2BKCA

The x-ray structure of the h43g listeria innocua dps mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
150
structure length
150
Chain Sequence
VDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTLELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-HEME IRON-CONTAINING FERRITIN
publication title The unusual intersubunit ferroxidase center of Listeria innocua Dps is required for hydrogen peroxide detoxification but not for iron uptake. A study with site-specific mutants.
pubmed doi rcsb
source organism Listeria innocua
molecule tags Iron oxidation and storage
total genus 67
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, X, Y
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2bkcA00
3RAVA 4CYAA 1JKUA 3QVDA 3A68A 2OC5A 2W0OA 1VEIA 4Y08A 4A25A 4QUWA 3FI6A 1F30A 1S2ZA 1MFRA 1JIGA 3PZAA 3R2LA 4PGIA 3F35A 4LPMA 5IX6A 1RCCA 3BKNA 4KVSA 3NP2X 4EVDA 2V15A 3TA8A 3SIDA 3PW1B 1QYBA 2CHPA 2IB0A 3E1JA 3U90A 1JREA 3WVWA 3F37A 5D8QA 5LS9A 2QF9A 4TOHA 5C6FA 1NF4A 3F32A 5JACA 2V2OA 4EVBA 2ZA6A 1RCEA 2BJYA 2WTLA 2CN7A 4M32A 3AF8X 3QB9A 4LYUA 3FSEA 3F34A 1RYTA 2ZG7X 3EZ0A 3ERZA 2ZURX 4TOEA 4DZ0A 3E1NA 4U3GA 2ITBA 2CLUA 1JYBA 4ZJKA 2V2LA 3R2MA 3MPSA 4TW3A 1JI5A 1BCFA 1YUXA 4ZMCA 2CEIA 4XKUA 3RGDA 1DVBA 4TOAA 5HJHA 5J8SA 3PVTA 1TKPA 4ZL6A 3AF7X 4E6KA 2XJOA 5E1UA 5FFDA 3PW8A 1SOFA 4RC6A 2YJJA 3AK8A 3IS7A 5JKMG 2Z5RA 5FFBA 4Z5SA 3KA3A 5J93A 1UVHA 3E1QA 5GN8A 1VJXA 5ERJA 4ZKWA 3QHCA 4CVRA 1O9RA 1TJOA 4ITTA 2BK6A 5HQOA 4LPJA 4MJYA 1F33A 4M34A 2RBDA 2C41A 4MY7A 2FG4A 1VLGA 3Q4RA 4DYUA 4M33A 3E1PA 1LKPA 1IESA 1LB3A 1BFRA 4KVQA 5D8PA 1RCGA 1YV1A 4RC6B 5D8OA 3E1OA 3PVRB 5GOUA 1R03A 4R42A 3SHXA 1OTKA 3KA8A 3F38A 5D8SA 4AM4A 2HTNA 2C2UA 1VEQA 3ISEA 4P18A 2FFXJ 4RC5A 4IXKA 4KVRA 4ZKXA 1XZ1A 3BVKA 3PWQC 4XKTA 3KXUA 2X170 5JKLG 2QQYA 3E2CA 3PVYB 4AM5A 1BG7A 5I4JA 1XZ3A 1N1QA 3AJQA 2FL0A 3RE7A 3PW8C 2V2RA 4TODA 1TKOA 1EUMA 1Z6OM 4II4A 2G4HA 3IQ1A 5K53A 5JKMA 1S3QA 3O7SA 3IS8A 4REUA 5J9VA 3Q4NA 1HRSA 4YKHA 4AM2A 2YW6A 2FG8A 4ISPA 2D5KA 5J8WA 2C2FA 1GWGA 4TO9A 1J30A 2CHIA 3R2KA 2GYDA 2CN6A 2VXIA 3KA9A 5GU1X 3E1MA 4ML5A 5LBHA 3EGMA 5LG2A 3RD0A 1JGCA 1L8IA 2XJNA 1FHAA 1QGHA 1YUZA 1LKMA 4TOFA 1NF6A 2VZBA 4DI0A 5HJFA 2V2PA 3F33A 1JKVA 4CMYA 4M35A 4ETRA 2C2JA 3AK9A 5CMRA 3VNXA 4PGKA 3NOZX 1DPSA 5D8XA 3EZUA 4RC8A 1NFVA 3FVBA 3OGHA 4MN9A 4ZKHA 3AF9X 5AXSA 1RCDA 4LQHA 2Z5QA 4ZL5A 3KX9A 5FEJA 3RBCA 3T9JA 3SH6A 3WVVA 3PVTB 5JKLA 3QHBA 5D8RA 5CZUA 4DE6A 3R2HA 4EVEA 3BVFA 1TK6A 2FJCA 3HL1A 4CY9A 2FHAA 1IERA 3UOIA 2HR5A 2V2MA 1VELA 2BKCA 2ZA7A 1LKOA 1L8HA 3PW1A 4LQVA 5GN8B 3Q4QA 3BVLA 3QD8A 1MOJA 3BVIA 4CYBA 4ISMA 2XJMA 2YJKA 4LQJA 4DYZA 3GE4A 4TOBA 4CVPA 3F36A 3UOFA 2WLAA 4MUDA 3GHQA 3KWOA 5GU0X 3F39A 3SE1A 2OH3A 2ZG9X 1S30A 4Z3BA 1ZS3A 2XGWA 1KRQA 2GYQA 3A9QA 3WVUA 2WLUA 1JI4A 3GVYA 2FZFA 1O9IA 3E1LA 1DATA 2VXXA 3H7GA 3ISFA 2FKZA 3OJ5A 3QZ3A 2V2JA 2IY4A 2IU2A 3AJOA 3E6SA 4RC5B 3O7RA 2V2SA 4CMYV 1Z4AA 1JTSA 4CVSA 2Z6MA 4OYNA 5CMQA 4DYYA 4MKUA 4TOCA 2C6RA 2CIHA 1NNQA 2XKQA 2BW1A 4ITWA 3KA4A 4XGSA 4RC7A 2YW7A 3HIUA 2Z90A 4DYXA 3R2OA 2UX1A 3PWQA 5FFCA 5E2DA 2JD70 5D8YA 2V2NA 4XKSA 4CVTA 1AEWA 2GS4A 2Y3QA 2JD60 3PWFA 3KA6A 4II4B 4EVCA 4DASA 2ZG8X 1B71A 2Z5PA 5FFEA 1SQ3A 4ZLWA 5FFAA 3UNOA 4ERUA 3E6RA 2JD80 1UMNA 1Z6OA 4PG1A 4LPNA 4LYXA 2PYBA 4PG0A 3PVRA 2V2IA 4IWKA 1H96A 4RC7B 4ZTTA 5LG8A 5ERKA 5K52A 3BT5A 5GU2X 3WNWA 3Q4OA 1ZUJA 4TOGA 2ZA8A 2CLBA 2F7NA 1RCIA 5GU3X 2CF7A 3BVEA 3R2SA 3PVYA 3AJPA 3ES3A 4LQNA 3R2RA 3NP0X 4IWJA
chains in the Genus database with same CATH superfamily
4W4LB 3RAVA 4CYAA 1JKUA 3QVDA 3A68A 2OC5A 2W0OA 1VEIA 4Y08A 4A25A 4QUWA 3FI6A 1F30A 3W54A 1S2ZA 1MFRA 1JIGA 3PZAA 3R2LA 4PGIA 3F35A 4LPMA 5IX6A 3VVAA 3LKDA 1RCCA 3VV9A 3BKNA 4KVSA 3NP2X 4EVDA 2V8TA 2V15A 3TA8A 3SIDA 3PW1B 1QYBA 2CHPA 2IB0A 3E1JA 3U90A 1JREA 3WVWA 3F37A 5D8QA 5LS9A 2QF9A 4TOHA 5C6FA 1NF4A 3F32A 5JACA 2V2OA 4EVBA 2ZA6A 1RCEA 2BJYA 2WTLA 2CN7A 4M32A 3AF8X 3M6JA 3QB9A 4W4KB 4LYUA 3FSEA 3F34A 1RYTA 2ZG7X 3EZ0A 3ERZA 2ZURX 4TOEA 4DZ0A 3E1NA 4U3GA 2ITBA 2CLUA 1JYBA 4ZJKA 2V2LA 3R2MA 3MPSA 4WJG4 4TW3A 1JI5A 1BCFA 1YUXA 3GGZA 4ZMCA 2CEIA 4XKUA 3RGDA 1DVBA 4TOAA 3UFBA 4YVZA 5HJHA 5J8SA 2G38B 3JZ9A 1TKPA 3PVTA 4ZL6A 3AF7X 4E6KA 2XJOA 5E1UA 5FFDA 3PW8A 1SOFA 4RC6A 2YJJA 3AK8A 3C1ZA 3IS7A 5JKMG 2Z5RA 4MXPA 5FFBA 4Z5SA 3KA3A 5J93A 1UVHA 3E1QA 5GN8A 1VJXA 5ERJA 4ZKWA 3QHCA 3FRSA 4CVRA 1O9RA 1TJOA 4ITTA 3D19A 2BK6A 5HQOA 4LPJA 4MJYA 1F33A 4M34A 2RBDA 2C41A 4MY7A 2FG4A 1VLGA 3Q4RA 4DYUA 4M33A 3E1PA 1LKPA 1IESA 1LB3A 1BFRA 4KVQA 2OKCA 5D8PA 1RCGA 1YV1A 4RC6B 5D8OA 3E1OA 3PVRB 5GOUA 1R03A 4R42A 3SHXA 1OTKA 3KA8A 3F38A 5D8SA 4AM4A 2HTNA 2C2UA 1VEQA 3ISEA 4P18A 2FFXJ 4RC5A 4IXKA 4KVRA 4ZKXA 1XZ1A 3BVKA 3PWQC 4XKTA 3KXUA 2X170 5JKLG 2QQYA 3E2CA 3PVYB 4AM5A 1BG7A 5I4JA 1XZ3A 1N1QA 3AJQA 2FL0A 3RE7A 4E40A 3PW8C 2V2RA 4TODA 1TKOA 1EUMA 1Z6OM 4II4A 2G4HA 3IQ1A 5K53A 5JKMA 1S3QA 3O7SA 3IS8A 3FRRA 4REUA 5J9VA 3Q4NA 5JDOA 1HRSA 3N6OA 4YKHA 4AM2A 2YW6A 2FG8A 4ISPA 2D5KA 5J8WA 2C2FA 1GWGA 4TO9A 1J30A 2CHIA 3R2KA 2GYDA 2CN6A 2VXIA 3KA9A 5GU1X 3E1MA 4ML5A 5LBHA 3EGMA 5LG2A 2V8UA 3RD0A 1JGCA 1L8IA 2XJNA 1FHAA 1QGHA 1YUZA 1LKMA 4TOFA 1NF6A 2VZBA 3C1YA 4DI0A 5HJFA 2V2PA 3F33A 1JKVA 4CMYA 4M35A 4ETRA 2C2JA 4YXJA 3AK9A 5JDOB 5CMRA 3VNXA 4PGKA 3NOZX 1DPSA 5D8XA 2Y44A 3EZUA 4RC8A 1NFVA 3FVBA 3OGHA 4MN9A 4ZKHA 3AF9X 5AXSA 1RCDA 4LQHA 2Z5QA 4ZL5A 3KX9A 5FEJA 3RBCA 3T9JA 3SH6A 3WVVA 3PVTB 5JKLA 3QHBA 5D8RA 5CZUA 4DE6A 3R2HA 4EVEA 3BVFA 4KXRB 1TK6A 2FJCA 3HL1A 4CY9A 2FHAA 1IERA 3UOIA 2HR5A 3JZAB 2V2MA 1VELA 2BKCA 2ZA7A 1LKOA 1L8HA 3PW1A 4LQVA 5GN8B 3Q4QA 3BVLA 5HU6D 3QD8A 1MOJA 4X0JA 3BVIA 4CYBA 4ISMA 2XJMA 2YJKA 4YXMA 4LQJA 4DYZA 3GE4A 4TOBA 4CVPA 3F36A 3UOFA 2WLAA 4MUDA 3GHQA 3KWOA 5GU0X 3F39A 3SE1A 2OH3A 2ZG9X 3C23A 1S30A 4Z3BA 1ZS3A 2XGWA 1KRQA 2GYQA 3A9QA 3WVUA 2WLUA 1JI4A 3GVYA 2FZFA 1O9IA 3E1LA 1DATA 2VXXA 3H7GA 3ISFA 2FKZA 3OJ5A 3QZ3A 2V2JA 2IY4A 2IU2A 3AJOA 3E6SA 4RC5B 3O7RA 2V2SA 4CMYV 1Z4AA 1JTSA 3C21A 4CVSA 2Z6MA 4OYNA 5CMQA 4DYYA 4MKUA 4TOCA 2C6RA 3GGYA 2CIHA 1NNQA 2XKQA 2BW1A 4ITWA 3KDQA 3KA4A 4XGSA 4RC7A 2YW7A 2AR0A 3HIUA 2Z90A 4DYXA 3DBYA 3R2OA 2UX1A 3PWQA 5FFCA 5E2DA 2JD70 5D8YA 2MGYA 2V2NA 4XKSA 4CVTA 1AEWA 2GS4A 2Y3QA 2JD60 3PWFA 3KA6A 4II4B 4EVCA 4DASA 2ZG8X 1B71A 2Z5PA 5FFEA 1SQ3A 4ZLWA 5FFAA 3UNOA 4ERUA 3E6RA 2JD80 1UMNA 1Z6OA 4PG1A 4LPNA 4LYXA 2PYBA 4PG0A 3PVRA 2V2IA 4IWKA 1H96A 3V3KB 4RC7B 4ZTTA 5LG8A 5ERKA 5K52A 3BT5A 5GU2X 3WNWA 3Q4OA 1ZUJA 4TOGA 3KHKA 2ZA8A 2CLBA 2CWLA 2WWXB 2F7NA 1RCIA 2N02A 3L0MA 5GU3X 2CF7A 3BVEA 3R2SA 3PVYA 3AJPA 3ES3A 4LQNA 3R2RA 3NP0X 4IWJA
chains in the Genus database with same CATH topology
4W4LB 3RAVA 4CYAA 1JKUA 3QVDA 3A68A 2OC5A 2W0OA 1VEIA 4Y08A 4A25A 4QUWA 3FI6A 1F30A 3W54A 1S2ZA 1MFRA 1JIGA 3PZAA 3R2LA 4PGIA 3F35A 4LPMA 5IX6A 3VVAA 3LKDA 1RCCA 3VV9A 3BKNA 4KVSA 3NP2X 4EVDA 2V8TA 2V15A 3TA8A 3SIDA 3PW1B 1QYBA 2CHPA 2IB0A 3E1JA 3U90A 1JREA 3WVWA 3F37A 5D8QA 5LS9A 2QF9A 4TOHA 5C6FA 1NF4A 3F32A 5JACA 2V2OA 4EVBA 2ZA6A 1RCEA 2BJYA 2WTLA 2CN7A 4M32A 3AF8X 3M6JA 3QB9A 4W4KB 4LYUA 3FSEA 3F34A 1RYTA 2ZG7X 3EZ0A 3ERZA 2ZURX 4TOEA 4DZ0A 3E1NA 4U3GA 2ITBA 2CLUA 1JYBA 4ZJKA 2V2LA 3R2MA 3MPSA 4WJG4 4TW3A 1JI5A 1BCFA 1YUXA 3GGZA 4ZMCA 2CEIA 4XKUA 3RGDA 1DVBA 4TOAA 3UFBA 4YVZA 5HJHA 5J8SA 2G38B 3JZ9A 1TKPA 3PVTA 4ZL6A 3AF7X 4E6KA 2XJOA 5E1UA 5FFDA 3PW8A 1SOFA 4RC6A 2YJJA 3AK8A 3C1ZA 3IS7A 5JKMG 2Z5RA 4MXPA 5FFBA 4Z5SA 3KA3A 5J93A 1UVHA 3E1QA 5GN8A 1VJXA 5ERJA 4ZKWA 3QHCA 3FRSA 4CVRA 1O9RA 1TJOA 4ITTA 3D19A 2BK6A 5HQOA 4LPJA 4MJYA 1F33A 4M34A 2RBDA 2C41A 4MY7A 2FG4A 1VLGA 3Q4RA 4DYUA 4M33A 3E1PA 1LKPA 1IESA 1LB3A 1BFRA 4KVQA 2OKCA 5D8PA 1RCGA 1YV1A 4RC6B 5D8OA 3E1OA 3PVRB 5GOUA 1R03A 4R42A 3SHXA 1OTKA 3KA8A 3F38A 5D8SA 4AM4A 2HTNA 2C2UA 1VEQA 3ISEA 4P18A 2FFXJ 4RC5A 4IXKA 4KVRA 4ZKXA 1XZ1A 3BVKA 3PWQC 4XKTA 3KXUA 2X170 5JKLG 2QQYA 3E2CA 3PVYB 4AM5A 1BG7A 5I4JA 1XZ3A 1N1QA 3AJQA 2FL0A 3RE7A 4E40A 3PW8C 2V2RA 4TODA 1TKOA 1EUMA 1Z6OM 4II4A 2G4HA 3IQ1A 5K53A 5JKMA 1S3QA 3O7SA 3IS8A 3FRRA 4REUA 5J9VA 3Q4NA 5JDOA 1HRSA 3N6OA 4YKHA 4AM2A 2YW6A 2FG8A 4ISPA 2D5KA 5J8WA 2C2FA 1GWGA 4TO9A 1J30A 2CHIA 3R2KA 2GYDA 2CN6A 2VXIA 3KA9A 5GU1X 3E1MA 4ML5A 5LBHA 3EGMA 5LG2A 2V8UA 3RD0A 1JGCA 1L8IA 2XJNA 1FHAA 1QGHA 1YUZA 1LKMA 4TOFA 1NF6A 2VZBA 3C1YA 4DI0A 5HJFA 2V2PA 3F33A 1JKVA 4CMYA 4M35A 4ETRA 2C2JA 4YXJA 3AK9A 5JDOB 5CMRA 3VNXA 4PGKA 3NOZX 1DPSA 5D8XA 2Y44A 3EZUA 4RC8A 1NFVA 3FVBA 3OGHA 4MN9A 4ZKHA 3AF9X 5AXSA 1RCDA 4LQHA 2Z5QA 4ZL5A 3KX9A 5FEJA 3RBCA 3T9JA 3SH6A 3WVVA 3PVTB 5JKLA 3QHBA 5D8RA 5CZUA 4DE6A 3R2HA 4EVEA 3BVFA 4KXRB 1TK6A 2FJCA 3HL1A 4CY9A 2FHAA 1IERA 3UOIA 2HR5A 3JZAB 2V2MA 1VELA 2BKCA 2ZA7A 1LKOA 1L8HA 3PW1A 4LQVA 5GN8B 3Q4QA 3BVLA 5HU6D 3QD8A 1MOJA 4X0JA 3BVIA 4CYBA 4ISMA 2XJMA 2YJKA 4YXMA 4LQJA 4DYZA 3GE4A 4TOBA 4CVPA 3F36A 3UOFA 2WLAA 4MUDA 3GHQA 3KWOA 5GU0X 3F39A 3SE1A 2OH3A 2ZG9X 3C23A 1S30A 4Z3BA 1ZS3A 2XGWA 1KRQA 2GYQA 3A9QA 3WVUA 2WLUA 1JI4A 3GVYA 2FZFA 1O9IA 3E1LA 1DATA 2VXXA 3H7GA 3ISFA 2FKZA 3OJ5A 3QZ3A 2V2JA 2IY4A 2IU2A 3AJOA 3E6SA 4RC5B 3O7RA 2V2SA 4CMYV 1Z4AA 1JTSA 3C21A 4CVSA 2Z6MA 4OYNA 5CMQA 4DYYA 4MKUA 4TOCA 2C6RA 3GGYA 2CIHA 1NNQA 2XKQA 2BW1A 4ITWA 3KDQA 3KA4A 4XGSA 4RC7A 2YW7A 2AR0A 3HIUA 2Z90A 4DYXA 3DBYA 3R2OA 2UX1A 3PWQA 5FFCA 5E2DA 2JD70 5D8YA 2MGYA 2V2NA 4XKSA 4CVTA 1AEWA 2GS4A 2Y3QA 2JD60 3PWFA 3KA6A 4II4B 4EVCA 4DASA 2ZG8X 1B71A 2Z5PA 5FFEA 1SQ3A 4ZLWA 5FFAA 3UNOA 4ERUA 3E6RA 2JD80 1UMNA 1Z6OA 4PG1A 4LPNA 4LYXA 2PYBA 4PG0A 3PVRA 2V2IA 4IWKA 1H96A 3V3KB 4RC7B 4ZTTA 5LG8A 5ERKA 5K52A 3BT5A 5GU2X 3WNWA 3Q4OA 1ZUJA 4TOGA 3KHKA 2ZA8A 2CLBA 2CWLA 2WWXB 2F7NA 1RCIA 2N02A 3L0MA 5GU3X 2CF7A 3BVEA 3R2SA 3PVYA 3AJPA 3ES3A 4LQNA 3R2RA 3NP0X 4IWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RAV A;  4CYA A;  1JKU A;  3QVD A;  3A68 A;  2OC5 A;  2W0O A;  1VEI A;  4Y08 A;  4A25 A;  4QUW A;  3FI6 A;  1F30 A;  1S2Z A;  1MFR A;  1JIG A;  3PZA A;  3R2L A;  4PGI A;  3F35 A;  4LPM A;  5IX6 A;  1RCC A;  3BKN A;  4KVS A;  3NP2 X;  4EVD A;  2V15 A;  3TA8 A;  3SID A;  3PW1 B;  1QYB A;  2CHP A;  2IB0 A;  3E1J A;  3U90 A;  1JRE A;  3WVW A;  3F37 A;  5D8Q A;  5LS9 A;  2QF9 A;  4TOH A;  5C6F A;  1NF4 A;  3F32 A;  5JAC A;  2V2O A;  4EVB A;  2ZA6 A;  1RCE A;  2BJY A;  2WTL A;  2CN7 A;  4M32 A;  3AF8 X;  3QB9 A;  4LYU A;  3FSE A;  3F34 A;  1RYT A;  2ZG7 X;  3EZ0 A;  3ERZ A;  2ZUR X;  4TOE A;  4DZ0 A;  3E1N A;  4U3G A;  2ITB A;  2CLU A;  1JYB A;  4ZJK A;  2V2L A;  3R2M A;  3MPS A;  4TW3 A;  1JI5 A;  1BCF A;  1YUX A;  4ZMC A;  2CEI A;  4XKU A;  3RGD A;  1DVB A;  4TOA A;  5HJH A;  5J8S A;  3PVT A;  1TKP A;  4ZL6 A;  3AF7 X;  4E6K A;  2XJO A;  5E1U A;  5FFD A;  3PW8 A;  1SOF A;  4RC6 A;  2YJJ A;  3AK8 A;  3IS7 A;  5JKM G;  2Z5R A;  5FFB A;  4Z5S A;  3KA3 A;  5J93 A;  1UVH A;  3E1Q A;  5GN8 A;  1VJX A;  5ERJ A;  4ZKW A;  3QHC A;  4CVR A;  1O9R A;  1TJO A;  4ITT A;  2BK6 A;  5HQO A;  4LPJ A;  4MJY A;  1F33 A;  4M34 A;  2RBD A;  2C41 A;  4MY7 A;  2FG4 A;  1VLG A;  3Q4R A;  4DYU A;  4M33 A;  3E1P A;  1LKP A;  1IES A;  1LB3 A;  1BFR A;  4KVQ A;  5D8P A;  1RCG A;  1YV1 A;  4RC6 B;  5D8O A;  3E1O A;  3PVR B;  5GOU A;  1R03 A;  4R42 A;  3SHX A;  1OTK A;  3KA8 A;  3F38 A;  5D8S A;  4AM4 A;  2HTN A;  2C2U A;  1VEQ A;  3ISE A;  4P18 A;  2FFX J;  4RC5 A;  4IXK A;  4KVR A;  4ZKX A;  1XZ1 A;  3BVK A;  3PWQ C;  4XKT A;  3KXU A;  2X17 0;  5JKL G;  2QQY A;  3E2C A;  3PVY B;  4AM5 A;  1BG7 A;  5I4J A;  1XZ3 A;  1N1Q A;  3AJQ A;  2FL0 A;  3RE7 A;  3PW8 C;  2V2R A;  4TOD A;  1TKO A;  1EUM A;  1Z6O M;  4II4 A;  2G4H A;  3IQ1 A;  5K53 A;  5JKM A;  1S3Q A;  3O7S A;  3IS8 A;  4REU A;  5J9V A;  3Q4N A;  1HRS A;  4YKH A;  4AM2 A;  2YW6 A;  2FG8 A;  4ISP A;  2D5K A;  5J8W A;  2C2F A;  1GWG A;  4TO9 A;  1J30 A;  2CHI A;  3R2K A;  2GYD A;  2CN6 A;  2VXI A;  3KA9 A;  5GU1 X;  3E1M A;  4ML5 A;  5LBH A;  3EGM A;  5LG2 A;  3RD0 A;  1JGC A;  1L8I A;  2XJN A;  1FHA A;  1QGH A;  1YUZ A;  1LKM A;  4TOF A;  1NF6 A;  2VZB A;  4DI0 A;  5HJF A;  2V2P A;  3F33 A;  1JKV A;  4CMY A;  4M35 A;  4ETR A;  2C2J A;  3AK9 A;  5CMR A;  3VNX A;  4PGK A;  3NOZ X;  1DPS A;  5D8X A;  3EZU A;  4RC8 A;  1NFV A;  3FVB A;  3OGH A;  4MN9 A;  4ZKH A;  3AF9 X;  5AXS A;  1RCD A;  4LQH A;  2Z5Q A;  4ZL5 A;  3KX9 A;  5FEJ A;  3RBC A;  3T9J A;  3SH6 A;  3WVV A;  3PVT B;  5JKL A;  3QHB A;  5D8R A;  5CZU A;  4DE6 A;  3R2H A;  4EVE A;  3BVF A;  1TK6 A;  2FJC A;  3HL1 A;  4CY9 A;  2FHA A;  1IER A;  3UOI A;  2HR5 A;  2V2M A;  1VEL A;  2BKC A;  2ZA7 A;  1LKO A;  1L8H A;  3PW1 A;  4LQV A;  5GN8 B;  3Q4Q A;  3BVL A;  3QD8 A;  1MOJ A;  3BVI A;  4CYB A;  4ISM A;  2XJM A;  2YJK A;  4LQJ A;  4DYZ A;  3GE4 A;  4TOB A;  4CVP A;  3F36 A;  3UOF A;  2WLA A;  4MUD A;  3GHQ A;  3KWO A;  5GU0 X;  3F39 A;  3SE1 A;  2OH3 A;  2ZG9 X;  1S30 A;  4Z3B A;  1ZS3 A;  2XGW A;  1KRQ A;  2GYQ A;  3A9Q A;  3WVU A;  2WLU A;  1JI4 A;  3GVY A;  2FZF A;  1O9I A;  3E1L A;  1DAT A;  2VXX A;  3H7G A;  3ISF A;  2FKZ A;  3OJ5 A;  3QZ3 A;  2V2J A;  2IY4 A;  2IU2 A;  3AJO A;  3E6S A;  4RC5 B;  3O7R A;  2V2S A;  4CMY V;  1Z4A A;  1JTS A;  4CVS A;  2Z6M A;  4OYN A;  5CMQ A;  4DYY A;  4MKU A;  4TOC A;  2C6R A;  2CIH A;  1NNQ A;  2XKQ A;  2BW1 A;  4ITW A;  3KA4 A;  4XGS A;  4RC7 A;  2YW7 A;  3HIU A;  2Z90 A;  4DYX A;  3R2O A;  2UX1 A;  3PWQ A;  5FFC A;  5E2D A;  2JD7 0;  5D8Y A;  2V2N A;  4XKS A;  4CVT A;  1AEW A;  2GS4 A;  2Y3Q A;  2JD6 0;  3PWF A;  3KA6 A;  4II4 B;  4EVC A;  4DAS A;  2ZG8 X;  1B71 A;  2Z5P A;  5FFE A;  1SQ3 A;  4ZLW A;  5FFA A;  3UNO A;  4ERU A;  3E6R A;  2JD8 0;  1UMN A;  1Z6O A;  4PG1 A;  4LPN A;  4LYX A;  2PYB A;  4PG0 A;  3PVR A;  2V2I A;  4IWK A;  1H96 A;  4RC7 B;  4ZTT A;  5LG8 A;  5ERK A;  5K52 A;  3BT5 A;  5GU2 X;  3WNW A;  3Q4O A;  1ZUJ A;  4TOG A;  2ZA8 A;  2CLB A;  2F7N A;  1RCI A;  5GU3 X;  2CF7 A;  3BVE A;  3R2S A;  3PVY A;  3AJP A;  3ES3 A;  4LQN A;  3R2R A;  3NP0 X;  4IWJ A; 
#chains in the Genus database with same CATH topology
 4W4L B;  3RAV A;  4CYA A;  1JKU A;  3QVD A;  3A68 A;  2OC5 A;  2W0O A;  1VEI A;  4Y08 A;  4A25 A;  4QUW A;  3FI6 A;  1F30 A;  3W54 A;  1S2Z A;  1MFR A;  1JIG A;  3PZA A;  3R2L A;  4PGI A;  3F35 A;  4LPM A;  5IX6 A;  3VVA A;  3LKD A;  1RCC A;  3VV9 A;  3BKN A;  4KVS A;  3NP2 X;  4EVD A;  2V8T A;  2V15 A;  3TA8 A;  3SID A;  3PW1 B;  1QYB A;  2CHP A;  2IB0 A;  3E1J A;  3U90 A;  1JRE A;  3WVW A;  3F37 A;  5D8Q A;  5LS9 A;  2QF9 A;  4TOH A;  5C6F A;  1NF4 A;  3F32 A;  5JAC A;  2V2O A;  4EVB A;  2ZA6 A;  1RCE A;  2BJY A;  2WTL A;  2CN7 A;  4M32 A;  3AF8 X;  3M6J A;  3QB9 A;  4W4K B;  4LYU A;  3FSE A;  3F34 A;  1RYT A;  2ZG7 X;  3EZ0 A;  3ERZ A;  2ZUR X;  4TOE A;  4DZ0 A;  3E1N A;  4U3G A;  2ITB A;  2CLU A;  1JYB A;  4ZJK A;  2V2L A;  3R2M A;  3MPS A;  4WJG 4;  4TW3 A;  1JI5 A;  1BCF A;  1YUX A;  3GGZ A;  4ZMC A;  2CEI A;  4XKU A;  3RGD A;  1DVB A;  4TOA A;  3UFB A;  4YVZ A;  5HJH A;  5J8S A;  2G38 B;  3JZ9 A;  1TKP A;  3PVT A;  4ZL6 A;  3AF7 X;  4E6K A;  2XJO A;  5E1U A;  5FFD A;  3PW8 A;  1SOF A;  4RC6 A;  2YJJ A;  3AK8 A;  3C1Z A;  3IS7 A;  5JKM G;  2Z5R A;  4MXP A;  5FFB A;  4Z5S A;  3KA3 A;  5J93 A;  1UVH A;  3E1Q A;  5GN8 A;  1VJX A;  5ERJ A;  4ZKW A;  3QHC A;  3FRS A;  4CVR A;  1O9R A;  1TJO A;  4ITT A;  3D19 A;  2BK6 A;  5HQO A;  4LPJ A;  4MJY A;  1F33 A;  4M34 A;  2RBD A;  2C41 A;  4MY7 A;  2FG4 A;  1VLG A;  3Q4R A;  4DYU A;  4M33 A;  3E1P A;  1LKP A;  1IES A;  1LB3 A;  1BFR A;  4KVQ A;  2OKC A;  5D8P A;  1RCG A;  1YV1 A;  4RC6 B;  5D8O A;  3E1O A;  3PVR B;  5GOU A;  1R03 A;  4R42 A;  3SHX A;  1OTK A;  3KA8 A;  3F38 A;  5D8S A;  4AM4 A;  2HTN A;  2C2U A;  1VEQ A;  3ISE A;  4P18 A;  2FFX J;  4RC5 A;  4IXK A;  4KVR A;  4ZKX A;  1XZ1 A;  3BVK A;  3PWQ C;  4XKT A;  3KXU A;  2X17 0;  5JKL G;  2QQY A;  3E2C A;  3PVY B;  4AM5 A;  1BG7 A;  5I4J A;  1XZ3 A;  1N1Q A;  3AJQ A;  2FL0 A;  3RE7 A;  4E40 A;  3PW8 C;  2V2R A;  4TOD A;  1TKO A;  1EUM A;  1Z6O M;  4II4 A;  2G4H A;  3IQ1 A;  5K53 A;  5JKM A;  1S3Q A;  3O7S A;  3IS8 A;  3FRR A;  4REU A;  5J9V A;  3Q4N A;  5JDO A;  1HRS A;  3N6O A;  4YKH A;  4AM2 A;  2YW6 A;  2FG8 A;  4ISP A;  2D5K A;  5J8W A;  2C2F A;  1GWG A;  4TO9 A;  1J30 A;  2CHI A;  3R2K A;  2GYD A;  2CN6 A;  2VXI A;  3KA9 A;  5GU1 X;  3E1M A;  4ML5 A;  5LBH A;  3EGM A;  5LG2 A;  2V8U A;  3RD0 A;  1JGC A;  1L8I A;  2XJN A;  1FHA A;  1QGH A;  1YUZ A;  1LKM A;  4TOF A;  1NF6 A;  2VZB A;  3C1Y A;  4DI0 A;  5HJF A;  2V2P A;  3F33 A;  1JKV A;  4CMY A;  4M35 A;  4ETR A;  2C2J A;  4YXJ A;  3AK9 A;  5JDO B;  5CMR A;  3VNX A;  4PGK A;  3NOZ X;  1DPS A;  5D8X A;  2Y44 A;  3EZU A;  4RC8 A;  1NFV A;  3FVB A;  3OGH A;  4MN9 A;  4ZKH A;  3AF9 X;  5AXS A;  1RCD A;  4LQH A;  2Z5Q A;  4ZL5 A;  3KX9 A;  5FEJ A;  3RBC A;  3T9J A;  3SH6 A;  3WVV A;  3PVT B;  5JKL A;  3QHB A;  5D8R A;  5CZU A;  4DE6 A;  3R2H A;  4EVE A;  3BVF A;  4KXR B;  1TK6 A;  2FJC A;  3HL1 A;  4CY9 A;  2FHA A;  1IER A;  3UOI A;  2HR5 A;  3JZA B;  2V2M A;  1VEL A;  2BKC A;  2ZA7 A;  1LKO A;  1L8H A;  3PW1 A;  4LQV A;  5GN8 B;  3Q4Q A;  3BVL A;  5HU6 D;  3QD8 A;  1MOJ A;  4X0J A;  3BVI A;  4CYB A;  4ISM A;  2XJM A;  2YJK A;  4YXM A;  4LQJ A;  4DYZ A;  3GE4 A;  4TOB A;  4CVP A;  3F36 A;  3UOF A;  2WLA A;  4MUD A;  3GHQ A;  3KWO A;  5GU0 X;  3F39 A;  3SE1 A;  2OH3 A;  2ZG9 X;  3C23 A;  1S30 A;  4Z3B A;  1ZS3 A;  2XGW A;  1KRQ A;  2GYQ A;  3A9Q A;  3WVU A;  2WLU A;  1JI4 A;  3GVY A;  2FZF A;  1O9I A;  3E1L A;  1DAT A;  2VXX A;  3H7G A;  3ISF A;  2FKZ A;  3OJ5 A;  3QZ3 A;  2V2J A;  2IY4 A;  2IU2 A;  3AJO A;  3E6S A;  4RC5 B;  3O7R A;  2V2S A;  4CMY V;  1Z4A A;  1JTS A;  3C21 A;  4CVS A;  2Z6M A;  4OYN A;  5CMQ A;  4DYY A;  4MKU A;  4TOC A;  2C6R A;  3GGY A;  2CIH A;  1NNQ A;  2XKQ A;  2BW1 A;  4ITW A;  3KDQ A;  3KA4 A;  4XGS A;  4RC7 A;  2YW7 A;  2AR0 A;  3HIU A;  2Z90 A;  4DYX A;  3DBY A;  3R2O A;  2UX1 A;  3PWQ A;  5FFC A;  5E2D A;  2JD7 0;  5D8Y A;  2MGY A;  2V2N A;  4XKS A;  4CVT A;  1AEW A;  2GS4 A;  2Y3Q A;  2JD6 0;  3PWF A;  3KA6 A;  4II4 B;  4EVC A;  4DAS A;  2ZG8 X;  1B71 A;  2Z5P A;  5FFE A;  1SQ3 A;  4ZLW A;  5FFA A;  3UNO A;  4ERU A;  3E6R A;  2JD8 0;  1UMN A;  1Z6O A;  4PG1 A;  4LPN A;  4LYX A;  2PYB A;  4PG0 A;  3PVR A;  2V2I A;  4IWK A;  1H96 A;  3V3K B;  4RC7 B;  4ZTT A;  5LG8 A;  5ERK A;  5K52 A;  3BT5 A;  5GU2 X;  3WNW A;  3Q4O A;  1ZUJ A;  4TOG A;  3KHK A;  2ZA8 A;  2CLB A;  2CWL A;  2WWX B;  2F7N A;  1RCI A;  2N02 A;  3L0M A;  5GU3 X;  2CF7 A;  3BVE A;  3R2S A;  3PVY A;  3AJP A;  3ES3 A;  4LQN A;  3R2R A;  3NP0 X;  4IWJ A; 
#chains in the Genus database with same CATH homology
 4W4L B;  3RAV A;  4CYA A;  1JKU A;  3QVD A;  3A68 A;  2OC5 A;  2W0O A;  1VEI A;  4Y08 A;  4A25 A;  4QUW A;  3FI6 A;  1F30 A;  3W54 A;  1S2Z A;  1MFR A;  1JIG A;  3PZA A;  3R2L A;  4PGI A;  3F35 A;  4LPM A;  5IX6 A;  3VVA A;  3LKD A;  1RCC A;  3VV9 A;  3BKN A;  4KVS A;  3NP2 X;  4EVD A;  2V8T A;  2V15 A;  3TA8 A;  3SID A;  3PW1 B;  1QYB A;  2CHP A;  2IB0 A;  3E1J A;  3U90 A;  1JRE A;  3WVW A;  3F37 A;  5D8Q A;  5LS9 A;  2QF9 A;  4TOH A;  5C6F A;  1NF4 A;  3F32 A;  5JAC A;  2V2O A;  4EVB A;  2ZA6 A;  1RCE A;  2BJY A;  2WTL A;  2CN7 A;  4M32 A;  3AF8 X;  3M6J A;  3QB9 A;  4W4K B;  4LYU A;  3FSE A;  3F34 A;  1RYT A;  2ZG7 X;  3EZ0 A;  3ERZ A;  2ZUR X;  4TOE A;  4DZ0 A;  3E1N A;  4U3G A;  2ITB A;  2CLU A;  1JYB A;  4ZJK A;  2V2L A;  3R2M A;  3MPS A;  4WJG 4;  4TW3 A;  1JI5 A;  1BCF A;  1YUX A;  3GGZ A;  4ZMC A;  2CEI A;  4XKU A;  3RGD A;  1DVB A;  4TOA A;  3UFB A;  4YVZ A;  5HJH A;  5J8S A;  2G38 B;  3JZ9 A;  1TKP A;  3PVT A;  4ZL6 A;  3AF7 X;  4E6K A;  2XJO A;  5E1U A;  5FFD A;  3PW8 A;  1SOF A;  4RC6 A;  2YJJ A;  3AK8 A;  3C1Z A;  3IS7 A;  5JKM G;  2Z5R A;  4MXP A;  5FFB A;  4Z5S A;  3KA3 A;  5J93 A;  1UVH A;  3E1Q A;  5GN8 A;  1VJX A;  5ERJ A;  4ZKW A;  3QHC A;  3FRS A;  4CVR A;  1O9R A;  1TJO A;  4ITT A;  3D19 A;  2BK6 A;  5HQO A;  4LPJ A;  4MJY A;  1F33 A;  4M34 A;  2RBD A;  2C41 A;  4MY7 A;  2FG4 A;  1VLG A;  3Q4R A;  4DYU A;  4M33 A;  3E1P A;  1LKP A;  1IES A;  1LB3 A;  1BFR A;  4KVQ A;  2OKC A;  5D8P A;  1RCG A;  1YV1 A;  4RC6 B;  5D8O A;  3E1O A;  3PVR B;  5GOU A;  1R03 A;  4R42 A;  3SHX A;  1OTK A;  3KA8 A;  3F38 A;  5D8S A;  4AM4 A;  2HTN A;  2C2U A;  1VEQ A;  3ISE A;  4P18 A;  2FFX J;  4RC5 A;  4IXK A;  4KVR A;  4ZKX A;  1XZ1 A;  3BVK A;  3PWQ C;  4XKT A;  3KXU A;  2X17 0;  5JKL G;  2QQY A;  3E2C A;  3PVY B;  4AM5 A;  1BG7 A;  5I4J A;  1XZ3 A;  1N1Q A;  3AJQ A;  2FL0 A;  3RE7 A;  4E40 A;  3PW8 C;  2V2R A;  4TOD A;  1TKO A;  1EUM A;  1Z6O M;  4II4 A;  2G4H A;  3IQ1 A;  5K53 A;  5JKM A;  1S3Q A;  3O7S A;  3IS8 A;  3FRR A;  4REU A;  5J9V A;  3Q4N A;  5JDO A;  1HRS A;  3N6O A;  4YKH A;  4AM2 A;  2YW6 A;  2FG8 A;  4ISP A;  2D5K A;  5J8W A;  2C2F A;  1GWG A;  4TO9 A;  1J30 A;  2CHI A;  3R2K A;  2GYD A;  2CN6 A;  2VXI A;  3KA9 A;  5GU1 X;  3E1M A;  4ML5 A;  5LBH A;  3EGM A;  5LG2 A;  2V8U A;  3RD0 A;  1JGC A;  1L8I A;  2XJN A;  1FHA A;  1QGH A;  1YUZ A;  1LKM A;  4TOF A;  1NF6 A;  2VZB A;  3C1Y A;  4DI0 A;  5HJF A;  2V2P A;  3F33 A;  1JKV A;  4CMY A;  4M35 A;  4ETR A;  2C2J A;  4YXJ A;  3AK9 A;  5JDO B;  5CMR A;  3VNX A;  4PGK A;  3NOZ X;  1DPS A;  5D8X A;  2Y44 A;  3EZU A;  4RC8 A;  1NFV A;  3FVB A;  3OGH A;  4MN9 A;  4ZKH A;  3AF9 X;  5AXS A;  1RCD A;  4LQH A;  2Z5Q A;  4ZL5 A;  3KX9 A;  5FEJ A;  3RBC A;  3T9J A;  3SH6 A;  3WVV A;  3PVT B;  5JKL A;  3QHB A;  5D8R A;  5CZU A;  4DE6 A;  3R2H A;  4EVE A;  3BVF A;  4KXR B;  1TK6 A;  2FJC A;  3HL1 A;  4CY9 A;  2FHA A;  1IER A;  3UOI A;  2HR5 A;  3JZA B;  2V2M A;  1VEL A;  2BKC A;  2ZA7 A;  1LKO A;  1L8H A;  3PW1 A;  4LQV A;  5GN8 B;  3Q4Q A;  3BVL A;  5HU6 D;  3QD8 A;  1MOJ A;  4X0J A;  3BVI A;  4CYB A;  4ISM A;  2XJM A;  2YJK A;  4YXM A;  4LQJ A;  4DYZ A;  3GE4 A;  4TOB A;  4CVP A;  3F36 A;  3UOF A;  2WLA A;  4MUD A;  3GHQ A;  3KWO A;  5GU0 X;  3F39 A;  3SE1 A;  2OH3 A;  2ZG9 X;  3C23 A;  1S30 A;  4Z3B A;  1ZS3 A;  2XGW A;  1KRQ A;  2GYQ A;  3A9Q A;  3WVU A;  2WLU A;  1JI4 A;  3GVY A;  2FZF A;  1O9I A;  3E1L A;  1DAT A;  2VXX A;  3H7G A;  3ISF A;  2FKZ A;  3OJ5 A;  3QZ3 A;  2V2J A;  2IY4 A;  2IU2 A;  3AJO A;  3E6S A;  4RC5 B;  3O7R A;  2V2S A;  4CMY V;  1Z4A A;  1JTS A;  3C21 A;  4CVS A;  2Z6M A;  4OYN A;  5CMQ A;  4DYY A;  4MKU A;  4TOC A;  2C6R A;  3GGY A;  2CIH A;  1NNQ A;  2XKQ A;  2BW1 A;  4ITW A;  3KDQ A;  3KA4 A;  4XGS A;  4RC7 A;  2YW7 A;  2AR0 A;  3HIU A;  2Z90 A;  4DYX A;  3DBY A;  3R2O A;  2UX1 A;  3PWQ A;  5FFC A;  5E2D A;  2JD7 0;  5D8Y A;  2MGY A;  2V2N A;  4XKS A;  4CVT A;  1AEW A;  2GS4 A;  2Y3Q A;  2JD6 0;  3PWF A;  3KA6 A;  4II4 B;  4EVC A;  4DAS A;  2ZG8 X;  1B71 A;  2Z5P A;  5FFE A;  1SQ3 A;  4ZLW A;  5FFA A;  3UNO A;  4ERU A;  3E6R A;  2JD8 0;  1UMN A;  1Z6O A;  4PG1 A;  4LPN A;  4LYX A;  2PYB A;  4PG0 A;  3PVR A;  2V2I A;  4IWK A;  1H96 A;  3V3K B;  4RC7 B;  4ZTT A;  5LG8 A;  5ERK A;  5K52 A;  3BT5 A;  5GU2 X;  3WNW A;  3Q4O A;  1ZUJ A;  4TOG A;  3KHK A;  2ZA8 A;  2CLB A;  2CWL A;  2WWX B;  2F7N A;  1RCI A;  2N02 A;  3L0M A;  5GU3 X;  2CF7 A;  3BVE A;  3R2S A;  3PVY A;  3AJP A;  3ES3 A;  4LQN A;  3R2R A;  3NP0 X;  4IWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...