A;  2GYQ A;  3E6S A;  3NP0 X;  3RD0 A;  3PVT A;  3RBC A;  4DAS A;  2OH3 A;  3IQ1 A;  2CN7 A;  4PGK A;  2YW6 A;  3E1O A;  3SHX A;  3QHB A;  2QF9 A;  3TA8 A;  3JZA B;  3O7S A;  3DBY A;  4CY9 A;  1MOJ A;  3BVF A;  2ZUR X;  2V2M A;  2ZG7 X;  5D8R A;  3FVB A;  5CZU A;  3T9J A;  4TOB A;  1LB3 A;  4ISM A;  4IXK A;  1VEL A;  1JIG A;  5JKL A;  3BVI A;  3E1L A;  3O7R A;  2CF7 A;  3KA4 A;  2Z5Q A;  4LYU A;  4RC6 A;  4ERU A;  4RC5 A;  5JKM A;  5D8X A;  3AJP A;  1JI5 A;  4MN9 A;  2IB0 A;  5CMQ A;  1LKO A;  1Z4A A;  2JD6 0;  3HIU A;  3WVW A;  3C1Y A;  3BT5 A;  5IX6 A;  4KXR B;  5LG2 A;  4DYX A;  4TOG A;  4QUW A;  4YVZ A;  4LPM A;  3R2M A;  1DVB A;  1RCD A;  4ETR A;  4XKU A;  4ZTT A;  3SID A;  5JDO A;  2CEI A;  3KWO A;  2UX1 A;  2WLU A;  3QHC A;  1AEW A;  2YJJ A;  3F34 A;  4TOA A;  2OKC A;  4ITT A;  3Q4O A;  1TKP A;  3GGY A;  2JD7 0;  2Y3Q A;  3GGZ A;  1MFR A;  5HU6 D;  1NFV A;  2FHA A;  2YJK A;  3UOF A;  5HQO A;  5HJH A;  3QD8 A;  2ZA8 A;  4U3G A;  3Q4Q A;  2X17 0;  4TOD A;  5GU2 X;  5JAC A;  2HR5 A;  3H7G A;  3R2L A;  2OC5 A;  2C6R A;  5JKM G;  4EVB A;  4LPN A;  3R2R A;  3KHK A;  2BK6 A;  5GN8 B;  4EVC A;  4DZ0 A;  3UNO A;  1RYT A;  2FFX J;  2XKQ A;  4ISP A;  3R2S A;  3A9Q A;  4ZMC A;  3EZ0 A;  4LQH A;  4PG0 A;  4TOE A;  1RCI A;  1F33 A;  3PVR A;  4MJY A;  1JYB A;  3PW1 A;  4PGI A;  2XJM A;  3F33 A;  2D5K A;  4MKU A;  4II4 B;  2ZG9 X;  4CYB A;  4CVT A;  4MY7 A;  3VV9 A;  2GS4 A;  3F35 A;  1JGC A;  3PVY A;  5GU3 X;  3RAV A;  4CYA A;  3KA9 A;  4RC7 A;  2Y44 A;  4KVS A;  4ZKH A;  1UMN A;  3BVK A;  2V15 A;  2V2I A;  2PYB A;  2V2L A;  3RE7 A;  4ZLW A;  2Z5P A;  2V8U A;  3C23 A;  5FFC A;  5CMR A;  3F38 A;  3PW8 C;  3E1P A;  3MPS A;  4REU A;  5AXS A;  4TO9 A;  4RC5 B;  1JTS A;  2CHI A;  3BKN A;  3AF9 X;  3E1M A;  4W4K B;  1QYB A;  1YV1 A;  4CVR A;  5D8Y A;  1S30 A;  3F37 A;  5LG8 A;  2V2O A;  1RCG A;  1O9R A;  2C41 A;  2FG8 A;  1RCE A;  3QZ3 A;  5J9V A;  2WWX B;  3NOZ X;  5K52 A;  3KXU A;  3FI6 A;  2CHP A;  2IY4 A;  3EGM A;  2Z5R A;  1S3Q A;  3ERZ A;  3VNX A;  4E6K A;  4ML5 A;  2F7N A;  4LQN A;  2C2F A;  4KVQ A;  4WJG 4;  4KVR A;  2FJC A;  2WTL A;  2XJN A;  3AK9 A;  1OTK A;  2ZA6 A;  3VVA A;  1S2Z A;  1RCC A;  1LKM A;  5E1U A;  2V2R A;  2GYD A;  4M33 A;  4AM5 A;  4OYN A;  4ZL5 A;  2BW1 A;  1L8H A;  3GE4 A;  3AF8 X;  1BFR A;  2C2U A;  1H96 A;  3HL1 A;  4M35 A;  4YKH A;  4W4L B;  3N6O A;  3E1N A;  4IWK A;  1QGH A;  1UVH A;  2YW7 A;  3IS7 A;  4M34 A;  3R2H A;  5GU0 X;  2W0O A;  3PWQ C;  2FZF A;  1FHA A;  2Z90 A;  3Q4N A;  5J8S A;  5D8S A;  1KRQ A;  3PWF A;  4P18 A;  4DYZ A;  3AJQ A;  4AM4 A;  4MXP A;  4TOF A;  4E40 A;  4LYX A;  3U90 A;  3RGD A;  2Z6M A;  5D8O A;  3FSE A;  3Q4R A;  3PVT B;  4ITW A;  1YUX A;  3UOI A;  2BJY A;  4LQJ A;  3PVY B;  3E2C A;  1SOF A;  3ISF A;  4XKS A;  4RC7 B;  5J8W A;  4CMY V;  3NP2 X;  5LS9 A;  3KA6 A;  2MGY A;  5D8P A;  1VEQ A;  3E1Q A;  3D19 A;  5D8Q A;  3KA3 A;  5GN8 A;  3PZA A;  2N02 A;  2VZB A;  1BCF A;  4CVP A;  3EZU A;  1Z6O M;  1TK6 A;  2CIH A;  4Z5S A;  3FRR A;  2ITB A;  3WVV A;  1JKU A;  4RC6 B;  2BKC A;  4EVD A;  4II4 A;  4XGS A;  5J93 A;  3E1J A;  3ISE A;  4AM2 A;  4LQV A;  2CWL A;  3C21 A;  4ZKX A;  4RC8 A;  4DI0 A;  1NF4 A;  5FFB A;  2V8T A;  3WNW A;  3SH6 A;  4IWJ A;  3OJ5 A;  1EUM A;  3C1Z A;  1VLG A;  1DPS A;  4TOH A;  5FFA A;  5K53 A;  4XKT A;  2CLB A;  1JKV A;  3A68 A;  4PG1 A;  3R2O A;  4EVE A;  2IU2 A;  4YXM A;  3OGH A;  3W54 A;  4A25 A;  3PW8 A;  2JD8 0;  5JDO B;  5LBH A;  2VXX A;  5FFE A;  3GHQ A;  2C2J A;  2V2S A;  3UFB A;  3JZ9 A;  5ERK A;  1L8I A;  1XZ1 A;  5FFD A;  2V2P A;  1B71 A;  5E2D A;  4YXJ A;  1TJO A;  2AR0 A;  3LKD A;  2V2N A;  1TKO A;  3E6R A;  3F36 A;  2RBD A;  4R42 A;  5I4J A;  3F39 A;  1JRE A;  2FL0 A;  4TOC A;  4ZJK A;  2FKZ A;  4LPJ A;  5GU1 X;  1ZS3 A;  4CVS A;  4CMY A;  1LKP A;  2VXI A;  3FRS A;  4ZL6 A;  2QQY A;  2CN6 A;  3KX9 A;  1J30 A;  1GWG A;  5C6F A;  2ZA7 A;  4Y08 A;  1Z6O A;  1N1Q A;  4Z3B A;  4ZKW A;  1JI4 A;  2V2J A;  5ERJ A;  3AF7 X;  3IS8 A;  3L0M A;  3M6J A;  2XJO A;  1NNQ A;  2FG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...