1JTSA

Dna protection and binding by e. coli dps protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
155
structure length
155
Chain Sequence
NLLYTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAKDDDTADILTAASRDLDKFLWFIESNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title DNA Protection and Binding by E. Coli Dps Protein
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 65
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2001-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1jtsA00
4CMYA 4MJYA 5K52A 2GS4A 4TO9A 4CVRA 3KA3A 5LG2A 3Q4QA 2OH3A 2C41A 3WVWA 3BVEA 3R2HA 2IY4A 3BT5A 4A25A 4ZKWA 5HJHA 3BVKA 3AJPA 3F34A 2VXIA 2ZG8X 3FSEA 5D8XA 2XJNA 4Z5SA 3F39A 1Z6OM 4LQJA 1BG7A 2V15A 4AM4A 4XGSA 5D8PA 4RC8A 4MKUA 2HR5A 3WNWA 3PWQA 2FL0A 5D8SA 1DPSA 4IXKA 2C2UA 2BJYA 3E1MA 3GVYA 3IS8A 5E2DA 2CHPA 4PGIA 4IWKA 5JKMG 2ZA8A 4REUA 4TW3A 3IS7A 4DYYA 4M32A 4LQNA 4LYXA 3PW1B 4II4A 3R2LA 1IESA 1RCDA 2YJKA 3E1PA 4TODA 3TA8A 5D8RA 1JKUA 3QHBA 1F33A 1VEIA 2QF9A 2OC5A 3ISEA 3A9QA 1VJXA 2CHIA 3R2RA 1ZS3A 4TOFA 5J93A 1TJOA 4M34A 2Z90A 5ERJA 2FFXJ 2BK6A 3SHXA 2ZA6A 5LG8A 2W0OA 2C2FA 5GU2X 3H7GA 4RC7A 4EVBA 2V2SA 5FFDA 2Z5RA 1S3QA 1JYBA 4CYAA 4RC6A 5AXSA 1LKOA 4CVSA 3AJQA 1L8HA 2WTLA 4TOGA 3E2CA 2CEIA 5K53A 2V2RA 1VELA 4M33A 4XKUA 2WLAA 2CN7A 2C2JA 4LQHA 5GU1X 4MY7A 1JREA 2V2NA 3UOFA 2YW7A 1XZ1A 3FI6A 4AM5A 3PVYA 3IQ1A 1EUMA 1BCFA 3PZAA 2VXXA 2C6RA 3KA9A 3QD8A 2G4HA 1DATA 1R03A 4LYUA 3U90A 1TKOA 3E1JA 2GYDA 4ERUA 3EZ0A 2Z5PA 1AEWA 1RYTA 3E1QA 1VEQA 3PVRA 4LQVA 3ISFA 1RCIA 4TOAA 4IWJA 2XJOA 1HRSA 3BVIA 2CN6A 3RGDA 4OYNA 4DYZA 1QYBA 1FHAA 4ZKXA 4MUDA 4ZTTA 1S30A 2ZURX 3QVDA 3KXUA 4R42A 2X170 1MOJA 2GYQA 3Q4OA 4ITWA 4RC5B 5JKLG 3KWOA 3UOIA 3Q4NA 5D8OA 2V2JA 3RBCA 2CLUA 1LKPA 3F35A 2RBDA 3HL1A 3OGHA 1OTKA 1RCEA 4RC7B 4CMYV 5GN8A 3T9JA 5CZUA 4DE6A 3KA8A 3AJOA 4RC6B 4EVCA 3SIDA 4ML5A 1O9IA 1VLGA 2ZG9X 5HQOA 1O9RA 3WVVA 3E1NA 5E1UA 4MN9A 3HIUA 3WVUA 4KVRA 3AF9X 2IB0A 3UNOA 1KRQA 4XKSA 2VZBA 1NF4A 1RCCA 2ZA7A 4TOCA 1S2ZA 1IERA 1LKMA 1SQ3A 4PGKA 3EZUA 3E1OA 1Z4AA 1F30A 1LB3A 2JD70 3AK8A 1JGCA 5JKMA 3PW1A 2JD60 2HTNA 3RAVA 3PVTA 5IX6A 1SOFA 4XKTA 3ERZA 4LPMA 2V2LA 3BVFA 1MFRA 1JTSA 5I4JA 4ZKHA 4YKHA 2YW6A 5J9VA 4TOEA 4PG0A 3MPSA 5FFEA 4ZL6A 1UVHA 4ZL5A 5CMQA 2CIHA 3SE1A 5GU0X 1Z6OA 3E1LA 5FFAA 2D5KA 3QHCA 4ZLWA 4II4B 3R2SA 2F7NA 4M35A 1YUXA 3F38A 1J30A 2YJJA 2FJCA 2V2MA 2ZG7X 1QGHA 2FKZA 3F32A 5GN8B 2ITBA 5FFCA 1NFVA 3KA4A 3A68A 3R2KA 1NF6A 5J8SA 3AF8X 3O7SA 5LBHA 1JI5A 3F36A 4CVPA 4DI0A 5FFBA 3RE7A 2PYBA 5GU3X 2CF7A 2UX1A 2FG8A 2BKCA 4Y08A 4LPNA 3F33A 1JI4A 4LPJA 3RD0A 2Z6MA 3NP0X 4DASA 3PWFA 4DYUA 4ISPA 5GOUA 5C6FA 3NP2X 1TKPA 1GWGA 2FZFA 1YV1A 1N1QA 3PW8C 3R2OA 2XKQA 3KX9A 2BW1A 4CY9A 5J8WA 4DZ0A 3QB9A 2CLBA 4E6KA 2FG4A 1TK6A 4ETRA 3PVTB 4ZJKA 1L8IA 2V2PA 4CVTA 5CMRA 3E6SA 3Q4RA 2IU2A 2V2OA 2Z5QA 1H96A 4KVSA 3PVYB 3F37A 2V2IA 3EGMA 3OJ5A 5LS9A 4P18A 1UMNA 3AK9A 4RC5A 1JKVA 3BVLA 1YUZA 4DYXA 4U3GA 1ZUJA 3BKNA 1JIGA 4ITTA 4PG1A 1RCGA 3GHQA 5JKLA 3NOZX 5D8YA 4QUWA 5FEJA 3E6RA 5HJFA 4ISMA 3O7RA 2XJMA 3PVRB 4EVEA 1BFRA 1XZ3A 3SH6A 3PW8A 5ERKA 2Y3QA 4EVDA 3GE4A 3QZ3A 2XGWA 3AF7X 5D8QA 3ES3A 3VNXA 3PWQC 5JACA 4CYBA 1DVBA 2JD80 1B71A 2WLUA 2FHAA 2QQYA 3R2MA 4KVQA 4Z3BA 3KA6A 1NNQA 3FVBA 4TOHA 4ZMCA 4AM2A 4TOBA
chains in the Genus database with same CATH superfamily
4CMYA 4MJYA 5K52A 3M6JA 2GS4A 4TO9A 4CVRA 3KA3A 5LG2A 3Q4QA 2OH3A 2C41A 3WVWA 3BVEA 3R2HA 2IY4A 3BT5A 4A25A 4ZKWA 4W4LB 5HJHA 3BVKA 3AJPA 2OKCA 3F34A 2V8TA 2VXIA 2ZG8X 3FSEA 4X0JA 5D8XA 2XJNA 4Z5SA 3F39A 1Z6OM 4LQJA 1BG7A 2V15A 4AM4A 3C1ZA 4XGSA 5D8PA 4RC8A 4MKUA 4WJG4 2HR5A 3WNWA 3PWQA 2FL0A 5D8SA 1DPSA 4IXKA 2C2UA 2BJYA 3DBYA 3E1MA 3GVYA 3IS8A 4E40A 5E2DA 2CHPA 4PGIA 4IWKA 5JKMG 2ZA8A 4REUA 4TW3A 3IS7A 4DYYA 4M32A 4LQNA 4LYXA 3PW1B 4II4A 3R2LA 1IESA 1RCDA 2YJKA 3E1PA 4TODA 4YXJA 3TA8A 3KDQA 3KHKA 5D8RA 1JKUA 3QHBA 1F33A 1VEIA 2QF9A 2OC5A 3ISEA 3A9QA 1VJXA 2CHIA 3R2RA 1ZS3A 4TOFA 5J93A 1TJOA 4M34A 2Z90A 5ERJA 2FFXJ 2BK6A 3SHXA 2ZA6A 2Y44A 5LG8A 2W0OA 2C2FA 5GU2X 3H7GA 4RC7A 4EVBA 2V2SA 5FFDA 2Z5RA 3C1YA 1S3QA 1JYBA 4CYAA 2WWXB 4RC6A 5AXSA 1LKOA 4CVSA 3AJQA 1L8HA 2WTLA 4TOGA 3E2CA 3VVAA 2CEIA 5K53A 2V2RA 1VELA 4M33A 4XKUA 3N6OA 2WLAA 2CN7A 2C2JA 4LQHA 5GU1X 4MY7A 1JREA 2V2NA 3UOFA 2YW7A 1XZ1A 3FI6A 4AM5A 3PVYA 3IQ1A 1EUMA 1BCFA 5JDOB 3PZAA 2AR0A 2VXXA 2C6RA 3KA9A 3QD8A 2G4HA 1DATA 1R03A 4LYUA 3U90A 1TKOA 3E1JA 2GYDA 4ERUA 3EZ0A 3D19A 2Z5PA 1AEWA 1RYTA 3E1QA 1VEQA 3PVRA 3C21A 4LQVA 3ISFA 1RCIA 4TOAA 4IWJA 2XJOA 1HRSA 3BVIA 2CN6A 3RGDA 4OYNA 3LKDA 4DYZA 1QYBA 2MGYA 1FHAA 4ZKXA 4MUDA 4ZTTA 1S30A 2ZURX 3QVDA 3KXUA 4R42A 2X170 1MOJA 2GYQA 3Q4OA 4ITWA 4RC5B 5JKLG 3KWOA 3UOIA 3Q4NA 5D8OA 2V2JA 3RBCA 2CLUA 1LKPA 3F35A 2RBDA 3HL1A 3OGHA 1OTKA 1RCEA 4RC7B 4CMYV 5GN8A 3T9JA 5CZUA 4DE6A 3KA8A 3AJOA 4RC6B 4EVCA 2CWLA 3SIDA 4ML5A 1O9IA 1VLGA 2ZG9X 5HQOA 1O9RA 3WVVA 3E1NA 5E1UA 4MN9A 3HIUA 3WVUA 3L0MA 4KVRA 3AF9X 2IB0A 3UNOA 1KRQA 4XKSA 2VZBA 1NF4A 1RCCA 2ZA7A 4TOCA 2G38B 1S2ZA 1IERA 1LKMA 1SQ3A 4PGKA 3EZUA 3E1OA 1Z4AA 1F30A 1LB3A 2JD70 3AK8A 3W54A 1JGCA 5JKMA 3PW1A 2JD60 2HTNA 3RAVA 3VV9A 3PVTA 5IX6A 1SOFA 4XKTA 3ERZA 4LPMA 2V2LA 3BVFA 1MFRA 1JTSA 5I4JA 4ZKHA 4YKHA 2YW6A 5J9VA 4TOEA 4PG0A 3MPSA 5FFEA 4ZL6A 1UVHA 4ZL5A 5CMQA 2CIHA 3SE1A 5GU0X 1Z6OA 3E1LA 5FFAA 2D5KA 3QHCA 4ZLWA 4II4B 3R2SA 2F7NA 4M35A 4YVZA 1YUXA 3F38A 1J30A 2YJJA 2FJCA 2V2MA 2ZG7X 1QGHA 2FKZA 3F32A 5GN8B 3JZ9A 2ITBA 3C23A 5FFCA 4KXRB 4MXPA 1NFVA 3KA4A 4W4KB 3A68A 3R2KA 1NF6A 5J8SA 3AF8X 3JZAB 3O7SA 5LBHA 1JI5A 3F36A 4CVPA 4DI0A 5FFBA 3RE7A 2PYBA 5GU3X 2CF7A 2UX1A 2FG8A 2BKCA 4Y08A 4LPNA 3F33A 1JI4A 4LPJA 3RD0A 2Z6MA 3NP0X 4DASA 2N02A 3PWFA 5JDOA 4DYUA 4ISPA 5GOUA 5C6FA 3NP2X 1TKPA 1GWGA 2FZFA 1YV1A 1N1QA 3PW8C 3R2OA 2XKQA 3KX9A 2BW1A 4CY9A 5J8WA 4DZ0A 3QB9A 2CLBA 4E6KA 2FG4A 1TK6A 4ETRA 3PVTB 4ZJKA 1L8IA 2V2PA 4CVTA 5CMRA 3E6SA 3Q4RA 5HU6D 2IU2A 2V2OA 3GGZA 3UFBA 2Z5QA 1H96A 4KVSA 3PVYB 3F37A 2V2IA 3EGMA 3OJ5A 5LS9A 4P18A 1UMNA 3AK9A 3FRRA 3GGYA 4RC5A 1JKVA 3BVLA 1YUZA 4DYXA 4U3GA 1ZUJA 3BKNA 1JIGA 4ITTA 4PG1A 1RCGA 3GHQA 5JKLA 3NOZX 4YXMA 5D8YA 4QUWA 5FEJA 3E6RA 2V8UA 4ISMA 5HJFA 3O7RA 2XJMA 3PVRB 4EVEA 1BFRA 1XZ3A 3SH6A 3PW8A 5ERKA 3V3KB 2Y3QA 4EVDA 3GE4A 3QZ3A 2XGWA 3AF7X 5D8QA 3ES3A 3FRSA 3VNXA 3PWQC 5JACA 4CYBA 1DVBA 2JD80 1B71A 2WLUA 2FHAA 2QQYA 3R2MA 4KVQA 4Z3BA 3KA6A 1NNQA 3FVBA 4TOHA 4ZMCA 4AM2A 4TOBA
chains in the Genus database with same CATH topology
4CMYA 4MJYA 5K52A 3M6JA 2GS4A 4TO9A 4CVRA 3KA3A 5LG2A 3Q4QA 2OH3A 2C41A 3WVWA 3BVEA 3R2HA 2IY4A 3BT5A 4A25A 4ZKWA 4W4LB 5HJHA 3BVKA 3AJPA 2OKCA 3F34A 2V8TA 2VXIA 2ZG8X 3FSEA 4X0JA 5D8XA 2XJNA 4Z5SA 3F39A 1Z6OM 4LQJA 1BG7A 2V15A 4AM4A 3C1ZA 4XGSA 5D8PA 4RC8A 4MKUA 4WJG4 2HR5A 3WNWA 3PWQA 2FL0A 5D8SA 1DPSA 4IXKA 2C2UA 2BJYA 3DBYA 3E1MA 3GVYA 3IS8A 4E40A 5E2DA 2CHPA 4PGIA 4IWKA 5JKMG 2ZA8A 4REUA 4TW3A 3IS7A 4DYYA 4M32A 4LQNA 4LYXA 3PW1B 4II4A 3R2LA 1IESA 1RCDA 2YJKA 3E1PA 4TODA 4YXJA 3TA8A 3KDQA 3KHKA 5D8RA 1JKUA 3QHBA 1F33A 1VEIA 2QF9A 2OC5A 3ISEA 3A9QA 1VJXA 2CHIA 3R2RA 1ZS3A 4TOFA 5J93A 1TJOA 4M34A 2Z90A 5ERJA 2FFXJ 2BK6A 3SHXA 2ZA6A 2Y44A 5LG8A 2W0OA 2C2FA 5GU2X 3H7GA 4RC7A 4EVBA 2V2SA 5FFDA 2Z5RA 3C1YA 1S3QA 1JYBA 4CYAA 2WWXB 4RC6A 5AXSA 1LKOA 4CVSA 3AJQA 1L8HA 2WTLA 4TOGA 3E2CA 3VVAA 2CEIA 5K53A 2V2RA 1VELA 4M33A 4XKUA 3N6OA 2WLAA 2CN7A 2C2JA 4LQHA 5GU1X 4MY7A 1JREA 2V2NA 3UOFA 2YW7A 1XZ1A 3FI6A 4AM5A 3PVYA 3IQ1A 1EUMA 1BCFA 5JDOB 3PZAA 2AR0A 2VXXA 2C6RA 3KA9A 3QD8A 2G4HA 1DATA 1R03A 4LYUA 3U90A 1TKOA 3E1JA 2GYDA 4ERUA 3EZ0A 3D19A 2Z5PA 1AEWA 1RYTA 3E1QA 1VEQA 3PVRA 3C21A 4LQVA 3ISFA 1RCIA 4TOAA 4IWJA 2XJOA 1HRSA 3BVIA 2CN6A 3RGDA 4OYNA 3LKDA 4DYZA 1QYBA 2MGYA 1FHAA 4ZKXA 4MUDA 4ZTTA 1S30A 2ZURX 3QVDA 3KXUA 4R42A 2X170 1MOJA 2GYQA 3Q4OA 4ITWA 4RC5B 5JKLG 3KWOA 3UOIA 3Q4NA 5D8OA 2V2JA 3RBCA 2CLUA 1LKPA 3F35A 2RBDA 3HL1A 3OGHA 1OTKA 1RCEA 4RC7B 4CMYV 5GN8A 3T9JA 5CZUA 4DE6A 3KA8A 3AJOA 4RC6B 4EVCA 2CWLA 3SIDA 4ML5A 1O9IA 1VLGA 2ZG9X 5HQOA 1O9RA 3WVVA 3E1NA 5E1UA 4MN9A 3HIUA 3WVUA 3L0MA 4KVRA 3AF9X 2IB0A 3UNOA 1KRQA 4XKSA 2VZBA 1NF4A 1RCCA 2ZA7A 4TOCA 2G38B 1S2ZA 1IERA 1LKMA 1SQ3A 4PGKA 3EZUA 3E1OA 1Z4AA 1F30A 1LB3A 2JD70 3AK8A 3W54A 1JGCA 5JKMA 3PW1A 2JD60 2HTNA 3RAVA 3VV9A 3PVTA 5IX6A 1SOFA 4XKTA 3ERZA 4LPMA 2V2LA 3BVFA 1MFRA 1JTSA 5I4JA 4ZKHA 4YKHA 2YW6A 5J9VA 4TOEA 4PG0A 3MPSA 5FFEA 4ZL6A 1UVHA 4ZL5A 5CMQA 2CIHA 3SE1A 5GU0X 1Z6OA 3E1LA 5FFAA 2D5KA 3QHCA 4ZLWA 4II4B 3R2SA 2F7NA 4M35A 4YVZA 1YUXA 3F38A 1J30A 2YJJA 2FJCA 2V2MA 2ZG7X 1QGHA 2FKZA 3F32A 5GN8B 3JZ9A 2ITBA 3C23A 5FFCA 4KXRB 4MXPA 1NFVA 3KA4A 4W4KB 3A68A 3R2KA 1NF6A 5J8SA 3AF8X 3JZAB 3O7SA 5LBHA 1JI5A 3F36A 4CVPA 4DI0A 5FFBA 3RE7A 2PYBA 5GU3X 2CF7A 2UX1A 2FG8A 2BKCA 4Y08A 4LPNA 3F33A 1JI4A 4LPJA 3RD0A 2Z6MA 3NP0X 4DASA 2N02A 3PWFA 5JDOA 4DYUA 4ISPA 5GOUA 5C6FA 3NP2X 1TKPA 1GWGA 2FZFA 1YV1A 1N1QA 3PW8C 3R2OA 2XKQA 3KX9A 2BW1A 4CY9A 5J8WA 4DZ0A 3QB9A 2CLBA 4E6KA 2FG4A 1TK6A 4ETRA 3PVTB 4ZJKA 1L8IA 2V2PA 4CVTA 5CMRA 3E6SA 3Q4RA 5HU6D 2IU2A 2V2OA 3GGZA 3UFBA 2Z5QA 1H96A 4KVSA 3PVYB 3F37A 2V2IA 3EGMA 3OJ5A 5LS9A 4P18A 1UMNA 3AK9A 3FRRA 3GGYA 4RC5A 1JKVA 3BVLA 1YUZA 4DYXA 4U3GA 1ZUJA 3BKNA 1JIGA 4ITTA 4PG1A 1RCGA 3GHQA 5JKLA 3NOZX 4YXMA 5D8YA 4QUWA 5FEJA 3E6RA 2V8UA 4ISMA 5HJFA 3O7RA 2XJMA 3PVRB 4EVEA 1BFRA 1XZ3A 3SH6A 3PW8A 5ERKA 3V3KB 2Y3QA 4EVDA 3GE4A 3QZ3A 2XGWA 3AF7X 5D8QA 3ES3A 3FRSA 3VNXA 3PWQC 5JACA 4CYBA 1DVBA 2JD80 1B71A 2WLUA 2FHAA 2QQYA 3R2MA 4KVQA 4Z3BA 3KA6A 1NNQA 3FVBA 4TOHA 4ZMCA 4AM2A 4TOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CMY A;  4MJY A;  5K52 A;  2GS4 A;  4TO9 A;  4CVR A;  3KA3 A;  5LG2 A;  3Q4Q A;  2OH3 A;  2C41 A;  3WVW A;  3BVE A;  3R2H A;  2IY4 A;  3BT5 A;  4A25 A;  4ZKW A;  5HJH A;  3BVK A;  3AJP A;  3F34 A;  2VXI A;  2ZG8 X;  3FSE A;  5D8X A;  2XJN A;  4Z5S A;  3F39 A;  1Z6O M;  4LQJ A;  1BG7 A;  2V15 A;  4AM4 A;  4XGS A;  5D8P A;  4RC8 A;  4MKU A;  2HR5 A;  3WNW A;  3PWQ A;  2FL0 A;  5D8S A;  1DPS A;  4IXK A;  2C2U A;  2BJY A;  3E1M A;  3GVY A;  3IS8 A;  5E2D A;  2CHP A;  4PGI A;  4IWK A;  5JKM G;  2ZA8 A;  4REU A;  4TW3 A;  3IS7 A;  4DYY A;  4M32 A;  4LQN A;  4LYX A;  3PW1 B;  4II4 A;  3R2L A;  1IES A;  1RCD A;  2YJK A;  3E1P A;  4TOD A;  3TA8 A;  5D8R A;  1JKU A;  3QHB A;  1F33 A;  1VEI A;  2QF9 A;  2OC5 A;  3ISE A;  3A9Q A;  1VJX A;  2CHI A;  3R2R A;  1ZS3 A;  4TOF A;  5J93 A;  1TJO A;  4M34 A;  2Z90 A;  5ERJ A;  2FFX J;  2BK6 A;  3SHX A;  2ZA6 A;  5LG8 A;  2W0O A;  2C2F A;  5GU2 X;  3H7G A;  4RC7 A;  4EVB A;  2V2S A;  5FFD A;  2Z5R A;  1S3Q A;  1JYB A;  4CYA A;  4RC6 A;  5AXS A;  1LKO A;  4CVS A;  3AJQ A;  1L8H A;  2WTL A;  4TOG A;  3E2C A;  2CEI A;  5K53 A;  2V2R A;  1VEL A;  4M33 A;  4XKU A;  2WLA A;  2CN7 A;  2C2J A;  4LQH A;  5GU1 X;  4MY7 A;  1JRE A;  2V2N A;  3UOF A;  2YW7 A;  1XZ1 A;  3FI6 A;  4AM5 A;  3PVY A;  3IQ1 A;  1EUM A;  1BCF A;  3PZA A;  2VXX A;  2C6R A;  3KA9 A;  3QD8 A;  2G4H A;  1DAT A;  1R03 A;  4LYU A;  3U90 A;  1TKO A;  3E1J A;  2GYD A;  4ERU A;  3EZ0 A;  2Z5P A;  1AEW A;  1RYT A;  3E1Q A;  1VEQ A;  3PVR A;  4LQV A;  3ISF A;  1RCI A;  4TOA A;  4IWJ A;  2XJO A;  1HRS A;  3BVI A;  2CN6 A;  3RGD A;  4OYN A;  4DYZ A;  1QYB A;  1FHA A;  4ZKX A;  4MUD A;  4ZTT A;  1S30 A;  2ZUR X;  3QVD A;  3KXU A;  4R42 A;  2X17 0;  1MOJ A;  2GYQ A;  3Q4O A;  4ITW A;  4RC5 B;  5JKL G;  3KWO A;  3UOI A;  3Q4N A;  5D8O A;  2V2J A;  3RBC A;  2CLU A;  1LKP A;  3F35 A;  2RBD A;  3HL1 A;  3OGH A;  1OTK A;  1RCE A;  4RC7 B;  4CMY V;  5GN8 A;  3T9J A;  5CZU A;  4DE6 A;  3KA8 A;  3AJO A;  4RC6 B;  4EVC A;  3SID A;  4ML5 A;  1O9I A;  1VLG A;  2ZG9 X;  5HQO A;  1O9R A;  3WVV A;  3E1N A;  5E1U A;  4MN9 A;  3HIU A;  3WVU A;  4KVR A;  3AF9 X;  2IB0 A;  3UNO A;  1KRQ A;  4XKS A;  2VZB A;  1NF4 A;  1RCC A;  2ZA7 A;  4TOC A;  1S2Z A;  1IER A;  1LKM A;  1SQ3 A;  4PGK A;  3EZU A;  3E1O A;  1Z4A A;  1F30 A;  1LB3 A;  2JD7 0;  3AK8 A;  1JGC A;  5JKM A;  3PW1 A;  2JD6 0;  2HTN A;  3RAV A;  3PVT A;  5IX6 A;  1SOF A;  4XKT A;  3ERZ A;  4LPM A;  2V2L A;  3BVF A;  1MFR A;  1JTS A;  5I4J A;  4ZKH A;  4YKH A;  2YW6 A;  5J9V A;  4TOE A;  4PG0 A;  3MPS A;  5FFE A;  4ZL6 A;  1UVH A;  4ZL5 A;  5CMQ A;  2CIH A;  3SE1 A;  5GU0 X;  1Z6O A;  3E1L A;  5FFA A;  2D5K A;  3QHC A;  4ZLW A;  4II4 B;  3R2S A;  2F7N A;  4M35 A;  1YUX A;  3F38 A;  1J30 A;  2YJJ A;  2FJC A;  2V2M A;  2ZG7 X;  1QGH A;  2FKZ A;  3F32 A;  5GN8 B;  2ITB A;  5FFC A;  1NFV A;  3KA4 A;  3A68 A;  3R2K A;  1NF6 A;  5J8S A;  3AF8 X;  3O7S A;  5LBH A;  1JI5 A;  3F36 A;  4CVP A;  4DI0 A;  5FFB A;  3RE7 A;  2PYB A;  5GU3 X;  2CF7 A;  2UX1 A;  2FG8 A;  2BKC A;  4Y08 A;  4LPN A;  3F33 A;  1JI4 A;  4LPJ A;  3RD0 A;  2Z6M A;  3NP0 X;  4DAS A;  3PWF A;  4DYU A;  4ISP A;  5GOU A;  5C6F A;  3NP2 X;  1TKP A;  1GWG A;  2FZF A;  1YV1 A;  1N1Q A;  3PW8 C;  3R2O A;  2XKQ A;  3KX9 A;  2BW1 A;  4CY9 A;  5J8W A;  4DZ0 A;  3QB9 A;  2CLB A;  4E6K A;  2FG4 A;  1TK6 A;  4ETR A;  3PVT B;  4ZJK A;  1L8I A;  2V2P A;  4CVT A;  5CMR A;  3E6S A;  3Q4R A;  2IU2 A;  2V2O A;  2Z5Q A;  1H96 A;  4KVS A;  3PVY B;  3F37 A;  2V2I A;  3EGM A;  3OJ5 A;  5LS9 A;  4P18 A;  1UMN A;  3AK9 A;  4RC5 A;  1JKV A;  3BVL A;  1YUZ A;  4DYX A;  4U3G A;  1ZUJ A;  3BKN A;  1JIG A;  4ITT A;  4PG1 A;  1RCG A;  3GHQ A;  5JKL A;  3NOZ X;  5D8Y A;  4QUW A;  5FEJ A;  3E6R A;  5HJF A;  4ISM A;  3O7R A;  2XJM A;  3PVR B;  4EVE A;  1BFR A;  1XZ3 A;  3SH6 A;  3PW8 A;  5ERK A;  2Y3Q A;  4EVD A;  3GE4 A;  3QZ3 A;  2XGW A;  3AF7 X;  5D8Q A;  3ES3 A;  3VNX A;  3PWQ C;  5JAC A;  4CYB A;  1DVB A;  2JD8 0;  1B71 A;  2WLU A;  2FHA A;  2QQY A;  3R2M A;  4KVQ A;  4Z3B A;  3KA6 A;  1NNQ A;  3FVB A;  4TOH A;  4ZMC A;  4AM2 A;  4TOB A; 
#chains in the Genus database with same CATH topology
 4CMY A;  4MJY A;  5K52 A;  3M6J A;  2GS4 A;  4TO9 A;  4CVR A;  3KA3 A;  5LG2 A;  3Q4Q A;  2OH3 A;  2C41 A;  3WVW A;  3BVE A;  3R2H A;  2IY4 A;  3BT5 A;  4A25 A;  4ZKW A;  4W4L B;  5HJH A;  3BVK A;  3AJP A;  2OKC A;  3F34 A;  2V8T A;  2VXI A;  2ZG8 X;  3FSE A;  4X0J A;  5D8X A;  2XJN A;  4Z5S A;  3F39 A;  1Z6O M;  4LQJ A;  1BG7 A;  2V15 A;  4AM4 A;  3C1Z A;  4XGS A;  5D8P A;  4RC8 A;  4MKU A;  4WJG 4;  2HR5 A;  3WNW A;  3PWQ A;  2FL0 A;  5D8S A;  1DPS A;  4IXK A;  2C2U A;  2BJY A;  3DBY A;  3E1M A;  3GVY A;  3IS8 A;  4E40 A;  5E2D A;  2CHP A;  4PGI A;  4IWK A;  5JKM G;  2ZA8 A;  4REU A;  4TW3 A;  3IS7 A;  4DYY A;  4M32 A;  4LQN A;  4LYX A;  3PW1 B;  4II4 A;  3R2L A;  1IES A;  1RCD A;  2YJK A;  3E1P A;  4TOD A;  4YXJ A;  3TA8 A;  3KDQ A;  3KHK A;  5D8R A;  1JKU A;  3QHB A;  1F33 A;  1VEI A;  2QF9 A;  2OC5 A;  3ISE A;  3A9Q A;  1VJX A;  2CHI A;  3R2R A;  1ZS3 A;  4TOF A;  5J93 A;  1TJO A;  4M34 A;  2Z90 A;  5ERJ A;  2FFX J;  2BK6 A;  3SHX A;  2ZA6 A;  2Y44 A;  5LG8 A;  2W0O A;  2C2F A;  5GU2 X;  3H7G A;  4RC7 A;  4EVB A;  2V2S A;  5FFD A;  2Z5R A;  3C1Y A;  1S3Q A;  1JYB A;  4CYA A;  2WWX B;  4RC6 A;  5AXS A;  1LKO A;  4CVS A;  3AJQ A;  1L8H A;  2WTL A;  4TOG A;  3E2C A;  3VVA A;  2CEI A;  5K53 A;  2V2R A;  1VEL A;  4M33 A;  4XKU A;  3N6O A;  2WLA A;  2CN7 A;  2C2J A;  4LQH A;  5GU1 X;  4MY7 A;  1JRE A;  2V2N A;  3UOF A;  2YW7 A;  1XZ1 A;  3FI6 A;  4AM5 A;  3PVY A;  3IQ1 A;  1EUM A;  1BCF A;  5JDO B;  3PZA A;  2AR0 A;  2VXX A;  2C6R A;  3KA9 A;  3QD8 A;  2G4H A;  1DAT A;  1R03 A;  4LYU A;  3U90 A;  1TKO A;  3E1J A;  2GYD A;  4ERU A;  3EZ0 A;  3D19 A;  2Z5P A;  1AEW A;  1RYT A;  3E1Q A;  1VEQ A;  3PVR A;  3C21 A;  4LQV A;  3ISF A;  1RCI A;  4TOA A;  4IWJ A;  2XJO A;  1HRS A;  3BVI A;  2CN6 A;  3RGD A;  4OYN A;  3LKD A;  4DYZ A;  1QYB A;  2MGY A;  1FHA A;  4ZKX A;  4MUD A;  4ZTT A;  1S30 A;  2ZUR X;  3QVD A;  3KXU A;  4R42 A;  2X17 0;  1MOJ A;  2GYQ A;  3Q4O A;  4ITW A;  4RC5 B;  5JKL G;  3KWO A;  3UOI A;  3Q4N A;  5D8O A;  2V2J A;  3RBC A;  2CLU A;  1LKP A;  3F35 A;  2RBD A;  3HL1 A;  3OGH A;  1OTK A;  1RCE A;  4RC7 B;  4CMY V;  5GN8 A;  3T9J A;  5CZU A;  4DE6 A;  3KA8 A;  3AJO A;  4RC6 B;  4EVC A;  2CWL A;  3SID A;  4ML5 A;  1O9I A;  1VLG A;  2ZG9 X;  5HQO A;  1O9R A;  3WVV A;  3E1N A;  5E1U A;  4MN9 A;  3HIU A;  3WVU A;  3L0M A;  4KVR A;  3AF9 X;  2IB0 A;  3UNO A;  1KRQ A;  4XKS A;  2VZB A;  1NF4 A;  1RCC A;  2ZA7 A;  4TOC A;  2G38 B;  1S2Z A;  1IER A;  1LKM A;  1SQ3 A;  4PGK A;  3EZU A;  3E1O A;  1Z4A A;  1F30 A;  1LB3 A;  2JD7 0;  3AK8 A;  3W54 A;  1JGC A;  5JKM A;  3PW1 A;  2JD6 0;  2HTN A;  3RAV A;  3VV9 A;  3PVT A;  5IX6 A;  1SOF A;  4XKT A;  3ERZ A;  4LPM A;  2V2L A;  3BVF A;  1MFR A;  1JTS A;  5I4J A;  4ZKH A;  4YKH A;  2YW6 A;  5J9V A;  4TOE A;  4PG0 A;  3MPS A;  5FFE A;  4ZL6 A;  1UVH A;  4ZL5 A;  5CMQ A;  2CIH A;  3SE1 A;  5GU0 X;  1Z6O A;  3E1L A;  5FFA A;  2D5K A;  3QHC A;  4ZLW A;  4II4 B;  3R2S A;  2F7N A;  4M35 A;  4YVZ A;  1YUX A;  3F38 A;  1J30 A;  2YJJ A;  2FJC A;  2V2M A;  2ZG7 X;  1QGH A;  2FKZ A;  3F32 A;  5GN8 B;  3JZ9 A;  2ITB A;  3C23 A;  5FFC A;  4KXR B;  4MXP A;  1NFV A;  3KA4 A;  4W4K B;  3A68 A;  3R2K A;  1NF6 A;  5J8S A;  3AF8 X;  3JZA B;  3O7S A;  5LBH A;  1JI5 A;  3F36 A;  4CVP A;  4DI0 A;  5FFB A;  3RE7 A;  2PYB A;  5GU3 X;  2CF7 A;  2UX1 A;  2FG8 A;  2BKC A;  4Y08 A;  4LPN A;  3F33 A;  1JI4 A;  4LPJ A;  3RD0 A;  2Z6M A;  3NP0 X;  4DAS A;  2N02 A;  3PWF A;  5JDO A;  4DYU A;  4ISP A;  5GOU A;  5C6F A;  3NP2 X;  1TKP A;  1GWG A;  2FZF A;  1YV1 A;  1N1Q A;  3PW8 C;  3R2O A;  2XKQ A;  3KX9 A;  2BW1 A;  4CY9 A;  5J8W A;  4DZ0 A;  3QB9 A;  2CLB A;  4E6K A;  2FG4 A;  1TK6 A;  4ETR A;  3PVT B;  4ZJK A;  1L8I A;  2V2P A;  4CVT A;  5CMR A;  3E6S A;  3Q4R A;  5HU6 D;  2IU2 A;  2V2O A;  3GGZ A;  3UFB A;  2Z5Q A;  1H96 A;  4KVS A;  3PVY B;  3F37 A;  2V2I A;  3EGM A;  3OJ5 A;  5LS9 A;  4P18 A;  1UMN A;  3AK9 A;  3FRR A;  3GGY A;  4RC5 A;  1JKV A;  3BVL A;  1YUZ A;  4DYX A;  4U3G A;  1ZUJ A;  3BKN A;  1JIG A;  4ITT A;  4PG1 A;  1RCG A;  3GHQ A;  5JKL A;  3NOZ X;  4YXM A;  5D8Y A;  4QUW A;  5FEJ A;  3E6R A;  2V8U A;  4ISM A;  5HJF A;  3O7R A;  2XJM A;  3PVR B;  4EVE A;  1BFR A;  1XZ3 A;  3SH6 A;  3PW8 A;  5ERK A;  3V3K B;  2Y3Q A;  4EVD A;  3GE4 A;  3QZ3 A;  2XGW A;  3AF7 X;  5D8Q A;  3ES3 A;  3FRS A;  3VNX A;  3PWQ C;  5JAC A;  4CYB A;  1DVB A;  2JD8 0;  1B71 A;  2WLU A;  2FHA A;  2QQY A;  3R2M A;  4KVQ A;  4Z3B A;  3KA6 A;  1NNQ A;  3FVB A;  4TOH A;  4ZMC A;  4AM2 A;  4TOB A; 
#chains in the Genus database with same CATH homology
 4CMY A;  4MJY A;  5K52 A;  3M6J A;  2GS4 A;  4TO9 A;  4CVR A;  3KA3 A;  5LG2 A;  3Q4Q A;  2OH3 A;  2C41 A;  3WVW A;  3BVE A;  3R2H A;  2IY4 A;  3BT5 A;  4A25 A;  4ZKW A;  4W4L B;  5HJH A;  3BVK A;  3AJP A;  2OKC A;  3F34 A;  2V8T A;  2VXI A;  2ZG8 X;  3FSE A;  4X0J A;  5D8X A;  2XJN A;  4Z5S A;  3F39 A;  1Z6O M;  4LQJ A;  1BG7 A;  2V15 A;  4AM4 A;  3C1Z A;  4XGS A;  5D8P A;  4RC8 A;  4MKU A;  4WJG 4;  2HR5 A;  3WNW A;  3PWQ A;  2FL0 A;  5D8S A;  1DPS A;  4IXK A;  2C2U A;  2BJY A;  3DBY A;  3E1M A;  3GVY A;  3IS8 A;  4E40 A;  5E2D A;  2CHP A;  4PGI A;  4IWK A;  5JKM G;  2ZA8 A;  4REU A;  4TW3 A;  3IS7 A;  4DYY A;  4M32 A;  4LQN A;  4LYX A;  3PW1 B;  4II4 A;  3R2L A;  1IES A;  1RCD A;  2YJK A;  3E1P A;  4TOD A;  4YXJ A;  3TA8 A;  3KDQ A;  3KHK A;  5D8R A;  1JKU A;  3QHB A;  1F33 A;  1VEI A;  2QF9 A;  2OC5 A;  3ISE A;  3A9Q A;  1VJX A;  2CHI A;  3R2R A;  1ZS3 A;  4TOF A;  5J93 A;  1TJO A;  4M34 A;  2Z90 A;  5ERJ A;  2FFX J;  2BK6 A;  3SHX A;  2ZA6 A;  2Y44 A;  5LG8 A;  2W0O A;  2C2F A;  5GU2 X;  3H7G A;  4RC7 A;  4EVB A;  2V2S A;  5FFD A;  2Z5R A;  3C1Y A;  1S3Q A;  1JYB A;  4CYA A;  2WWX B;  4RC6 A;  5AXS A;  1LKO A;  4CVS A;  3AJQ A;  1L8H A;  2WTL A;  4TOG A;  3E2C A;  3VVA A;  2CEI A;  5K53 A;  2V2R A;  1VEL A;  4M33 A;  4XKU A;  3N6O A;  2WLA A;  2CN7 A;  2C2J A;  4LQH A;  5GU1 X;  4MY7 A;  1JRE A;  2V2N A;  3UOF A;  2YW7 A;  1XZ1 A;  3FI6 A;  4AM5 A;  3PVY A;  3IQ1 A;  1EUM A;  1BCF A;  5JDO B;  3PZA A;  2AR0 A;  2VXX A;  2C6R A;  3KA9 A;  3QD8 A;  2G4H A;  1DAT A;  1R03 A;  4LYU A;  3U90 A;  1TKO A;  3E1J A;  2GYD A;  4ERU A;  3EZ0 A;  3D19 A;  2Z5P A;  1AEW A;  1RYT A;  3E1Q A;  1VEQ A;  3PVR A;  3C21 A;  4LQV A;  3ISF A;  1RCI A;  4TOA A;  4IWJ A;  2XJO A;  1HRS A;  3BVI A;  2CN6 A;  3RGD A;  4OYN A;  3LKD A;  4DYZ A;  1QYB A;  2MGY A;  1FHA A;  4ZKX A;  4MUD A;  4ZTT A;  1S30 A;  2ZUR X;  3QVD A;  3KXU A;  4R42 A;  2X17 0;  1MOJ A;  2GYQ A;  3Q4O A;  4ITW A;  4RC5 B;  5JKL G;  3KWO A;  3UOI A;  3Q4N A;  5D8O A;  2V2J A;  3RBC A;  2CLU A;  1LKP A;  3F35 A;  2RBD A;  3HL1 A;  3OGH A;  1OTK A;  1RCE A;  4RC7 B;  4CMY V;  5GN8 A;  3T9J A;  5CZU A;  4DE6 A;  3KA8 A;  3AJO A;  4RC6 B;  4EVC A;  2CWL A;  3SID A;  4ML5 A;  1O9I A;  1VLG A;  2ZG9 X;  5HQO A;  1O9R A;  3WVV A;  3E1N A;  5E1U A;  4MN9 A;  3HIU A;  3WVU A;  3L0M A;  4KVR A;  3AF9 X;  2IB0 A;  3UNO A;  1KRQ A;  4XKS A;  2VZB A;  1NF4 A;  1RCC A;  2ZA7 A;  4TOC A;  2G38 B;  1S2Z A;  1IER A;  1LKM A;  1SQ3 A;  4PGK A;  3EZU A;  3E1O A;  1Z4A A;  1F30 A;  1LB3 A;  2JD7 0;  3AK8 A;  3W54 A;  1JGC A;  5JKM A;  3PW1 A;  2JD6 0;  2HTN A;  3RAV A;  3VV9 A;  3PVT A;  5IX6 A;  1SOF A;  4XKT A;  3ERZ A;  4LPM A;  2V2L A;  3BVF A;  1MFR A;  1JTS A;  5I4J A;  4ZKH A;  4YKH A;  2YW6 A;  5J9V A;  4TOE A;  4PG0 A;  3MPS A;  5FFE A;  4ZL6 A;  1UVH A;  4ZL5 A;  5CMQ A;  2CIH A;  3SE1 A;  5GU0 X;  1Z6O A;  3E1L A;  5FFA A;  2D5K A;  3QHC A;  4ZLW A;  4II4 B;  3R2S A;  2F7N A;  4M35 A;  4YVZ A;  1YUX A;  3F38 A;  1J30 A;  2YJJ A;  2FJC A;  2V2M A;  2ZG7 X;  1QGH A;  2FKZ A;  3F32 A;  5GN8 B;  3JZ9 A;  2ITB A;  3C23 A;  5FFC A;  4KXR B;  4MXP A;  1NFV A;  3KA4 A;  4W4K B;  3A68 A;  3R2K A;  1NF6 A;  5J8S A;  3AF8 X;  3JZA B;  3O7S A;  5LBH A;  1JI5 A;  3F36 A;  4CVP A;  4DI0 A;  5FFB A;  3RE7 A;  2PYB A;  5GU3 X;  2CF7 A;  2UX1 A;  2FG8 A;  2BKC A;  4Y08 A;  4LPN A;  3F33 A;  1JI4 A;  4LPJ A;  3RD0 A;  2Z6M A;  3NP0 X;  4DAS A;  2N02 A;  3PWF A;  5JDO A;  4DYU A;  4ISP A;  5GOU A;  5C6F A;  3NP2 X;  1TKP A;  1GWG A;  2FZF A;  1YV1 A;  1N1Q A;  3PW8 C;  3R2O A;  2XKQ A;  3KX9 A;  2BW1 A;  4CY9 A;  5J8W A;  4DZ0 A;  3QB9 A;  2CLB A;  4E6K A;  2FG4 A;  1TK6 A;  4ETR A;  3PVT B;  4ZJK A;  1L8I A;  2V2P A;  4CVT A;  5CMR A;  3E6S A;  3Q4R A;  5HU6 D;  2IU2 A;  2V2O A;  3GGZ A;  3UFB A;  2Z5Q A;  1H96 A;  4KVS A;  3PVY B;  3F37 A;  2V2I A;  3EGM A;  3OJ5 A;  5LS9 A;  4P18 A;  1UMN A;  3AK9 A;  3FRR A;  3GGY A;  4RC5 A;  1JKV A;  3BVL A;  1YUZ A;  4DYX A;  4U3G A;  1ZUJ A;  3BKN A;  1JIG A;  4ITT A;  4PG1 A;  1RCG A;  3GHQ A;  5JKL A;  3NOZ X;  4YXM A;  5D8Y A;  4QUW A;  5FEJ A;  3E6R A;  2V8U A;  4ISM A;  5HJF A;  3O7R A;  2XJM A;  3PVR B;  4EVE A;  1BFR A;  1XZ3 A;  3SH6 A;  3PW8 A;  5ERK A;  3V3K B;  2Y3Q A;  4EVD A;  3GE4 A;  3QZ3 A;  2XGW A;  3AF7 X;  5D8Q A;  3ES3 A;  3FRS A;  3VNX A;  3PWQ C;  5JAC A;  4CYB A;  1DVB A;  2JD8 0;  1B71 A;  2WLU A;  2FHA A;  2QQY A;  3R2M A;  4KVQ A;  4Z3B A;  3KA6 A;  1NNQ A;  3FVB A;  4TOH A;  4ZMC A;  4AM2 A;  4TOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...