1JTSA

Dna protection and binding by e. coli dps protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
155
structure length
155
Chain Sequence
NLLYTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAKDDDTADILTAASRDLDKFLWFIESNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title DNA Protection and Binding by E. Coli Dps Protein
rcsb
source organism Escherichia coli
total genus 65
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2001-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1jtsA00
4LQVA 3F38A 3PVRB 4ERUA 4ITTA 5LBHA 1H96A 1Z6OM 4XGSA 2C2FA 2F7NA 3PWQA 4M34A 3PW8C 1VJXA 2FG4A 2XGWA 3IS8A 3A68A 4M33A 2CN6A 3R2SA 3AF9X 3PVTA 2V2MA 4AM5A 1LB3A 1JI4A 1YV1A 3U90A 4MJYA 5GN8B 4CY9A 1Z4AA 4PGKA 3GVYA 2IY4A 4LQNA 2FHAA 3RAVA 3NP0X 5FEJA 2CF7A 3QB9A 4DYXA 2XKQA 4R42A 2FJCA 2V2LA 2XJOA 2WLAA 2WLUA 2CLUA 2BW1A 1ZUJA 2YW6A 4LQHA 1LKMA 5D8QA 1IESA 4MUDA 3PVYB 2ZG8X 1UVHA 4ZKHA 5FFBA 3IQ1A 1DPSA 3BVLA 3R2HA 3SE1A 5D8PA 5JKLG 3QD8A 1FHAA 1XZ3A 5K53A 1KRQA 4CVTA 2JD70 3RBCA 3F35A 2C2UA 3H7GA 3RGDA 2D5KA 3E1NA 4Y08A 3QHCA 3GHQA 1JREA 1B71A 3KA6A 1HRSA 4RC6A 2C41A 4LPMA 4DASA 4TO9A 3QZ3A 3IS7A 2CHPA 4TW3A 2ZG7X 5LS9A 3ES3A 4TOBA 3KA4A 3GE4A 3EZUA 4TODA 2V15A 2OH3A 5FFDA 5FFCA 5D8RA 3E1PA 1S3QA 3F33A 3PW1B 4DYUA 5E2DA 4ZL6A 3VNXA 3WVWA 4REUA 4RC5B 3E1LA 1QGHA 2V2IA 1BG7A 2CN7A 5D8SA 3PVRA 5LG2A 2VZBA 2ZA8A 5D8OA 5I4JA 4M32A 5J9VA 4ZMCA 5CMQA 5J8SA 2HR5A 4Z5SA 2CIHA 1S2ZA 1JGCA 4ZKXA 1OTKA 5GU3X 5FFAA 1ZS3A 3OGHA 3BVIA 5JACA 3PWFA 1QYBA 5J93A 1GWGA 4PG0A 1L8HA 4XKTA 1JIGA 1O9RA 2CHIA 3R2KA 2Z5RA 1F33A 4KVRA 5GN8A 3O7RA 2ITBA 2GYDA 3ERZA 3A9QA 3EZ0A 2YJJA 3FVBA 4P18A 2ZA6A 1NF6A 4AM2A 1VEIA 1SQ3A 2PYBA 3T9JA 4DYYA 3KA3A 4CVRA 3BVEA 3E1QA 1TJOA 3KA8A 4II4A 1IERA 2V2SA 2Y3QA 3KA9A 5C6FA 4EVDA 3UOFA 3PVYA 4CMYV 4YKHA 1JYBA 2HTNA 3F37A 2YJKA 5CMRA 3E1MA 4ISPA 4A25A 2VXIA 4DYZA 4DZ0A 4MKUA 4TOHA 5CZUA 1TK6A 2V2RA 2W0OA 2C2JA 3AK8A 4KVQA 3NP2X 1TKPA 2V2OA 4EVCA 1O9IA 2BK6A 1JI5A 2WTLA 1R03A 4PGIA 2IU2A 3AJPA 3QVDA 2FG8A 3KX9A 4RC8A 4IWKA 3HIUA 5GU1X 3KXUA 4RC7B 4RC6B 1N1QA 2OC5A 4EVBA 1XZ1A 3E1JA 4ZLWA 2XJNA 1RYTA 5FFEA 4LQJA 1EUMA 1DVBA 1MFRA 4Z3BA 4XKUA 1RCDA 5JKMA 5GU2X 3R2LA 3SIDA 3PZAA 1TKOA 4OYNA 1BFRA 2Z90A 4ZJKA 4TOFA 5JKLA 5ERKA 1SOFA 4TOGA 3AK9A 1RCGA 4ZKWA 3PW1A 2RBDA 4MN9A 2BKCA 4LPJA 3E6RA 4RC5A 3Q4OA 5E1UA 3Q4RA 3F39A 1LKPA 4TOAA 1NNQA 4LPNA 5D8YA 1JTSA 3EGMA 4U3GA 2FFXJ 1BCFA 1J30A 2BJYA 3E2CA 3F34A 3BT5A 3SH6A 4CYAA 2ZURX 3OJ5A 2CLBA 5HJFA 3AF8X 2CEIA 4E6KA 3PVTB 3BVKA 1MOJA 1RCIA 1F30A 3QHBA 3UNOA 3AJOA 3RD0A 2X170 5HJHA 3KWOA 2ZA7A 2QF9A 1DATA 2YW7A 2JD60 3BKNA 4IWJA 5LG8A 3R2MA 3R2RA 3AJQA 3E1OA 3ISEA 4MY7A 1L8IA 2VXXA 3PWQC 3HL1A 4AM4A 5GU0X 2V2NA 4EVEA 1RCCA 4CVPA 4CMYA 4IXKA 1JKUA 4II4B 2V2JA 4ISMA 5JKMG 3WNWA 4TOEA 4LYXA 2FZFA 2IB0A 4CYBA 3FI6A 5K52A 5AXSA 4CVSA 2FKZA 1VLGA 4DE6A 1NFVA 5GOUA 2C6RA 4ZL5A 5ERJA 4ZTTA 2Z5PA 3NOZX 4QUWA 1YUZA 3FSEA 4XKSA 1VELA 2JD80 3F36A 4LYUA 1RCEA 4ETRA 3RE7A 3SHXA 1Z6OA 4PG1A 3WVUA 3R2OA 3BVFA 4RC7A 4KVSA 1LKOA 1YUXA 3WVVA 3E6SA 5IX6A 3TA8A 2ZG9X 3ISFA 4ML5A 3UOIA 2Z5QA 5HQOA 4TOCA 3F32A 3MPSA 1AEWA 1S30A 3AF7X 1VEQA 2FL0A 1JKVA 2GYQA 2G4HA 4M35A 2GS4A 3Q4NA 3PW8A 3O7SA 5D8XA 4ITWA 1UMNA 2Z6MA 4DI0A 2XJMA 2QQYA 3Q4QA 2UX1A 5J8WA 2V2PA 1NF4A
chains in the Genus database with same CATH superfamily
4LQVA 3F38A 3PVRB 4ERUA 3VVAA 4ITTA 5LBHA 1H96A 1Z6OM 4XGSA 2C2FA 2F7NA 3PWQA 4M34A 3PW8C 1VJXA 2FG4A 2XGWA 3IS8A 3A68A 4M33A 2CN6A 3R2SA 3AF9X 3PVTA 2V2MA 3KDQA 4AM5A 1LB3A 1JI4A 1YV1A 2WWXB 4MJYA 5GN8B 3U90A 4CY9A 1Z4AA 4PGKA 3GVYA 2IY4A 4LQNA 2FHAA 3RAVA 3NP0X 5FEJA 2CF7A 3QB9A 4DYXA 2XKQA 4R42A 2FJCA 2V2LA 2XJOA 2WLAA 2WLUA 2CLUA 2BW1A 1ZUJA 2YW6A 4LQHA 1LKMA 5D8QA 1IESA 4MUDA 3PVYB 2ZG8X 1UVHA 4ZKHA 5FFBA 3IQ1A 1DPSA 3BVLA 2Y44A 3R2HA 3SE1A 5D8PA 2MGYA 5JKLG 3QD8A 3UFBA 1FHAA 1XZ3A 5K53A 1KRQA 4CVTA 2JD70 3RBCA 3F35A 2C2UA 3H7GA 3RGDA 4X0JA 2D5KA 3E1NA 4Y08A 3QHCA 3GHQA 1JREA 1B71A 3KA6A 1HRSA 4RC6A 2C41A 3FRSA 4LPMA 4DASA 4TO9A 3QZ3A 3IS7A 2CHPA 4TW3A 2ZG7X 5LS9A 3ES3A 4TOBA 2CWLA 4W4KB 3KA4A 3GE4A 3EZUA 4TODA 2V15A 2OH3A 5FFDA 5FFCA 5D8RA 3E1PA 1S3QA 3F33A 4E40A 3PW1B 4DYUA 3KHKA 5E2DA 4ZL6A 3VNXA 3WVWA 4REUA 4RC5B 3E1LA 1QGHA 3W54A 2V2IA 1BG7A 2CN7A 5D8SA 2G38B 3PVRA 5LG2A 2VZBA 2ZA8A 5D8OA 3FRRA 2V8UA 5I4JA 4M32A 5J9VA 3GGZA 4ZMCA 3DBYA 5CMQA 5J8SA 2HR5A 4Z5SA 2CIHA 3LKDA 1S2ZA 1JGCA 4ZKXA 1OTKA 5GU3X 5FFAA 1ZS3A 3OGHA 3BVIA 5JACA 3PWFA 1QYBA 5J93A 1GWGA 4PG0A 1L8HA 4XKTA 1JIGA 1O9RA 2CHIA 3R2KA 2Z5RA 1F33A 4KVRA 5GN8A 3O7RA 4KXRB 2ITBA 2GYDA 3ERZA 3A9QA 3EZ0A 2YJJA 3FVBA 4P18A 2ZA6A 1NF6A 4AM2A 1VEIA 1SQ3A 2PYBA 3T9JA 4DYYA 3KA3A 4CVRA 3C23A 3BVEA 3E1QA 1TJOA 3KA8A 4II4A 1IERA 2V2SA 2Y3QA 3KA9A 5C6FA 4EVDA 3UOFA 3PVYA 4CMYV 4YKHA 1JYBA 2HTNA 3F37A 2YJKA 5CMRA 3E1MA 4ISPA 4A25A 2VXIA 4DYZA 4DZ0A 4MKUA 4TOHA 5CZUA 1TK6A 2V2RA 2W0OA 2C2JA 3AK8A 3C1ZA 4KVQA 3NP2X 1TKPA 2V2OA 4EVCA 1O9IA 4YXJA 2BK6A 1JI5A 2WTLA 1R03A 4PGIA 2IU2A 3AJPA 3QVDA 2FG8A 3KX9A 4RC8A 4IWKA 3HIUA 5GU1X 3KXUA 4YXMA 4RC7B 4RC6B 1N1QA 2OC5A 4EVBA 1XZ1A 3E1JA 3L0MA 4ZLWA 4W4LB 2XJNA 1RYTA 4MXPA 5FFEA 4LQJA 1EUMA 1DVBA 1MFRA 4Z3BA 4XKUA 1RCDA 5JKMA 5GU2X 5JDOA 3R2LA 3SIDA 3PZAA 1TKOA 4OYNA 1BFRA 2Z90A 4ZJKA 4TOFA 5JKLA 5ERKA 1SOFA 4TOGA 3AK9A 1RCGA 4ZKWA 3PW1A 2RBDA 4MN9A 2BKCA 4LPJA 3E6RA 4RC5A 3Q4OA 5E1UA 2V8TA 3Q4RA 3F39A 1LKPA 4TOAA 1NNQA 4LPNA 5D8YA 1JTSA 3EGMA 4U3GA 2FFXJ 1BCFA 1J30A 2BJYA 3JZAB 3E2CA 3F34A 3BT5A 3SH6A 3N6OA 4CYAA 2ZURX 3OJ5A 2CLBA 5HJFA 3AF8X 2CEIA 4E6KA 3PVTB 3C21A 3BVKA 3JZ9A 1MOJA 1RCIA 1F30A 3QHBA 3UNOA 3AJOA 3RD0A 2X170 5HJHA 3KWOA 2ZA7A 2QF9A 1DATA 2YW7A 2JD60 3BKNA 4IWJA 5LG8A 3R2MA 3R2RA 3AJQA 3E1OA 3ISEA 4MY7A 3VV9A 1L8IA 2VXXA 3PWQC 3HL1A 4AM4A 5GU0X 2V2NA 4EVEA 1RCCA 4CVPA 4CMYA 4IXKA 1JKUA 4II4B 2V2JA 4ISMA 5HU6D 2AR0A 5JKMG 3WNWA 4TOEA 4LYXA 2FZFA 2IB0A 4CYBA 3GGYA 3FI6A 5K52A 2N02A 5AXSA 4CVSA 2FKZA 1VLGA 4DE6A 1NFVA 3V3KB 5GOUA 2C6RA 4ZL5A 5ERJA 4ZTTA 2Z5PA 3NOZX 4QUWA 1YUZA 3FSEA 4XKSA 1VELA 2JD80 3F36A 4LYUA 1RCEA 4ETRA 3RE7A 3SHXA 1Z6OA 4PG1A 3WVUA 3R2OA 3BVFA 2OKCA 4RC7A 4KVSA 1LKOA 4WJG4 1YUXA 3WVVA 3D19A 3E6SA 5IX6A 4YVZA 3TA8A 2ZG9X 3ISFA 4ML5A 3UOIA 2Z5QA 5HQOA 4TOCA 3F32A 3MPSA 1AEWA 1S30A 5JDOB 3AF7X 3M6JA 1VEQA 2FL0A 1JKVA 2GYQA 2G4HA 4M35A 2GS4A 3Q4NA 3PW8A 3O7SA 3C1YA 5D8XA 4ITWA 1UMNA 2Z6MA 4DI0A 2XJMA 2QQYA 3Q4QA 2UX1A 5J8WA 2V2PA 1NF4A
chains in the Genus database with same CATH topology
4LQVA 3F38A 3PVRB 4ERUA 3VVAA 4ITTA 5LBHA 1H96A 1Z6OM 4XGSA 2C2FA 2F7NA 3PWQA 4M34A 3PW8C 1VJXA 2FG4A 2XGWA 3IS8A 3A68A 4M33A 2CN6A 3R2SA 3AF9X 3PVTA 2V2MA 3KDQA 4AM5A 1LB3A 1JI4A 1YV1A 2WWXB 4MJYA 5GN8B 3U90A 4CY9A 1Z4AA 4PGKA 3GVYA 2IY4A 4LQNA 2FHAA 3RAVA 3NP0X 5FEJA 2CF7A 3QB9A 4DYXA 2XKQA 4R42A 2FJCA 2V2LA 2XJOA 2WLAA 2WLUA 2CLUA 2BW1A 1ZUJA 2YW6A 4LQHA 1LKMA 5D8QA 1IESA 4MUDA 3PVYB 2ZG8X 1UVHA 4ZKHA 5FFBA 3IQ1A 1DPSA 3BVLA 2Y44A 3R2HA 3SE1A 5D8PA 2MGYA 5JKLG 3QD8A 3UFBA 1FHAA 1XZ3A 5K53A 1KRQA 4CVTA 2JD70 3RBCA 3F35A 2C2UA 3H7GA 3RGDA 4X0JA 2D5KA 3E1NA 4Y08A 3QHCA 3GHQA 1JREA 1B71A 3KA6A 1HRSA 4RC6A 2C41A 3FRSA 4LPMA 4DASA 4TO9A 3QZ3A 3IS7A 2CHPA 4TW3A 2ZG7X 5LS9A 3ES3A 4TOBA 2CWLA 4W4KB 3KA4A 3GE4A 3EZUA 4TODA 2V15A 2OH3A 5FFDA 5FFCA 5D8RA 3E1PA 1S3QA 3F33A 4E40A 3PW1B 4DYUA 3KHKA 5E2DA 4ZL6A 3VNXA 3WVWA 4REUA 4RC5B 3E1LA 1QGHA 3W54A 2V2IA 1BG7A 2CN7A 5D8SA 2G38B 3PVRA 5LG2A 2VZBA 2ZA8A 5D8OA 3FRRA 2V8UA 5I4JA 4M32A 5J9VA 3GGZA 4ZMCA 3DBYA 5CMQA 5J8SA 2HR5A 4Z5SA 2CIHA 3LKDA 1S2ZA 1JGCA 4ZKXA 1OTKA 5GU3X 5FFAA 1ZS3A 3OGHA 3BVIA 5JACA 3PWFA 1QYBA 5J93A 1GWGA 4PG0A 1L8HA 4XKTA 1JIGA 1O9RA 2CHIA 3R2KA 2Z5RA 1F33A 4KVRA 5GN8A 3O7RA 4KXRB 2ITBA 2GYDA 3ERZA 3A9QA 3EZ0A 2YJJA 3FVBA 4P18A 2ZA6A 1NF6A 4AM2A 1VEIA 1SQ3A 2PYBA 3T9JA 4DYYA 3KA3A 4CVRA 3C23A 3BVEA 3E1QA 1TJOA 3KA8A 4II4A 1IERA 2V2SA 2Y3QA 3KA9A 5C6FA 4EVDA 3UOFA 3PVYA 4CMYV 4YKHA 1JYBA 2HTNA 3F37A 2YJKA 5CMRA 3E1MA 4ISPA 4A25A 2VXIA 4DYZA 4DZ0A 4MKUA 4TOHA 5CZUA 1TK6A 2V2RA 2W0OA 2C2JA 3AK8A 3C1ZA 4KVQA 3NP2X 1TKPA 2V2OA 4EVCA 1O9IA 4YXJA 2BK6A 1JI5A 2WTLA 1R03A 4PGIA 2IU2A 3AJPA 3QVDA 2FG8A 3KX9A 4RC8A 4IWKA 3HIUA 5GU1X 3KXUA 4YXMA 4RC7B 4RC6B 1N1QA 2OC5A 4EVBA 1XZ1A 3E1JA 3L0MA 4ZLWA 4W4LB 2XJNA 1RYTA 4MXPA 5FFEA 4LQJA 1EUMA 1DVBA 1MFRA 4Z3BA 4XKUA 1RCDA 5JKMA 5GU2X 5JDOA 3R2LA 3SIDA 3PZAA 1TKOA 4OYNA 1BFRA 2Z90A 4ZJKA 4TOFA 5JKLA 5ERKA 1SOFA 4TOGA 3AK9A 1RCGA 4ZKWA 3PW1A 2RBDA 4MN9A 2BKCA 4LPJA 3E6RA 4RC5A 3Q4OA 5E1UA 2V8TA 3Q4RA 3F39A 1LKPA 4TOAA 1NNQA 4LPNA 5D8YA 1JTSA 3EGMA 4U3GA 2FFXJ 1BCFA 1J30A 2BJYA 3JZAB 3E2CA 3F34A 3BT5A 3SH6A 3N6OA 4CYAA 2ZURX 3OJ5A 2CLBA 5HJFA 3AF8X 2CEIA 4E6KA 3PVTB 3C21A 3BVKA 3JZ9A 1MOJA 1RCIA 1F30A 3QHBA 3UNOA 3AJOA 3RD0A 2X170 5HJHA 3KWOA 2ZA7A 2QF9A 1DATA 2YW7A 2JD60 3BKNA 4IWJA 5LG8A 3R2MA 3R2RA 3AJQA 3E1OA 3ISEA 4MY7A 3VV9A 1L8IA 2VXXA 3PWQC 3HL1A 4AM4A 5GU0X 2V2NA 4EVEA 1RCCA 4CVPA 4CMYA 4IXKA 1JKUA 4II4B 2V2JA 4ISMA 5HU6D 2AR0A 5JKMG 3WNWA 4TOEA 4LYXA 2FZFA 2IB0A 4CYBA 3GGYA 3FI6A 5K52A 2N02A 5AXSA 4CVSA 2FKZA 1VLGA 4DE6A 1NFVA 3V3KB 5GOUA 2C6RA 4ZL5A 5ERJA 4ZTTA 2Z5PA 3NOZX 4QUWA 1YUZA 3FSEA 4XKSA 1VELA 2JD80 3F36A 4LYUA 1RCEA 4ETRA 3RE7A 3SHXA 1Z6OA 4PG1A 3WVUA 3R2OA 3BVFA 2OKCA 4RC7A 4KVSA 1LKOA 4WJG4 1YUXA 3WVVA 3D19A 3E6SA 5IX6A 4YVZA 3TA8A 2ZG9X 3ISFA 4ML5A 3UOIA 2Z5QA 5HQOA 4TOCA 3F32A 3MPSA 1AEWA 1S30A 5JDOB 3AF7X 3M6JA 1VEQA 2FL0A 1JKVA 2GYQA 2G4HA 4M35A 2GS4A 3Q4NA 3PW8A 3O7SA 3C1YA 5D8XA 4ITWA 1UMNA 2Z6MA 4DI0A 2XJMA 2QQYA 3Q4QA 2UX1A 5J8WA 2V2PA 1NF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQV A;  3F38 A;  3PVR B;  4ERU A;  4ITT A;  5LBH A;  1H96 A;  1Z6O M;  4XGS A;  2C2F A;  2F7N A;  3PWQ A;  4M34 A;  3PW8 C;  1VJX A;  2FG4 A;  2XGW A;  3IS8 A;  3A68 A;  4M33 A;  2CN6 A;  3R2S A;  3AF9 X;  3PVT A;  2V2M A;  4AM5 A;  1LB3 A;  1JI4 A;  1YV1 A;  3U90 A;  4MJY A;  5GN8 B;  4CY9 A;  1Z4A A;  4PGK A;  3GVY A;  2IY4 A;  4LQN A;  2FHA A;  3RAV A;  3NP0 X;  5FEJ A;  2CF7 A;  3QB9 A;  4DYX A;  2XKQ A;  4R42 A;  2FJC A;  2V2L A;  2XJO A;  2WLA A;  2WLU A;  2CLU A;  2BW1 A;  1ZUJ A;  2YW6 A;  4LQH A;  1LKM A;  5D8Q A;  1IES A;  4MUD A;  3PVY B;  2ZG8 X;  1UVH A;  4ZKH A;  5FFB A;  3IQ1 A;  1DPS A;  3BVL A;  3R2H A;  3SE1 A;  5D8P A;  5JKL G;  3QD8 A;  1FHA A;  1XZ3 A;  5K53 A;  1KRQ A;  4CVT A;  2JD7 0;  3RBC A;  3F35 A;  2C2U A;  3H7G A;  3RGD A;  2D5K A;  3E1N A;  4Y08 A;  3QHC A;  3GHQ A;  1JRE A;  1B71 A;  3KA6 A;  1HRS A;  4RC6 A;  2C41 A;  4LPM A;  4DAS A;  4TO9 A;  3QZ3 A;  3IS7 A;  2CHP A;  4TW3 A;  2ZG7 X;  5LS9 A;  3ES3 A;  4TOB A;  3KA4 A;  3GE4 A;  3EZU A;  4TOD A;  2V15 A;  2OH3 A;  5FFD A;  5FFC A;  5D8R A;  3E1P A;  1S3Q A;  3F33 A;  3PW1 B;  4DYU A;  5E2D A;  4ZL6 A;  3VNX A;  3WVW A;  4REU A;  4RC5 B;  3E1L A;  1QGH A;  2V2I A;  1BG7 A;  2CN7 A;  5D8S A;  3PVR A;  5LG2 A;  2VZB A;  2ZA8 A;  5D8O A;  5I4J A;  4M32 A;  5J9V A;  4ZMC A;  5CMQ A;  5J8S A;  2HR5 A;  4Z5S A;  2CIH A;  1S2Z A;  1JGC A;  4ZKX A;  1OTK A;  5GU3 X;  5FFA A;  1ZS3 A;  3OGH A;  3BVI A;  5JAC A;  3PWF A;  1QYB A;  5J93 A;  1GWG A;  4PG0 A;  1L8H A;  4XKT A;  1JIG A;  1O9R A;  2CHI A;  3R2K A;  2Z5R A;  1F33 A;  4KVR A;  5GN8 A;  3O7R A;  2ITB A;  2GYD A;  3ERZ A;  3A9Q A;  3EZ0 A;  2YJJ A;  3FVB A;  4P18 A;  2ZA6 A;  1NF6 A;  4AM2 A;  1VEI A;  1SQ3 A;  2PYB A;  3T9J A;  4DYY A;  3KA3 A;  4CVR A;  3BVE A;  3E1Q A;  1TJO A;  3KA8 A;  4II4 A;  1IER A;  2V2S A;  2Y3Q A;  3KA9 A;  5C6F A;  4EVD A;  3UOF A;  3PVY A;  4CMY V;  4YKH A;  1JYB A;  2HTN A;  3F37 A;  2YJK A;  5CMR A;  3E1M A;  4ISP A;  4A25 A;  2VXI A;  4DYZ A;  4DZ0 A;  4MKU A;  4TOH A;  5CZU A;  1TK6 A;  2V2R A;  2W0O A;  2C2J A;  3AK8 A;  4KVQ A;  3NP2 X;  1TKP A;  2V2O A;  4EVC A;  1O9I A;  2BK6 A;  1JI5 A;  2WTL A;  1R03 A;  4PGI A;  2IU2 A;  3AJP A;  3QVD A;  2FG8 A;  3KX9 A;  4RC8 A;  4IWK A;  3HIU A;  5GU1 X;  3KXU A;  4RC7 B;  4RC6 B;  1N1Q A;  2OC5 A;  4EVB A;  1XZ1 A;  3E1J A;  4ZLW A;  2XJN A;  1RYT A;  5FFE A;  4LQJ A;  1EUM A;  1DVB A;  1MFR A;  4Z3B A;  4XKU A;  1RCD A;  5JKM A;  5GU2 X;  3R2L A;  3SID A;  3PZA A;  1TKO A;  4OYN A;  1BFR A;  2Z90 A;  4ZJK A;  4TOF A;  5JKL A;  5ERK A;  1SOF A;  4TOG A;  3AK9 A;  1RCG A;  4ZKW A;  3PW1 A;  2RBD A;  4MN9 A;  2BKC A;  4LPJ A;  3E6R A;  4RC5 A;  3Q4O A;  5E1U A;  3Q4R A;  3F39 A;  1LKP A;  4TOA A;  1NNQ A;  4LPN A;  5D8Y A;  1JTS A;  3EGM A;  4U3G A;  2FFX J;  1BCF A;  1J30 A;  2BJY A;  3E2C A;  3F34 A;  3BT5 A;  3SH6 A;  4CYA A;  2ZUR X;  3OJ5 A;  2CLB A;  5HJF A;  3AF8 X;  2CEI A;  4E6K A;  3PVT B;  3BVK A;  1MOJ A;  1RCI A;  1F30 A;  3QHB A;  3UNO A;  3AJO A;  3RD0 A;  2X17 0;  5HJH A;  3KWO A;  2ZA7 A;  2QF9 A;  1DAT A;  2YW7 A;  2JD6 0;  3BKN A;  4IWJ A;  5LG8 A;  3R2M A;  3R2R A;  3AJQ A;  3E1O A;  3ISE A;  4MY7 A;  1L8I A;  2VXX A;  3PWQ C;  3HL1 A;  4AM4 A;  5GU0 X;  2V2N A;  4EVE A;  1RCC A;  4CVP A;  4CMY A;  4IXK A;  1JKU A;  4II4 B;  2V2J A;  4ISM A;  5JKM G;  3WNW A;  4TOE A;  4LYX A;  2FZF A;  2IB0 A;  4CYB A;  3FI6 A;  5K52 A;  5AXS A;  4CVS A;  2FKZ A;  1VLG A;  4DE6 A;  1NFV A;  5GOU A;  2C6R A;  4ZL5 A;  5ERJ A;  4ZTT A;  2Z5P A;  3NOZ X;  4QUW A;  1YUZ A;  3FSE A;  4XKS A;  1VEL A;  2JD8 0;  3F36 A;  4LYU A;  1RCE A;  4ETR A;  3RE7 A;  3SHX A;  1Z6O A;  4PG1 A;  3WVU A;  3R2O A;  3BVF A;  4RC7 A;  4KVS A;  1LKO A;  1YUX A;  3WVV A;  3E6S A;  5IX6 A;  3TA8 A;  2ZG9 X;  3ISF A;  4ML5 A;  3UOI A;  2Z5Q A;  5HQO A;  4TOC A;  3F32 A;  3MPS A;  1AEW A;  1S30 A;  3AF7 X;  1VEQ A;  2FL0 A;  1JKV A;  2GYQ A;  2G4H A;  4M35 A;  2GS4 A;  3Q4N A;  3PW8 A;  3O7S A;  5D8X A;  4ITW A;  1UMN A;  2Z6M A;  4DI0 A;  2XJM A;  2QQY A;  3Q4Q A;  2UX1 A;  5J8W A;  2V2P A;  1NF4 A; 
#chains in the Genus database with same CATH topology
 4LQV A;  3F38 A;  3PVR B;  4ERU A;  3VVA A;  4ITT A;  5LBH A;  1H96 A;  1Z6O M;  4XGS A;  2C2F A;  2F7N A;  3PWQ A;  4M34 A;  3PW8 C;  1VJX A;  2FG4 A;  2XGW A;  3IS8 A;  3A68 A;  4M33 A;  2CN6 A;  3R2S A;  3AF9 X;  3PVT A;  2V2M A;  3KDQ A;  4AM5 A;  1LB3 A;  1JI4 A;  1YV1 A;  2WWX B;  4MJY A;  5GN8 B;  3U90 A;  4CY9 A;  1Z4A A;  4PGK A;  3GVY A;  2IY4 A;  4LQN A;  2FHA A;  3RAV A;  3NP0 X;  5FEJ A;  2CF7 A;  3QB9 A;  4DYX A;  2XKQ A;  4R42 A;  2FJC A;  2V2L A;  2XJO A;  2WLA A;  2WLU A;  2CLU A;  2BW1 A;  1ZUJ A;  2YW6 A;  4LQH A;  1LKM A;  5D8Q A;  1IES A;  4MUD A;  3PVY B;  2ZG8 X;  1UVH A;  4ZKH A;  5FFB A;  3IQ1 A;  1DPS A;  3BVL A;  2Y44 A;  3R2H A;  3SE1 A;  5D8P A;  2MGY A;  5JKL G;  3QD8 A;  3UFB A;  1FHA A;  1XZ3 A;  5K53 A;  1KRQ A;  4CVT A;  2JD7 0;  3RBC A;  3F35 A;  2C2U A;  3H7G A;  3RGD A;  4X0J A;  2D5K A;  3E1N A;  4Y08 A;  3QHC A;  3GHQ A;  1JRE A;  1B71 A;  3KA6 A;  1HRS A;  4RC6 A;  2C41 A;  3FRS A;  4LPM A;  4DAS A;  4TO9 A;  3QZ3 A;  3IS7 A;  2CHP A;  4TW3 A;  2ZG7 X;  5LS9 A;  3ES3 A;  4TOB A;  2CWL A;  4W4K B;  3KA4 A;  3GE4 A;  3EZU A;  4TOD A;  2V15 A;  2OH3 A;  5FFD A;  5FFC A;  5D8R A;  3E1P A;  1S3Q A;  3F33 A;  4E40 A;  3PW1 B;  4DYU A;  3KHK A;  5E2D A;  4ZL6 A;  3VNX A;  3WVW A;  4REU A;  4RC5 B;  3E1L A;  1QGH A;  3W54 A;  2V2I A;  1BG7 A;  2CN7 A;  5D8S A;  2G38 B;  3PVR A;  5LG2 A;  2VZB A;  2ZA8 A;  5D8O A;  3FRR A;  2V8U A;  5I4J A;  4M32 A;  5J9V A;  3GGZ A;  4ZMC A;  3DBY A;  5CMQ A;  5J8S A;  2HR5 A;  4Z5S A;  2CIH A;  3LKD A;  1S2Z A;  1JGC A;  4ZKX A;  1OTK A;  5GU3 X;  5FFA A;  1ZS3 A;  3OGH A;  3BVI A;  5JAC A;  3PWF A;  1QYB A;  5J93 A;  1GWG A;  4PG0 A;  1L8H A;  4XKT A;  1JIG A;  1O9R A;  2CHI A;  3R2K A;  2Z5R A;  1F33 A;  4KVR A;  5GN8 A;  3O7R A;  4KXR B;  2ITB A;  2GYD A;  3ERZ A;  3A9Q A;  3EZ0 A;  2YJJ A;  3FVB A;  4P18 A;  2ZA6 A;  1NF6 A;  4AM2 A;  1VEI A;  1SQ3 A;  2PYB A;  3T9J A;  4DYY A;  3KA3 A;  4CVR A;  3C23 A;  3BVE A;  3E1Q A;  1TJO A;  3KA8 A;  4II4 A;  1IER A;  2V2S A;  2Y3Q A;  3KA9 A;  5C6F A;  4EVD A;  3UOF A;  3PVY A;  4CMY V;  4YKH A;  1JYB A;  2HTN A;  3F37 A;  2YJK A;  5CMR A;  3E1M A;  4ISP A;  4A25 A;  2VXI A;  4DYZ A;  4DZ0 A;  4MKU A;  4TOH A;  5CZU A;  1TK6 A;  2V2R A;  2W0O A;  2C2J A;  3AK8 A;  3C1Z A;  4KVQ A;  3NP2 X;  1TKP A;  2V2O A;  4EVC A;  1O9I A;  4YXJ A;  2BK6 A;  1JI5 A;  2WTL A;  1R03 A;  4PGI A;  2IU2 A;  3AJP A;  3QVD A;  2FG8 A;  3KX9 A;  4RC8 A;  4IWK A;  3HIU A;  5GU1 X;  3KXU A;  4YXM A;  4RC7 B;  4RC6 B;  1N1Q A;  2OC5 A;  4EVB A;  1XZ1 A;  3E1J A;  3L0M A;  4ZLW A;  4W4L B;  2XJN A;  1RYT A;  4MXP A;  5FFE A;  4LQJ A;  1EUM A;  1DVB A;  1MFR A;  4Z3B A;  4XKU A;  1RCD A;  5JKM A;  5GU2 X;  5JDO A;  3R2L A;  3SID A;  3PZA A;  1TKO A;  4OYN A;  1BFR A;  2Z90 A;  4ZJK A;  4TOF A;  5JKL A;  5ERK A;  1SOF A;  4TOG A;  3AK9 A;  1RCG A;  4ZKW A;  3PW1 A;  2RBD A;  4MN9 A;  2BKC A;  4LPJ A;  3E6R A;  4RC5 A;  3Q4O A;  5E1U A;  2V8T A;  3Q4R A;  3F39 A;  1LKP A;  4TOA A;  1NNQ A;  4LPN A;  5D8Y A;  1JTS A;  3EGM A;  4U3G A;  2FFX J;  1BCF A;  1J30 A;  2BJY A;  3JZA B;  3E2C A;  3F34 A;  3BT5 A;  3SH6 A;  3N6O A;  4CYA A;  2ZUR X;  3OJ5 A;  2CLB A;  5HJF A;  3AF8 X;  2CEI A;  4E6K A;  3PVT B;  3C21 A;  3BVK A;  3JZ9 A;  1MOJ A;  1RCI A;  1F30 A;  3QHB A;  3UNO A;  3AJO A;  3RD0 A;  2X17 0;  5HJH A;  3KWO A;  2ZA7 A;  2QF9 A;  1DAT A;  2YW7 A;  2JD6 0;  3BKN A;  4IWJ A;  5LG8 A;  3R2M A;  3R2R A;  3AJQ A;  3E1O A;  3ISE A;  4MY7 A;  3VV9 A;  1L8I A;  2VXX A;  3PWQ C;  3HL1 A;  4AM4 A;  5GU0 X;  2V2N A;  4EVE A;  1RCC A;  4CVP A;  4CMY A;  4IXK A;  1JKU A;  4II4 B;  2V2J A;  4ISM A;  5HU6 D;  2AR0 A;  5JKM G;  3WNW A;  4TOE A;  4LYX A;  2FZF A;  2IB0 A;  4CYB A;  3GGY A;  3FI6 A;  5K52 A;  2N02 A;  5AXS A;  4CVS A;  2FKZ A;  1VLG A;  4DE6 A;  1NFV A;  3V3K B;  5GOU A;  2C6R A;  4ZL5 A;  5ERJ A;  4ZTT A;  2Z5P A;  3NOZ X;  4QUW A;  1YUZ A;  3FSE A;  4XKS A;  1VEL A;  2JD8 0;  3F36 A;  4LYU A;  1RCE A;  4ETR A;  3RE7 A;  3SHX A;  1Z6O A;  4PG1 A;  3WVU A;  3R2O A;  3BVF A;  2OKC A;  4RC7 A;  4KVS A;  1LKO A;  4WJG 4;  1YUX A;  3WVV A;  3D19 A;  3E6S A;  5IX6 A;  4YVZ A;  3TA8 A;  2ZG9 X;  3ISF A;  4ML5 A;  3UOI A;  2Z5Q A;  5HQO A;  4TOC A;  3F32 A;  3MPS A;  1AEW A;  1S30 A;  5JDO B;  3AF7 X;  3M6J A;  1VEQ A;  2FL0 A;  1JKV A;  2GYQ A;  2G4H A;  4M35 A;  2GS4 A;  3Q4N A;  3PW8 A;  3O7S A;  3C1Y A;  5D8X A;  4ITW A;  1UMN A;  2Z6M A;  4DI0 A;  2XJM A;  2QQY A;  3Q4Q A;  2UX1 A;  5J8W A;  2V2P A;  1NF4 A; 
#chains in the Genus database with same CATH homology
 4LQV A;  3F38 A;  3PVR B;  4ERU A;  3VVA A;  4ITT A;  5LBH A;  1H96 A;  1Z6O M;  4XGS A;  2C2F A;  2F7N A;  3PWQ A;  4M34 A;  3PW8 C;  1VJX A;  2FG4 A;  2XGW A;  3IS8 A;  3A68 A;  4M33 A;  2CN6 A;  3R2S A;  3AF9 X;  3PVT A;  2V2M A;  3KDQ A;  4AM5 A;  1LB3 A;  1JI4 A;  1YV1 A;  2WWX B;  4MJY A;  5GN8 B;  3U90 A;  4CY9 A;  1Z4A A;  4PGK A;  3GVY A;  2IY4 A;  4LQN A;  2FHA A;  3RAV A;  3NP0 X;  5FEJ A;  2CF7 A;  3QB9 A;  4DYX A;  2XKQ A;  4R42 A;  2FJC A;  2V2L A;  2XJO A;  2WLA A;  2WLU A;  2CLU A;  2BW1 A;  1ZUJ A;  2YW6 A;  4LQH A;  1LKM A;  5D8Q A;  1IES A;  4MUD A;  3PVY B;  2ZG8 X;  1UVH A;  4ZKH A;  5FFB A;  3IQ1 A;  1DPS A;  3BVL A;  2Y44 A;  3R2H A;  3SE1 A;  5D8P A;  2MGY A;  5JKL G;  3QD8 A;  3UFB A;  1FHA A;  1XZ3 A;  5K53 A;  1KRQ A;  4CVT A;  2JD7 0;  3RBC A;  3F35 A;  2C2U A;  3H7G A;  3RGD A;  4X0J A;  2D5K A;  3E1N A;  4Y08 A;  3QHC A;  3GHQ A;  1JRE A;  1B71 A;  3KA6 A;  1HRS A;  4RC6 A;  2C41 A;  3FRS A;  4LPM A;  4DAS A;  4TO9 A;  3QZ3 A;  3IS7 A;  2CHP A;  4TW3 A;  2ZG7 X;  5LS9 A;  3ES3 A;  4TOB A;  2CWL A;  4W4K B;  3KA4 A;  3GE4 A;  3EZU A;  4TOD A;  2V15 A;  2OH3 A;  5FFD A;  5FFC A;  5D8R A;  3E1P A;  1S3Q A;  3F33 A;  4E40 A;  3PW1 B;  4DYU A;  3KHK A;  5E2D A;  4ZL6 A;  3VNX A;  3WVW A;  4REU A;  4RC5 B;  3E1L A;  1QGH A;  3W54 A;  2V2I A;  1BG7 A;  2CN7 A;  5D8S A;  2G38 B;  3PVR A;  5LG2 A;  2VZB A;  2ZA8 A;  5D8O A;  3FRR A;  2V8U A;  5I4J A;  4M32 A;  5J9V A;  3GGZ A;  4ZMC A;  3DBY A;  5CMQ A;  5J8S A;  2HR5 A;  4Z5S A;  2CIH A;  3LKD A;  1S2Z A;  1JGC A;  4ZKX A;  1OTK A;  5GU3 X;  5FFA A;  1ZS3 A;  3OGH A;  3BVI A;  5JAC A;  3PWF A;  1QYB A;  5J93 A;  1GWG A;  4PG0 A;  1L8H A;  4XKT A;  1JIG A;  1O9R A;  2CHI A;  3R2K A;  2Z5R A;  1F33 A;  4KVR A;  5GN8 A;  3O7R A;  4KXR B;  2ITB A;  2GYD A;  3ERZ A;  3A9Q A;  3EZ0 A;  2YJJ A;  3FVB A;  4P18 A;  2ZA6 A;  1NF6 A;  4AM2 A;  1VEI A;  1SQ3 A;  2PYB A;  3T9J A;  4DYY A;  3KA3 A;  4CVR A;  3C23 A;  3BVE A;  3E1Q A;  1TJO A;  3KA8 A;  4II4 A;  1IER A;  2V2S A;  2Y3Q A;  3KA9 A;  5C6F A;  4EVD A;  3UOF A;  3PVY A;  4CMY V;  4YKH A;  1JYB A;  2HTN A;  3F37 A;  2YJK A;  5CMR A;  3E1M A;  4ISP A;  4A25 A;  2VXI A;  4DYZ A;  4DZ0 A;  4MKU A;  4TOH A;  5CZU A;  1TK6 A;  2V2R A;  2W0O A;  2C2J A;  3AK8 A;  3C1Z A;  4KVQ A;  3NP2 X;  1TKP A;  2V2O A;  4EVC A;  1O9I A;  4YXJ A;  2BK6 A;  1JI5 A;  2WTL A;  1R03 A;  4PGI A;  2IU2 A;  3AJP A;  3QVD A;  2FG8 A;  3KX9 A;  4RC8 A;  4IWK A;  3HIU A;  5GU1 X;  3KXU A;  4YXM A;  4RC7 B;  4RC6 B;  1N1Q A;  2OC5 A;  4EVB A;  1XZ1 A;  3E1J A;  3L0M A;  4ZLW A;  4W4L B;  2XJN A;  1RYT A;  4MXP A;  5FFE A;  4LQJ A;  1EUM A;  1DVB A;  1MFR A;  4Z3B A;  4XKU A;  1RCD A;  5JKM A;  5GU2 X;  5JDO A;  3R2L A;  3SID A;  3PZA A;  1TKO A;  4OYN A;  1BFR A;  2Z90 A;  4ZJK A;  4TOF A;  5JKL A;  5ERK A;  1SOF A;  4TOG A;  3AK9 A;  1RCG A;  4ZKW A;  3PW1 A;  2RBD A;  4MN9 A;  2BKC A;  4LPJ A;  3E6R A;  4RC5 A;  3Q4O A;  5E1U A;  2V8T A;  3Q4R A;  3F39 A;  1LKP A;  4TOA A;  1NNQ A;  4LPN A;  5D8Y A;  1JTS A;  3EGM A;  4U3G A;  2FFX J;  1BCF A;  1J30 A;  2BJY A;  3JZA B;  3E2C A;  3F34 A;  3BT5 A;  3SH6 A;  3N6O A;  4CYA A;  2ZUR X;  3OJ5 A;  2CLB A;  5HJF A;  3AF8 X;  2CEI A;  4E6K A;  3PVT B;  3C21 A;  3BVK A;  3JZ9 A;  1MOJ A;  1RCI A;  1F30 A;  3QHB A;  3UNO A;  3AJO A;  3RD0 A;  2X17 0;  5HJH A;  3KWO A;  2ZA7 A;  2QF9 A;  1DAT A;  2YW7 A;  2JD6 0;  3BKN A;  4IWJ A;  5LG8 A;  3R2M A;  3R2R A;  3AJQ A;  3E1O A;  3ISE A;  4MY7 A;  3VV9 A;  1L8I A;  2VXX A;  3PWQ C;  3HL1 A;  4AM4 A;  5GU0 X;  2V2N A;  4EVE A;  1RCC A;  4CVP A;  4CMY A;  4IXK A;  1JKU A;  4II4 B;  2V2J A;  4ISM A;  5HU6 D;  2AR0 A;  5JKM G;  3WNW A;  4TOE A;  4LYX A;  2FZF A;  2IB0 A;  4CYB A;  3GGY A;  3FI6 A;  5K52 A;  2N02 A;  5AXS A;  4CVS A;  2FKZ A;  1VLG A;  4DE6 A;  1NFV A;  3V3K B;  5GOU A;  2C6R A;  4ZL5 A;  5ERJ A;  4ZTT A;  2Z5P A;  3NOZ X;  4QUW A;  1YUZ A;  3FSE A;  4XKS A;  1VEL A;  2JD8 0;  3F36 A;  4LYU A;  1RCE A;  4ETR A;  3RE7 A;  3SHX A;  1Z6O A;  4PG1 A;  3WVU A;  3R2O A;  3BVF A;  2OKC A;  4RC7 A;  4KVS A;  1LKO A;  4WJG 4;  1YUX A;  3WVV A;  3D19 A;  3E6S A;  5IX6 A;  4YVZ A;  3TA8 A;  2ZG9 X;  3ISF A;  4ML5 A;  3UOI A;  2Z5Q A;  5HQO A;  4TOC A;  3F32 A;  3MPS A;  1AEW A;  1S30 A;  5JDO B;  3AF7 X;  3M6J A;  1VEQ A;  2FL0 A;  1JKV A;  2GYQ A;  2G4H A;  4M35 A;  2GS4 A;  3Q4N A;  3PW8 A;  3O7S A;  3C1Y A;  5D8X A;  4ITW A;  1UMN A;  2Z6M A;  4DI0 A;  2XJM A;  2QQY A;  3Q4Q A;  2UX1 A;  5J8W A;  2V2P A;  1NF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...