5LBHA

Crystal structure of helicobacter cinaedi caip
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
143
structure length
143
Chain Sequence
KVVELLKQIQADASVFYVKVHNFHWNVKGMDFHPTHKATQEIYEQFADVFDDVAERVLQLGEMPYVTLADMLKAAKIKEESKTSFCSKEIAQAVLADYEYFLKLFTELSAQADSQGDKVSAAYADDKVGELQKAIWMLKSQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords CAIP
publication title The Helicobacter cinaedi antigen CAIP participates in atherosclerotic inflammation by promoting the differentiation of macrophages in foam cells.
pubmed doi rcsb
source organism Helicobacter cinaedi
total genus 63
structure length 143
sequence length 143
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5lbhA00
5D8YA 1VEQA 5FFDA 2FKZA 4LPMA 5LG8A 2UX1A 3E1MA 2BK6A 2XJMA 1IESA 3PVTB 4PGKA 1JI5A 4DE6A 3BKNA 3NP2X 2XJOA 4M34A 4CMYV 1NF6A 1KRQA 4ZJKA 3KX9A 4DYXA 3BVEA 1F33A 2G4HA 2W0OA 4TW3A 3R2HA 5GU3X 3KWOA 1LKOA 2Z90A 3SHXA 3RBCA 5D8OA 5CMRA 3R2MA 2V15A 5JKLA 5GU2X 1L8HA 1UVHA 4RC7B 3IS7A 3E1QA 2YJKA 3TA8A 2V2IA 3AF8X 2V2OA 3HL1A 2IU2A 5E1UA 2CHIA 3F33A 3RAVA 5C6FA 4EVCA 1LKMA 2D5KA 4MUDA 3RD0A 4CVSA 1RYTA 2PYBA 3PVRA 2JD60 3BVIA 5ERJA 3E1NA 1DATA 3WVWA 5D8RA 5J93A 3PWQC 4LPNA 5ERKA 1UMNA 4ITWA 3KA4A 4ZL6A 3QHBA 1JKVA 5J8SA 5JKMA 2QF9A 3PW1B 1L8IA 4DYUA 4ZKWA 4CVPA 1BCFA 4LPJA 2WLUA 3AJQA 5GOUA 4M33A 3IS8A 1AEWA 2VXXA 3Q4NA 2V2MA 1RCDA 4LYXA 1RCGA 4PG1A 3BVKA 4U3GA 4TOHA 1LB3A 4LQJA 1RCIA 5K52A 5FFBA 4MKUA 2Z6MA 2GYDA 2ZURX 2FZFA 3ISFA 2Z5PA 1R03A 1MOJA 3UOFA 5GU0X 1LKPA 5FFCA 1VELA 3H7GA 3E1JA 2OH3A 3WNWA 3WVVA 2C2UA 3GVYA 1TJOA 4XKSA 2CIHA 3FVBA 3UNOA 3PW8A 3O7SA 3KA6A 4LYUA 4XKUA 5GU1X 3R2LA 4ZKHA 3OJ5A 4Z3BA 5K53A 1JKUA 5CMQA 1JTSA 1S3QA 1Z4AA 4DZ0A 3PVRB 1J30A 1F30A 1ZUJA 4MY7A 2CLUA 2YW7A 4MJYA 3R2KA 1O9IA 3E1OA 2CHPA 4II4A 2WTLA 1Z6OA 4ITTA 4M32A 2FG8A 3F36A 2ZA7A 3EZUA 4XKTA 5D8XA 5D8SA 1XZ3A 4TODA 2VXIA 4AM5A 5LBHA 2V2SA 1JREA 4CVTA 3NOZX 1NNQA 3PVYA 3AJOA 2HTNA 4ISPA 3PZAA 3EGMA 4TOEA 2FL0A 2V2LA 1TKPA 3PVTA 3ES3A 3A68A 4YKHA 4RC6A 1BFRA 2C2JA 3HIUA 2VZBA 3KA3A 3PWFA 1IERA 2ZA8A 5JKLG 4LQHA 4CMYA 2BKCA 1QYBA 4KVSA 4CYBA 2ZG7X 5HJFA 3SIDA 3VNXA 4TOBA 3E6RA 2FHAA 2JD80 3T9JA 3F34A 4E6KA 3GE4A 3PW8C 3BVFA 3FSEA 3F32A 3AK8A 3IQ1A 4ZTTA 3RGDA 1VJXA 2V2RA 2C2FA 2QQYA 3MPSA 4IWKA 5J8WA 1VEIA 4II4B 3RE7A 2C41A 2WLAA 2CN6A 5JKMG 1QGHA 3BVLA 3OGHA 4DYYA 1JI4A 3GHQA 1TKOA 1YUZA 2ZG8X 1TK6A 3FI6A 3AJPA 2CN7A 1GWGA 1Z6OM 4LQNA 5FFEA 4Y08A 5JACA 3F38A 2ZA6A 3PVYB 2BW1A 3AF7X 2V2JA 1BG7A 3Q4RA 1FHAA 1OTKA 4ETRA 3NP0X 2V2NA 2RBDA 3QVDA 2Z5QA 1JIGA 4TOCA 2V2PA 1B71A 4CYAA 3F35A 4ZKXA 5GN8A 4TOAA 1ZS3A 4AM4A 4KVRA 4RC6B 4QUWA 4EVEA 3O7RA 4KVQA 3AF9X 3F37A 4ISMA 4RC5A 2OC5A 4TO9A 5E2DA 3UOIA 1S30A 4ZMCA 1YUXA 3R2OA 2YW6A 4ZLWA 3QB9A 3SH6A 5LG2A 2F7NA 5I4JA 3R2RA 4PGIA 4DI0A 2HR5A 2ZG9X 3A9QA 2YJJA 5FEJA 4MN9A 3F39A 4CVRA 4M35A 3AK9A 1EUMA 4ERUA 4AM2A 3Q4OA 3QD8A 5IX6A 2IB0A 5D8PA 2C6RA 4DASA 5LS9A 3KXUA 3QHCA 3SE1A 4EVBA 5J9VA 3WVUA 2XGWA 4LQVA 1SOFA 4PG0A 3U90A 1RCEA 3ISEA 1S2ZA 1DVBA 2FJCA 4P18A 4RC8A 2CLBA 1JYBA 2CF7A 1O9RA 4OYNA 1NF4A 2CEIA 2Z5RA 3QZ3A 1DPSA 4TOFA 3R2SA 1XZ1A 2FFXJ 4RC7A 5HQOA 5CZUA 2Y3QA 4CY9A 3E1LA 4TOGA 4IXKA 1H96A 2BJYA 4A25A 3EZ0A 1N1QA 2FG4A 2XKQA 4DYZA 1MFRA 4IWJA 3PWQA 4R42A 1VLGA 3E6SA 5AXSA 4Z5SA 2X170 4REUA 4EVDA 1JGCA 2ITBA 5GN8B 5D8QA 3E2CA 3ERZA 2XJNA 2JD70 1YV1A 1HRSA 4XGSA 2GS4A 3Q4QA 3KA8A 4RC5B 1NFVA 5HJHA 2IY4A 4ZL5A 3KA9A 4ML5A 1RCCA 1SQ3A 2GYQA 3BT5A 3PW1A 3E1PA 5FFAA
chains in the Genus database with same CATH superfamily
5D8YA 1VEQA 5FFDA 2FKZA 4LPMA 5LG8A 3JZAB 2UX1A 3E1MA 2BK6A 2XJMA 1IESA 3PVTB 4PGKA 1JI5A 4DE6A 3BKNA 3NP2X 2XJOA 4M34A 4CMYV 1NF6A 1KRQA 4ZJKA 3KX9A 4DYXA 3BVEA 1F33A 2G4HA 2W0OA 3KHKA 4TW3A 3R2HA 5GU3X 3KWOA 4E40A 1LKOA 2Z90A 3SHXA 3RBCA 5D8OA 5CMRA 3R2MA 2V15A 5JKLA 5GU2X 1L8HA 1UVHA 4RC7B 3IS7A 3E1QA 2YJKA 3TA8A 2V2IA 3AF8X 2V2OA 3HL1A 3LKDA 2IU2A 4W4KB 5E1UA 2CHIA 3F33A 3RAVA 5C6FA 4EVCA 1LKMA 2D5KA 4MUDA 3RD0A 4CVSA 1RYTA 2PYBA 3PVRA 2JD60 3BVIA 5ERJA 3E1NA 1DATA 3WVWA 5D8RA 5J93A 3PWQC 4LPNA 5ERKA 1UMNA 4ITWA 3DBYA 3KA4A 4ZL6A 3QHBA 1JKVA 5J8SA 5JKMA 2QF9A 3PW1B 1L8IA 4DYUA 4ZKWA 4CVPA 1BCFA 4LPJA 2WLUA 3AJQA 5GOUA 4M33A 2OKCA 3IS8A 1AEWA 2VXXA 3Q4NA 2V2MA 1RCDA 4LYXA 2MGYA 1RCGA 4PG1A 3BVKA 3GGZA 4U3GA 4TOHA 1LB3A 4LQJA 1RCIA 5K52A 2WWXB 3UFBA 2Y44A 5FFBA 4MKUA 2Z6MA 2GYDA 2ZURX 2FZFA 3ISFA 2Z5PA 1R03A 1MOJA 3UOFA 5GU0X 1LKPA 4KXRB 5FFCA 1VELA 3M6JA 3H7GA 3E1JA 2OH3A 3WNWA 3WVVA 2C2UA 3GVYA 4YXJA 1TJOA 4XKSA 2CIHA 3FVBA 3UNOA 3PW8A 3O7SA 3KA6A 4LYUA 4XKUA 5GU1X 3R2LA 4ZKHA 3OJ5A 4Z3BA 5K53A 1JKUA 5CMQA 1JTSA 1S3QA 1Z4AA 4DZ0A 3PVRB 1J30A 1F30A 1ZUJA 4MY7A 2CLUA 2YW7A 4MJYA 2N02A 3R2KA 1O9IA 3E1OA 2CHPA 4II4A 2WTLA 1Z6OA 4ITTA 4M32A 2FG8A 2V8TA 3F36A 2ZA7A 4WJG4 3EZUA 4XKTA 5D8XA 5D8SA 1XZ3A 4TODA 2VXIA 4AM5A 5LBHA 2V2SA 1JREA 4CVTA 3NOZX 5JDOA 1NNQA 3PVYA 3AJOA 2HTNA 4ISPA 3PZAA 3EGMA 4TOEA 2FL0A 2V2LA 1TKPA 3PVTA 3ES3A 3A68A 4YKHA 4RC6A 1BFRA 2C2JA 3HIUA 2VZBA 3KA3A 3PWFA 1IERA 2ZA8A 2AR0A 5JKLG 4LQHA 4CMYA 2BKCA 1QYBA 4KVSA 4CYBA 2ZG7X 5HJFA 3SIDA 3VNXA 2G38B 4TOBA 3E6RA 2FHAA 2JD80 3T9JA 3F34A 3C1ZA 4E6KA 3GE4A 3PW8C 3BVFA 3FSEA 3F32A 3AK8A 3IQ1A 4ZTTA 3RGDA 1VJXA 2V2RA 2C2FA 2QQYA 3MPSA 4IWKA 3D19A 5J8WA 1VEIA 4II4B 3RE7A 2C41A 2WLAA 2CN6A 5JKMG 1QGHA 3BVLA 3OGHA 4DYYA 1JI4A 3GHQA 1TKOA 1YUZA 2ZG8X 1TK6A 3FI6A 2V8UA 3AJPA 4W4LB 2CN7A 1GWGA 3V3KB 1Z6OM 4LQNA 5FFEA 4Y08A 5JACA 3VVAA 5JDOB 3F38A 3W54A 2ZA6A 3FRSA 3PVYB 2BW1A 3AF7X 2V2JA 1BG7A 3Q4RA 1FHAA 1OTKA 4ETRA 3NP0X 2V2NA 2RBDA 3QVDA 2Z5QA 1JIGA 4TOCA 2V2PA 1B71A 4CYAA 3F35A 4ZKXA 5GN8A 4TOAA 1ZS3A 3GGYA 4AM4A 4KVRA 4RC6B 4QUWA 4EVEA 3O7RA 4KVQA 3AF9X 3F37A 4ISMA 4RC5A 2OC5A 4TO9A 5E2DA 3UOIA 3C1YA 1S30A 4ZMCA 3C23A 1YUXA 3R2OA 2YW6A 4ZLWA 3QB9A 3SH6A 5LG2A 2F7NA 5I4JA 3R2RA 3JZ9A 4PGIA 4DI0A 2HR5A 2ZG9X 3A9QA 2YJJA 5FEJA 4MN9A 3F39A 4CVRA 4M35A 3AK9A 1EUMA 4ERUA 2CWLA 3L0MA 4AM2A 3Q4OA 3QD8A 5IX6A 2IB0A 5D8PA 2C6RA 4DASA 5LS9A 3KXUA 3QHCA 3SE1A 4EVBA 4MXPA 5J9VA 3WVUA 2XGWA 3VV9A 4LQVA 1SOFA 4PG0A 3U90A 1RCEA 3ISEA 1S2ZA 1DVBA 2FJCA 4P18A 4RC8A 2CLBA 1JYBA 4YXMA 2CF7A 1O9RA 4OYNA 1NF4A 2CEIA 2Z5RA 3QZ3A 1DPSA 4TOFA 3R2SA 1XZ1A 2FFXJ 4RC7A 5HQOA 5CZUA 2Y3QA 4CY9A 3E1LA 4TOGA 4IXKA 1H96A 2BJYA 4A25A 3EZ0A 1N1QA 2FG4A 2XKQA 4DYZA 1MFRA 4IWJA 3PWQA 4R42A 1VLGA 3E6SA 5AXSA 4Z5SA 2X170 4REUA 4EVDA 3FRRA 1JGCA 3C21A 2ITBA 5GN8B 5D8QA 3E2CA 3ERZA 2XJNA 3KDQA 2JD70 1YV1A 1HRSA 4YVZA 4XGSA 2GS4A 3Q4QA 3KA8A 4RC5B 1NFVA 5HJHA 2IY4A 4ZL5A 3KA9A 5HU6D 4ML5A 1RCCA 1SQ3A 2GYQA 3BT5A 3N6OA 3PW1A 3E1PA 5FFAA 4X0JA
chains in the Genus database with same CATH topology
5D8YA 1VEQA 5FFDA 2FKZA 4LPMA 5LG8A 3JZAB 2UX1A 3E1MA 2BK6A 2XJMA 1IESA 3PVTB 4PGKA 1JI5A 4DE6A 3BKNA 3NP2X 2XJOA 4M34A 4CMYV 1NF6A 1KRQA 4ZJKA 3KX9A 4DYXA 3BVEA 1F33A 2G4HA 2W0OA 3KHKA 4TW3A 3R2HA 5GU3X 3KWOA 4E40A 1LKOA 2Z90A 3SHXA 3RBCA 5D8OA 5CMRA 3R2MA 2V15A 5JKLA 5GU2X 1L8HA 1UVHA 4RC7B 3IS7A 3E1QA 2YJKA 3TA8A 2V2IA 3AF8X 2V2OA 3HL1A 3LKDA 2IU2A 4W4KB 5E1UA 2CHIA 3F33A 3RAVA 5C6FA 4EVCA 1LKMA 2D5KA 4MUDA 3RD0A 4CVSA 1RYTA 2PYBA 3PVRA 2JD60 3BVIA 5ERJA 3E1NA 1DATA 3WVWA 5D8RA 5J93A 3PWQC 4LPNA 5ERKA 1UMNA 4ITWA 3DBYA 3KA4A 4ZL6A 3QHBA 1JKVA 5J8SA 5JKMA 2QF9A 3PW1B 1L8IA 4DYUA 4ZKWA 4CVPA 1BCFA 4LPJA 2WLUA 3AJQA 5GOUA 4M33A 2OKCA 3IS8A 1AEWA 2VXXA 3Q4NA 2V2MA 1RCDA 4LYXA 2MGYA 1RCGA 4PG1A 3BVKA 3GGZA 4U3GA 4TOHA 1LB3A 4LQJA 1RCIA 5K52A 2WWXB 3UFBA 2Y44A 5FFBA 4MKUA 2Z6MA 2GYDA 2ZURX 2FZFA 3ISFA 2Z5PA 1R03A 1MOJA 3UOFA 5GU0X 1LKPA 4KXRB 5FFCA 1VELA 3M6JA 3H7GA 3E1JA 2OH3A 3WNWA 3WVVA 2C2UA 3GVYA 4YXJA 1TJOA 4XKSA 2CIHA 3FVBA 3UNOA 3PW8A 3O7SA 3KA6A 4LYUA 4XKUA 5GU1X 3R2LA 4ZKHA 3OJ5A 4Z3BA 5K53A 1JKUA 5CMQA 1JTSA 1S3QA 1Z4AA 4DZ0A 3PVRB 1J30A 1F30A 1ZUJA 4MY7A 2CLUA 2YW7A 4MJYA 2N02A 3R2KA 1O9IA 3E1OA 2CHPA 4II4A 2WTLA 1Z6OA 4ITTA 4M32A 2FG8A 2V8TA 3F36A 2ZA7A 4WJG4 3EZUA 4XKTA 5D8XA 5D8SA 1XZ3A 4TODA 2VXIA 4AM5A 5LBHA 2V2SA 1JREA 4CVTA 3NOZX 5JDOA 1NNQA 3PVYA 3AJOA 2HTNA 4ISPA 3PZAA 3EGMA 4TOEA 2FL0A 2V2LA 1TKPA 3PVTA 3ES3A 3A68A 4YKHA 4RC6A 1BFRA 2C2JA 3HIUA 2VZBA 3KA3A 3PWFA 1IERA 2ZA8A 2AR0A 5JKLG 4LQHA 4CMYA 2BKCA 1QYBA 4KVSA 4CYBA 2ZG7X 5HJFA 3SIDA 3VNXA 2G38B 4TOBA 3E6RA 2FHAA 2JD80 3T9JA 3F34A 3C1ZA 4E6KA 3GE4A 3PW8C 3BVFA 3FSEA 3F32A 3AK8A 3IQ1A 4ZTTA 3RGDA 1VJXA 2V2RA 2C2FA 2QQYA 3MPSA 4IWKA 3D19A 5J8WA 1VEIA 4II4B 3RE7A 2C41A 2WLAA 2CN6A 5JKMG 1QGHA 3BVLA 3OGHA 4DYYA 1JI4A 3GHQA 1TKOA 1YUZA 2ZG8X 1TK6A 3FI6A 2V8UA 3AJPA 4W4LB 2CN7A 1GWGA 3V3KB 1Z6OM 4LQNA 5FFEA 4Y08A 5JACA 3VVAA 5JDOB 3F38A 3W54A 2ZA6A 3FRSA 3PVYB 2BW1A 3AF7X 2V2JA 1BG7A 3Q4RA 1FHAA 1OTKA 4ETRA 3NP0X 2V2NA 2RBDA 3QVDA 2Z5QA 1JIGA 4TOCA 2V2PA 1B71A 4CYAA 3F35A 4ZKXA 5GN8A 4TOAA 1ZS3A 3GGYA 4AM4A 4KVRA 4RC6B 4QUWA 4EVEA 3O7RA 4KVQA 3AF9X 3F37A 4ISMA 4RC5A 2OC5A 4TO9A 5E2DA 3UOIA 3C1YA 1S30A 4ZMCA 3C23A 1YUXA 3R2OA 2YW6A 4ZLWA 3QB9A 3SH6A 5LG2A 2F7NA 5I4JA 3R2RA 3JZ9A 4PGIA 4DI0A 2HR5A 2ZG9X 3A9QA 2YJJA 5FEJA 4MN9A 3F39A 4CVRA 4M35A 3AK9A 1EUMA 4ERUA 2CWLA 3L0MA 4AM2A 3Q4OA 3QD8A 5IX6A 2IB0A 5D8PA 2C6RA 4DASA 5LS9A 3KXUA 3QHCA 3SE1A 4EVBA 4MXPA 5J9VA 3WVUA 2XGWA 3VV9A 4LQVA 1SOFA 4PG0A 3U90A 1RCEA 3ISEA 1S2ZA 1DVBA 2FJCA 4P18A 4RC8A 2CLBA 1JYBA 4YXMA 2CF7A 1O9RA 4OYNA 1NF4A 2CEIA 2Z5RA 3QZ3A 1DPSA 4TOFA 3R2SA 1XZ1A 2FFXJ 4RC7A 5HQOA 5CZUA 2Y3QA 4CY9A 3E1LA 4TOGA 4IXKA 1H96A 2BJYA 4A25A 3EZ0A 1N1QA 2FG4A 2XKQA 4DYZA 1MFRA 4IWJA 3PWQA 4R42A 1VLGA 3E6SA 5AXSA 4Z5SA 2X170 4REUA 4EVDA 3FRRA 1JGCA 3C21A 2ITBA 5GN8B 5D8QA 3E2CA 3ERZA 2XJNA 3KDQA 2JD70 1YV1A 1HRSA 4YVZA 4XGSA 2GS4A 3Q4QA 3KA8A 4RC5B 1NFVA 5HJHA 2IY4A 4ZL5A 3KA9A 5HU6D 4ML5A 1RCCA 1SQ3A 2GYQA 3BT5A 3N6OA 3PW1A 3E1PA 5FFAA 4X0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8Y A;  1VEQ A;  5FFD A;  2FKZ A;  4LPM A;  5LG8 A;  2UX1 A;  3E1M A;  2BK6 A;  2XJM A;  1IES A;  3PVT B;  4PGK A;  1JI5 A;  4DE6 A;  3BKN A;  3NP2 X;  2XJO A;  4M34 A;  4CMY V;  1NF6 A;  1KRQ A;  4ZJK A;  3KX9 A;  4DYX A;  3BVE A;  1F33 A;  2G4H A;  2W0O A;  4TW3 A;  3R2H A;  5GU3 X;  3KWO A;  1LKO A;  2Z90 A;  3SHX A;  3RBC A;  5D8O A;  5CMR A;  3R2M A;  2V15 A;  5JKL A;  5GU2 X;  1L8H A;  1UVH A;  4RC7 B;  3IS7 A;  3E1Q A;  2YJK A;  3TA8 A;  2V2I A;  3AF8 X;  2V2O A;  3HL1 A;  2IU2 A;  5E1U A;  2CHI A;  3F33 A;  3RAV A;  5C6F A;  4EVC A;  1LKM A;  2D5K A;  4MUD A;  3RD0 A;  4CVS A;  1RYT A;  2PYB A;  3PVR A;  2JD6 0;  3BVI A;  5ERJ A;  3E1N A;  1DAT A;  3WVW A;  5D8R A;  5J93 A;  3PWQ C;  4LPN A;  5ERK A;  1UMN A;  4ITW A;  3KA4 A;  4ZL6 A;  3QHB A;  1JKV A;  5J8S A;  5JKM A;  2QF9 A;  3PW1 B;  1L8I A;  4DYU A;  4ZKW A;  4CVP A;  1BCF A;  4LPJ A;  2WLU A;  3AJQ A;  5GOU A;  4M33 A;  3IS8 A;  1AEW A;  2VXX A;  3Q4N A;  2V2M A;  1RCD A;  4LYX A;  1RCG A;  4PG1 A;  3BVK A;  4U3G A;  4TOH A;  1LB3 A;  4LQJ A;  1RCI A;  5K52 A;  5FFB A;  4MKU A;  2Z6M A;  2GYD A;  2ZUR X;  2FZF A;  3ISF A;  2Z5P A;  1R03 A;  1MOJ A;  3UOF A;  5GU0 X;  1LKP A;  5FFC A;  1VEL A;  3H7G A;  3E1J A;  2OH3 A;  3WNW A;  3WVV A;  2C2U A;  3GVY A;  1TJO A;  4XKS A;  2CIH A;  3FVB A;  3UNO A;  3PW8 A;  3O7S A;  3KA6 A;  4LYU A;  4XKU A;  5GU1 X;  3R2L A;  4ZKH A;  3OJ5 A;  4Z3B A;  5K53 A;  1JKU A;  5CMQ A;  1JTS A;  1S3Q A;  1Z4A A;  4DZ0 A;  3PVR B;  1J30 A;  1F30 A;  1ZUJ A;  4MY7 A;  2CLU A;  2YW7 A;  4MJY A;  3R2K A;  1O9I A;  3E1O A;  2CHP A;  4II4 A;  2WTL A;  1Z6O A;  4ITT A;  4M32 A;  2FG8 A;  3F36 A;  2ZA7 A;  3EZU A;  4XKT A;  5D8X A;  5D8S A;  1XZ3 A;  4TOD A;  2VXI A;  4AM5 A;  5LBH A;  2V2S A;  1JRE A;  4CVT A;  3NOZ X;  1NNQ A;  3PVY A;  3AJO A;  2HTN A;  4ISP A;  3PZA A;  3EGM A;  4TOE A;  2FL0 A;  2V2L A;  1TKP A;  3PVT A;  3ES3 A;  3A68 A;  4YKH A;  4RC6 A;  1BFR A;  2C2J A;  3HIU A;  2VZB A;  3KA3 A;  3PWF A;  1IER A;  2ZA8 A;  5JKL G;  4LQH A;  4CMY A;  2BKC A;  1QYB A;  4KVS A;  4CYB A;  2ZG7 X;  5HJF A;  3SID A;  3VNX A;  4TOB A;  3E6R A;  2FHA A;  2JD8 0;  3T9J A;  3F34 A;  4E6K A;  3GE4 A;  3PW8 C;  3BVF A;  3FSE A;  3F32 A;  3AK8 A;  3IQ1 A;  4ZTT A;  3RGD A;  1VJX A;  2V2R A;  2C2F A;  2QQY A;  3MPS A;  4IWK A;  5J8W A;  1VEI A;  4II4 B;  3RE7 A;  2C41 A;  2WLA A;  2CN6 A;  5JKM G;  1QGH A;  3BVL A;  3OGH A;  4DYY A;  1JI4 A;  3GHQ A;  1TKO A;  1YUZ A;  2ZG8 X;  1TK6 A;  3FI6 A;  3AJP A;  2CN7 A;  1GWG A;  1Z6O M;  4LQN A;  5FFE A;  4Y08 A;  5JAC A;  3F38 A;  2ZA6 A;  3PVY B;  2BW1 A;  3AF7 X;  2V2J A;  1BG7 A;  3Q4R A;  1FHA A;  1OTK A;  4ETR A;  3NP0 X;  2V2N A;  2RBD A;  3QVD A;  2Z5Q A;  1JIG A;  4TOC A;  2V2P A;  1B71 A;  4CYA A;  3F35 A;  4ZKX A;  5GN8 A;  4TOA A;  1ZS3 A;  4AM4 A;  4KVR A;  4RC6 B;  4QUW A;  4EVE A;  3O7R A;  4KVQ A;  3AF9 X;  3F37 A;  4ISM A;  4RC5 A;  2OC5 A;  4TO9 A;  5E2D A;  3UOI A;  1S30 A;  4ZMC A;  1YUX A;  3R2O A;  2YW6 A;  4ZLW A;  3QB9 A;  3SH6 A;  5LG2 A;  2F7N A;  5I4J A;  3R2R A;  4PGI A;  4DI0 A;  2HR5 A;  2ZG9 X;  3A9Q A;  2YJJ A;  5FEJ A;  4MN9 A;  3F39 A;  4CVR A;  4M35 A;  3AK9 A;  1EUM A;  4ERU A;  4AM2 A;  3Q4O A;  3QD8 A;  5IX6 A;  2IB0 A;  5D8P A;  2C6R A;  4DAS A;  5LS9 A;  3KXU A;  3QHC A;  3SE1 A;  4EVB A;  5J9V A;  3WVU A;  2XGW A;  4LQV A;  1SOF A;  4PG0 A;  3U90 A;  1RCE A;  3ISE A;  1S2Z A;  1DVB A;  2FJC A;  4P18 A;  4RC8 A;  2CLB A;  1JYB A;  2CF7 A;  1O9R A;  4OYN A;  1NF4 A;  2CEI A;  2Z5R A;  3QZ3 A;  1DPS A;  4TOF A;  3R2S A;  1XZ1 A;  2FFX J;  4RC7 A;  5HQO A;  5CZU A;  2Y3Q A;  4CY9 A;  3E1L A;  4TOG A;  4IXK A;  1H96 A;  2BJY A;  4A25 A;  3EZ0 A;  1N1Q A;  2FG4 A;  2XKQ A;  4DYZ A;  1MFR A;  4IWJ A;  3PWQ A;  4R42 A;  1VLG A;  3E6S A;  5AXS A;  4Z5S A;  2X17 0;  4REU A;  4EVD A;  1JGC A;  2ITB A;  5GN8 B;  5D8Q A;  3E2C A;  3ERZ A;  2XJN A;  2JD7 0;  1YV1 A;  1HRS A;  4XGS A;  2GS4 A;  3Q4Q A;  3KA8 A;  4RC5 B;  1NFV A;  5HJH A;  2IY4 A;  4ZL5 A;  3KA9 A;  4ML5 A;  1RCC A;  1SQ3 A;  2GYQ A;  3BT5 A;  3PW1 A;  3E1P A;  5FFA A; 
#chains in the Genus database with same CATH topology
 5D8Y A;  1VEQ A;  5FFD A;  2FKZ A;  4LPM A;  5LG8 A;  3JZA B;  2UX1 A;  3E1M A;  2BK6 A;  2XJM A;  1IES A;  3PVT B;  4PGK A;  1JI5 A;  4DE6 A;  3BKN A;  3NP2 X;  2XJO A;  4M34 A;  4CMY V;  1NF6 A;  1KRQ A;  4ZJK A;  3KX9 A;  4DYX A;  3BVE A;  1F33 A;  2G4H A;  2W0O A;  3KHK A;  4TW3 A;  3R2H A;  5GU3 X;  3KWO A;  4E40 A;  1LKO A;  2Z90 A;  3SHX A;  3RBC A;  5D8O A;  5CMR A;  3R2M A;  2V15 A;  5JKL A;  5GU2 X;  1L8H A;  1UVH A;  4RC7 B;  3IS7 A;  3E1Q A;  2YJK A;  3TA8 A;  2V2I A;  3AF8 X;  2V2O A;  3HL1 A;  3LKD A;  2IU2 A;  4W4K B;  5E1U A;  2CHI A;  3F33 A;  3RAV A;  5C6F A;  4EVC A;  1LKM A;  2D5K A;  4MUD A;  3RD0 A;  4CVS A;  1RYT A;  2PYB A;  3PVR A;  2JD6 0;  3BVI A;  5ERJ A;  3E1N A;  1DAT A;  3WVW A;  5D8R A;  5J93 A;  3PWQ C;  4LPN A;  5ERK A;  1UMN A;  4ITW A;  3DBY A;  3KA4 A;  4ZL6 A;  3QHB A;  1JKV A;  5J8S A;  5JKM A;  2QF9 A;  3PW1 B;  1L8I A;  4DYU A;  4ZKW A;  4CVP A;  1BCF A;  4LPJ A;  2WLU A;  3AJQ A;  5GOU A;  4M33 A;  2OKC A;  3IS8 A;  1AEW A;  2VXX A;  3Q4N A;  2V2M A;  1RCD A;  4LYX A;  2MGY A;  1RCG A;  4PG1 A;  3BVK A;  3GGZ A;  4U3G A;  4TOH A;  1LB3 A;  4LQJ A;  1RCI A;  5K52 A;  2WWX B;  3UFB A;  2Y44 A;  5FFB A;  4MKU A;  2Z6M A;  2GYD A;  2ZUR X;  2FZF A;  3ISF A;  2Z5P A;  1R03 A;  1MOJ A;  3UOF A;  5GU0 X;  1LKP A;  4KXR B;  5FFC A;  1VEL A;  3M6J A;  3H7G A;  3E1J A;  2OH3 A;  3WNW A;  3WVV A;  2C2U A;  3GVY A;  4YXJ A;  1TJO A;  4XKS A;  2CIH A;  3FVB A;  3UNO A;  3PW8 A;  3O7S A;  3KA6 A;  4LYU A;  4XKU A;  5GU1 X;  3R2L A;  4ZKH A;  3OJ5 A;  4Z3B A;  5K53 A;  1JKU A;  5CMQ A;  1JTS A;  1S3Q A;  1Z4A A;  4DZ0 A;  3PVR B;  1J30 A;  1F30 A;  1ZUJ A;  4MY7 A;  2CLU A;  2YW7 A;  4MJY A;  2N02 A;  3R2K A;  1O9I A;  3E1O A;  2CHP A;  4II4 A;  2WTL A;  1Z6O A;  4ITT A;  4M32 A;  2FG8 A;  2V8T A;  3F36 A;  2ZA7 A;  4WJG 4;  3EZU A;  4XKT A;  5D8X A;  5D8S A;  1XZ3 A;  4TOD A;  2VXI A;  4AM5 A;  5LBH A;  2V2S A;  1JRE A;  4CVT A;  3NOZ X;  5JDO A;  1NNQ A;  3PVY A;  3AJO A;  2HTN A;  4ISP A;  3PZA A;  3EGM A;  4TOE A;  2FL0 A;  2V2L A;  1TKP A;  3PVT A;  3ES3 A;  3A68 A;  4YKH A;  4RC6 A;  1BFR A;  2C2J A;  3HIU A;  2VZB A;  3KA3 A;  3PWF A;  1IER A;  2ZA8 A;  2AR0 A;  5JKL G;  4LQH A;  4CMY A;  2BKC A;  1QYB A;  4KVS A;  4CYB A;  2ZG7 X;  5HJF A;  3SID A;  3VNX A;  2G38 B;  4TOB A;  3E6R A;  2FHA A;  2JD8 0;  3T9J A;  3F34 A;  3C1Z A;  4E6K A;  3GE4 A;  3PW8 C;  3BVF A;  3FSE A;  3F32 A;  3AK8 A;  3IQ1 A;  4ZTT A;  3RGD A;  1VJX A;  2V2R A;  2C2F A;  2QQY A;  3MPS A;  4IWK A;  3D19 A;  5J8W A;  1VEI A;  4II4 B;  3RE7 A;  2C41 A;  2WLA A;  2CN6 A;  5JKM G;  1QGH A;  3BVL A;  3OGH A;  4DYY A;  1JI4 A;  3GHQ A;  1TKO A;  1YUZ A;  2ZG8 X;  1TK6 A;  3FI6 A;  2V8U A;  3AJP A;  4W4L B;  2CN7 A;  1GWG A;  3V3K B;  1Z6O M;  4LQN A;  5FFE A;  4Y08 A;  5JAC A;  3VVA A;  5JDO B;  3F38 A;  3W54 A;  2ZA6 A;  3FRS A;  3PVY B;  2BW1 A;  3AF7 X;  2V2J A;  1BG7 A;  3Q4R A;  1FHA A;  1OTK A;  4ETR A;  3NP0 X;  2V2N A;  2RBD A;  3QVD A;  2Z5Q A;  1JIG A;  4TOC A;  2V2P A;  1B71 A;  4CYA A;  3F35 A;  4ZKX A;  5GN8 A;  4TOA A;  1ZS3 A;  3GGY A;  4AM4 A;  4KVR A;  4RC6 B;  4QUW A;  4EVE A;  3O7R A;  4KVQ A;  3AF9 X;  3F37 A;  4ISM A;  4RC5 A;  2OC5 A;  4TO9 A;  5E2D A;  3UOI A;  3C1Y A;  1S30 A;  4ZMC A;  3C23 A;  1YUX A;  3R2O A;  2YW6 A;  4ZLW A;  3QB9 A;  3SH6 A;  5LG2 A;  2F7N A;  5I4J A;  3R2R A;  3JZ9 A;  4PGI A;  4DI0 A;  2HR5 A;  2ZG9 X;  3A9Q A;  2YJJ A;  5FEJ A;  4MN9 A;  3F39 A;  4CVR A;  4M35 A;  3AK9 A;  1EUM A;  4ERU A;  2CWL A;  3L0M A;  4AM2 A;  3Q4O A;  3QD8 A;  5IX6 A;  2IB0 A;  5D8P A;  2C6R A;  4DAS A;  5LS9 A;  3KXU A;  3QHC A;  3SE1 A;  4EVB A;  4MXP A;  5J9V A;  3WVU A;  2XGW A;  3VV9 A;  4LQV A;  1SOF A;  4PG0 A;  3U90 A;  1RCE A;  3ISE A;  1S2Z A;  1DVB A;  2FJC A;  4P18 A;  4RC8 A;  2CLB A;  1JYB A;  4YXM A;  2CF7 A;  1O9R A;  4OYN A;  1NF4 A;  2CEI A;  2Z5R A;  3QZ3 A;  1DPS A;  4TOF A;  3R2S A;  1XZ1 A;  2FFX J;  4RC7 A;  5HQO A;  5CZU A;  2Y3Q A;  4CY9 A;  3E1L A;  4TOG A;  4IXK A;  1H96 A;  2BJY A;  4A25 A;  3EZ0 A;  1N1Q A;  2FG4 A;  2XKQ A;  4DYZ A;  1MFR A;  4IWJ A;  3PWQ A;  4R42 A;  1VLG A;  3E6S A;  5AXS A;  4Z5S A;  2X17 0;  4REU A;  4EVD A;  3FRR A;  1JGC A;  3C21 A;  2ITB A;  5GN8 B;  5D8Q A;  3E2C A;  3ERZ A;  2XJN A;  3KDQ A;  2JD7 0;  1YV1 A;  1HRS A;  4YVZ A;  4XGS A;  2GS4 A;  3Q4Q A;  3KA8 A;  4RC5 B;  1NFV A;  5HJH A;  2IY4 A;  4ZL5 A;  3KA9 A;  5HU6 D;  4ML5 A;  1RCC A;  1SQ3 A;  2GYQ A;  3BT5 A;  3N6O A;  3PW1 A;  3E1P A;  5FFA A;  4X0J A; 
#chains in the Genus database with same CATH homology
 5D8Y A;  1VEQ A;  5FFD A;  2FKZ A;  4LPM A;  5LG8 A;  3JZA B;  2UX1 A;  3E1M A;  2BK6 A;  2XJM A;  1IES A;  3PVT B;  4PGK A;  1JI5 A;  4DE6 A;  3BKN A;  3NP2 X;  2XJO A;  4M34 A;  4CMY V;  1NF6 A;  1KRQ A;  4ZJK A;  3KX9 A;  4DYX A;  3BVE A;  1F33 A;  2G4H A;  2W0O A;  3KHK A;  4TW3 A;  3R2H A;  5GU3 X;  3KWO A;  4E40 A;  1LKO A;  2Z90 A;  3SHX A;  3RBC A;  5D8O A;  5CMR A;  3R2M A;  2V15 A;  5JKL A;  5GU2 X;  1L8H A;  1UVH A;  4RC7 B;  3IS7 A;  3E1Q A;  2YJK A;  3TA8 A;  2V2I A;  3AF8 X;  2V2O A;  3HL1 A;  3LKD A;  2IU2 A;  4W4K B;  5E1U A;  2CHI A;  3F33 A;  3RAV A;  5C6F A;  4EVC A;  1LKM A;  2D5K A;  4MUD A;  3RD0 A;  4CVS A;  1RYT A;  2PYB A;  3PVR A;  2JD6 0;  3BVI A;  5ERJ A;  3E1N A;  1DAT A;  3WVW A;  5D8R A;  5J93 A;  3PWQ C;  4LPN A;  5ERK A;  1UMN A;  4ITW A;  3DBY A;  3KA4 A;  4ZL6 A;  3QHB A;  1JKV A;  5J8S A;  5JKM A;  2QF9 A;  3PW1 B;  1L8I A;  4DYU A;  4ZKW A;  4CVP A;  1BCF A;  4LPJ A;  2WLU A;  3AJQ A;  5GOU A;  4M33 A;  2OKC A;  3IS8 A;  1AEW A;  2VXX A;  3Q4N A;  2V2M A;  1RCD A;  4LYX A;  2MGY A;  1RCG A;  4PG1 A;  3BVK A;  3GGZ A;  4U3G A;  4TOH A;  1LB3 A;  4LQJ A;  1RCI A;  5K52 A;  2WWX B;  3UFB A;  2Y44 A;  5FFB A;  4MKU A;  2Z6M A;  2GYD A;  2ZUR X;  2FZF A;  3ISF A;  2Z5P A;  1R03 A;  1MOJ A;  3UOF A;  5GU0 X;  1LKP A;  4KXR B;  5FFC A;  1VEL A;  3M6J A;  3H7G A;  3E1J A;  2OH3 A;  3WNW A;  3WVV A;  2C2U A;  3GVY A;  4YXJ A;  1TJO A;  4XKS A;  2CIH A;  3FVB A;  3UNO A;  3PW8 A;  3O7S A;  3KA6 A;  4LYU A;  4XKU A;  5GU1 X;  3R2L A;  4ZKH A;  3OJ5 A;  4Z3B A;  5K53 A;  1JKU A;  5CMQ A;  1JTS A;  1S3Q A;  1Z4A A;  4DZ0 A;  3PVR B;  1J30 A;  1F30 A;  1ZUJ A;  4MY7 A;  2CLU A;  2YW7 A;  4MJY A;  2N02 A;  3R2K A;  1O9I A;  3E1O A;  2CHP A;  4II4 A;  2WTL A;  1Z6O A;  4ITT A;  4M32 A;  2FG8 A;  2V8T A;  3F36 A;  2ZA7 A;  4WJG 4;  3EZU A;  4XKT A;  5D8X A;  5D8S A;  1XZ3 A;  4TOD A;  2VXI A;  4AM5 A;  5LBH A;  2V2S A;  1JRE A;  4CVT A;  3NOZ X;  5JDO A;  1NNQ A;  3PVY A;  3AJO A;  2HTN A;  4ISP A;  3PZA A;  3EGM A;  4TOE A;  2FL0 A;  2V2L A;  1TKP A;  3PVT A;  3ES3 A;  3A68 A;  4YKH A;  4RC6 A;  1BFR A;  2C2J A;  3HIU A;  2VZB A;  3KA3 A;  3PWF A;  1IER A;  2ZA8 A;  2AR0 A;  5JKL G;  4LQH A;  4CMY A;  2BKC A;  1QYB A;  4KVS A;  4CYB A;  2ZG7 X;  5HJF A;  3SID A;  3VNX A;  2G38 B;  4TOB A;  3E6R A;  2FHA A;  2JD8 0;  3T9J A;  3F34 A;  3C1Z A;  4E6K A;  3GE4 A;  3PW8 C;  3BVF A;  3FSE A;  3F32 A;  3AK8 A;  3IQ1 A;  4ZTT A;  3RGD A;  1VJX A;  2V2R A;  2C2F A;  2QQY A;  3MPS A;  4IWK A;  3D19 A;  5J8W A;  1VEI A;  4II4 B;  3RE7 A;  2C41 A;  2WLA A;  2CN6 A;  5JKM G;  1QGH A;  3BVL A;  3OGH A;  4DYY A;  1JI4 A;  3GHQ A;  1TKO A;  1YUZ A;  2ZG8 X;  1TK6 A;  3FI6 A;  2V8U A;  3AJP A;  4W4L B;  2CN7 A;  1GWG A;  3V3K B;  1Z6O M;  4LQN A;  5FFE A;  4Y08 A;  5JAC A;  3VVA A;  5JDO B;  3F38 A;  3W54 A;  2ZA6 A;  3FRS A;  3PVY B;  2BW1 A;  3AF7 X;  2V2J A;  1BG7 A;  3Q4R A;  1FHA A;  1OTK A;  4ETR A;  3NP0 X;  2V2N A;  2RBD A;  3QVD A;  2Z5Q A;  1JIG A;  4TOC A;  2V2P A;  1B71 A;  4CYA A;  3F35 A;  4ZKX A;  5GN8 A;  4TOA A;  1ZS3 A;  3GGY A;  4AM4 A;  4KVR A;  4RC6 B;  4QUW A;  4EVE A;  3O7R A;  4KVQ A;  3AF9 X;  3F37 A;  4ISM A;  4RC5 A;  2OC5 A;  4TO9 A;  5E2D A;  3UOI A;  3C1Y A;  1S30 A;  4ZMC A;  3C23 A;  1YUX A;  3R2O A;  2YW6 A;  4ZLW A;  3QB9 A;  3SH6 A;  5LG2 A;  2F7N A;  5I4J A;  3R2R A;  3JZ9 A;  4PGI A;  4DI0 A;  2HR5 A;  2ZG9 X;  3A9Q A;  2YJJ A;  5FEJ A;  4MN9 A;  3F39 A;  4CVR A;  4M35 A;  3AK9 A;  1EUM A;  4ERU A;  2CWL A;  3L0M A;  4AM2 A;  3Q4O A;  3QD8 A;  5IX6 A;  2IB0 A;  5D8P A;  2C6R A;  4DAS A;  5LS9 A;  3KXU A;  3QHC A;  3SE1 A;  4EVB A;  4MXP A;  5J9V A;  3WVU A;  2XGW A;  3VV9 A;  4LQV A;  1SOF A;  4PG0 A;  3U90 A;  1RCE A;  3ISE A;  1S2Z A;  1DVB A;  2FJC A;  4P18 A;  4RC8 A;  2CLB A;  1JYB A;  4YXM A;  2CF7 A;  1O9R A;  4OYN A;  1NF4 A;  2CEI A;  2Z5R A;  3QZ3 A;  1DPS A;  4TOF A;  3R2S A;  1XZ1 A;  2FFX J;  4RC7 A;  5HQO A;  5CZU A;  2Y3Q A;  4CY9 A;  3E1L A;  4TOG A;  4IXK A;  1H96 A;  2BJY A;  4A25 A;  3EZ0 A;  1N1Q A;  2FG4 A;  2XKQ A;  4DYZ A;  1MFR A;  4IWJ A;  3PWQ A;  4R42 A;  1VLG A;  3E6S A;  5AXS A;  4Z5S A;  2X17 0;  4REU A;  4EVD A;  3FRR A;  1JGC A;  3C21 A;  2ITB A;  5GN8 B;  5D8Q A;  3E2C A;  3ERZ A;  2XJN A;  3KDQ A;  2JD7 0;  1YV1 A;  1HRS A;  4YVZ A;  4XGS A;  2GS4 A;  3Q4Q A;  3KA8 A;  4RC5 B;  1NFV A;  5HJH A;  2IY4 A;  4ZL5 A;  3KA9 A;  5HU6 D;  4ML5 A;  1RCC A;  1SQ3 A;  2GYQ A;  3BT5 A;  3N6O A;  3PW1 A;  3E1P A;  5FFA A;  4X0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...