1UMNA

Crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
151
structure length
151
Chain Sequence
LADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peroxide resistance
molecule keywords DPS-LIKE PEROXIDE RESISTANCE PROTEIN
publication title Crystal structure of Streptococcus suis Dps-like peroxide resistance protein Dpr: implications for iron incorporation.
pubmed doi rcsb
source organism Streptococcus suis
total genus 66
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1umnA00
4LYUA 1B71A 3FVBA 1XZ3A 4RC6B 1OTKA 3WVUA 1NF4A 3FSEA 3VNXA 4RC6A 4M34A 3SH6A 4DYXA 3E2CA 2C41A 5HJFA 1BCFA 1VEQA 1L8IA 2JD70 5LBHA 3RAVA 3BT5A 4M35A 4DYZA 1RCGA 4LPMA 2C2UA 3Q4OA 2ZG8X 4E6KA 2YW6A 1UMNA 5JKLA 1VJXA 4DE6A 3AJQA 4EVEA 4LQJA 1DVBA 3PZAA 4PG1A 4KVQA 4ZL6A 4AM4A 3EGMA 2HR5A 4ITTA 2Z5PA 5D8OA 3R2KA 4ZMCA 3F37A 2XGWA 2C6RA 2FZFA 5CZUA 5D8QA 4XKUA 5GOUA 5FFEA 1RCEA 4PG0A 4M33A 3H7GA 2YW7A 3UNOA 2RBDA 1R03A 3O7RA 4DYYA 1TKPA 4LQHA 4ML5A 3F36A 3SHXA 4CVSA 2V15A 3PVYB 3E1MA 4XGSA 3IQ1A 1VEIA 4IWKA 3PVYA 3RGDA 2V2NA 4KVSA 4ZLWA 1GWGA 2WTLA 4EVCA 2FHAA 1O9IA 4ZL5A 3WNWA 3F38A 4TOEA 3ERZA 4TW3A 4DASA 4OYNA 5J9VA 5J8SA 4EVDA 4LYXA 3F35A 1SOFA 3PWQA 2FFXJ 1LKOA 1XZ1A 1MOJA 3AF8X 1JKUA 4TOAA 1TK6A 1H96A 3ISFA 3PW1B 1RCDA 1S30A 2Z5RA 1DPSA 2FJCA 3PW1A 3KWOA 2V2PA 2CHPA 2BKCA 4ETRA 5LG2A 3KA3A 1UVHA 2CLUA 1JI5A 3QZ3A 1YV1A 4ZKWA 3KXUA 2Z5QA 3U90A 3F33A 2W0OA 2ITBA 4Z3BA 2ZG7X 1JREA 2PYBA 4ISPA 3E6SA 4DYUA 1L8HA 1NNQA 4R42A 1TKOA 3AK9A 5ERJA 3BVFA 3E1JA 4TOFA 1SQ3A 5FFDA 3RBCA 5D8SA 5ERKA 3HIUA 3R2SA 3ES3A 2YJJA 5GU1X 4TOGA 4Z5SA 3AF9X 3PWFA 2C2JA 5GN8B 3FI6A 2GYDA 5GN8A 5GU2X 2XKQA 3R2RA 4CYBA 4ERUA 2JD80 2V2IA 2XJMA 4QUWA 1JGCA 1KRQA 4TOBA 3RE7A 3NP2X 3GVYA 2OC5A 2QF9A 1QGHA 2V2LA 4CMYA 1VLGA 3PVRA 2YJKA 2VXXA 3E1LA 5D8YA 4DZ0A 1BFRA 3QB9A 4LQVA 5IX6A 2OH3A 4ZTTA 3F34A 3SE1A 5J8WA 3NOZX 4EVBA 5AXSA 2UX1A 1JIGA 4TO9A 1DATA 3OJ5A 5GU3X 1J30A 4MJYA 4PGIA 3UOIA 4YKHA 3QHBA 2GYQA 1IESA 5JACA 5LG8A 3Q4NA 1YUZA 2ZA6A 4AM5A 3NP0X 3EZ0A 3E1PA 3IS8A 2XJNA 3PVTB 3PWQC 3TA8A 4P18A 2ZG9X 3PVTA 1LKPA 3BVLA 3E1OA 1VELA 4CVRA 1JYBA 5E1UA 1RCCA 1F30A 3T9JA 4RC7B 3UOFA 3R2OA 4ZKXA 2FG4A 2GS4A 4RC7A 5GU0X 3O7SA 4DI0A 2ZA8A 4TOCA 4PGKA 1O9RA 4CMYV 4IWJA 2BK6A 2BW1A 4U3GA 5HJHA 5JKMG 5C6FA 3Q4RA 2FG8A 1JKVA 4XKSA 4LPNA 3PW8A 3ISEA 3F32A 2IB0A 2CIHA 3R2LA 4KVRA 2V2RA 4ZJKA 3Q4QA 2FL0A 4RC5B 1AEWA 1FHAA 4ITWA 2QQYA 4RC5A 1LKMA 2FKZA 2V2JA 3AK8A 1YUXA 1LB3A 3A9QA 1RCIA 5D8RA 3BVEA 2V2OA 2CN7A 3E1NA 2VZBA 3EZUA 1MFRA 5FEJA 4TODA 5D8XA 5JKMA 4ISMA 3KA8A 1JI4A 3PVRB 3BKNA 2G4HA 4XKTA 3A68A 2D5KA 4MUDA 1ZUJA 1Z6OA 2WLUA 5K53A 3KA9A 2CHIA 3MPSA 4CVTA 2HTNA 2X170 5HQOA 2ZURX 5CMRA 2VXIA 3F39A 2Z90A 3QVDA 1S2ZA 3E1QA 2Y3QA 2XJOA 4AM2A 2WLAA 1ZS3A 3WVWA 5D8PA 3KA4A 3SIDA 4A25A 2CEIA 4REUA 2F7NA 1RYTA 1EUMA 3GHQA 3R2MA 3AJOA 4MKUA 5K52A 1JTSA 4RC8A 4IXKA 2IU2A 4LPJA 2ZA7A 5FFAA 1NF6A 3QHCA 3AJPA 1HRSA 2CN6A 4LQNA 2IY4A 3BVKA 2JD60 4II4B 5LS9A 1BG7A 1N1QA 4II4A 3E6RA 4MN9A 5FFBA 1S3QA 1F33A 4ZKHA 5J93A 3IS7A 3GE4A 3WVVA 3KA6A 2V2MA 5I4JA 5E2DA 1NFVA 1Z6OM 4MY7A 5CMQA 3QD8A 2Z6MA 3KX9A 3R2HA 2BJYA 3RD0A 4CY9A 1QYBA 1Z4AA 3HL1A 1TJOA 4TOHA 3OGHA 5FFCA 2CLBA 2V2SA 5JKLG 3BVIA 4CYAA 2CF7A 4CVPA 3AF7X 2C2FA 1IERA 4Y08A 3PW8C 4M32A
chains in the Genus database with same CATH superfamily
4LYUA 1B71A 3FVBA 1XZ3A 4RC6B 1OTKA 3WVUA 1NF4A 3FSEA 3VNXA 4RC6A 4M34A 3SH6A 4DYXA 3E2CA 2C41A 2N02A 5HJFA 1BCFA 4E40A 1VEQA 1L8IA 2JD70 5LBHA 3RAVA 3BT5A 4M35A 4DYZA 1RCGA 4LPMA 3KDQA 2C2UA 3Q4OA 2ZG8X 4E6KA 2YW6A 4YXJA 1UMNA 5JKLA 1VJXA 4DE6A 3AJQA 3FRRA 4EVEA 4LQJA 1DVBA 3PZAA 4PG1A 4KVQA 2Y44A 4ZL6A 4AM4A 3EGMA 2HR5A 4ITTA 2Z5PA 5D8OA 3R2KA 4ZMCA 3F37A 2XGWA 2C6RA 2FZFA 5CZUA 5D8QA 4XKUA 5GOUA 5FFEA 1RCEA 4PG0A 3N6OA 4M33A 3H7GA 2YW7A 3UNOA 2RBDA 1R03A 2MGYA 3O7RA 4DYYA 1TKPA 4LQHA 4ML5A 5JDOB 3W54A 3F36A 3SHXA 4CVSA 2V15A 3PVYB 3E1MA 4XGSA 3IQ1A 5JDOA 1VEIA 4IWKA 3PVYA 3RGDA 2V2NA 4KVSA 4ZLWA 1GWGA 3C1ZA 2WTLA 4YVZA 4EVCA 2FHAA 1O9IA 4ZL5A 3WNWA 3F38A 4TOEA 3ERZA 4TW3A 4DASA 3JZAB 4OYNA 5J9VA 5J8SA 4EVDA 4LYXA 3F35A 1SOFA 3PWQA 2FFXJ 1LKOA 1XZ1A 1MOJA 3AF8X 1JKUA 4TOAA 1TK6A 1H96A 3ISFA 3PW1B 2G38B 1RCDA 1S30A 2Z5RA 1DPSA 2FJCA 3PW1A 3KWOA 2V2PA 2CHPA 2BKCA 4ETRA 5LG2A 3KA3A 1UVHA 2CLUA 1JI5A 3QZ3A 1YV1A 4ZKWA 3KXUA 2Z5QA 3U90A 3F33A 2W0OA 2ITBA 4Z3BA 2ZG7X 1JREA 2PYBA 4ISPA 3E6SA 4DYUA 1L8HA 1NNQA 4R42A 1TKOA 3AK9A 5ERJA 2OKCA 3BVFA 3E1JA 4TOFA 1SQ3A 5FFDA 3RBCA 3VVAA 5D8SA 5ERKA 2AR0A 3HIUA 3R2SA 3ES3A 2YJJA 5GU1X 4TOGA 4Z5SA 3AF9X 3PWFA 2C2JA 5GN8B 3FI6A 2GYDA 5GN8A 5GU2X 4MXPA 2XKQA 3R2RA 4CYBA 4ERUA 2JD80 2V2IA 2XJMA 3C21A 3V3KB 4QUWA 1JGCA 1KRQA 4TOBA 3RE7A 3NP2X 3GVYA 3D19A 2OC5A 2QF9A 1QGHA 2V2LA 4CMYA 1VLGA 3PVRA 2YJKA 3C1YA 2VXXA 3E1LA 5D8YA 4DZ0A 1BFRA 3QB9A 2CWLA 4LQVA 5IX6A 2OH3A 4ZTTA 3F34A 3SE1A 5J8WA 3NOZX 4EVBA 5AXSA 2UX1A 1JIGA 4TO9A 1DATA 3OJ5A 5GU3X 1J30A 4MJYA 4PGIA 3UOIA 4YKHA 3QHBA 2GYQA 1IESA 5JACA 5LG8A 3Q4NA 4W4KB 1YUZA 2ZA6A 4W4LB 4AM5A 3NP0X 3FRSA 3EZ0A 3E1PA 3IS8A 2XJNA 3PVTB 3PWQC 3TA8A 4KXRB 4P18A 2ZG9X 3PVTA 1LKPA 4YXMA 3BVLA 3E1OA 1VELA 4CVRA 5HU6D 1JYBA 5E1UA 1RCCA 1F30A 3T9JA 4RC7B 3UOFA 3R2OA 4ZKXA 2FG4A 2GS4A 4RC7A 5GU0X 3O7SA 4DI0A 2WWXB 2ZA8A 4TOCA 4PGKA 1O9RA 4CMYV 4IWJA 2BK6A 2BW1A 3M6JA 4U3GA 5HJHA 5JKMG 5C6FA 3Q4RA 2FG8A 3LKDA 1JKVA 4XKSA 4LPNA 3C23A 3PW8A 3ISEA 3F32A 2IB0A 2CIHA 3R2LA 4KVRA 2V2RA 4ZJKA 3Q4QA 2FL0A 4RC5B 1AEWA 1FHAA 4ITWA 2QQYA 2V8UA 4RC5A 1LKMA 2FKZA 2V2JA 3AK8A 1YUXA 1LB3A 3A9QA 1RCIA 5D8RA 3BVEA 2V2OA 2CN7A 3E1NA 2VZBA 3EZUA 1MFRA 5FEJA 3GGYA 4TODA 5D8XA 5JKMA 4ISMA 3KA8A 1JI4A 3PVRB 3BKNA 2G4HA 4XKTA 3A68A 2D5KA 4MUDA 1ZUJA 3UFBA 1Z6OA 2WLUA 5K53A 3KA9A 2CHIA 3MPSA 3DBYA 4CVTA 2HTNA 2X170 5HQOA 2ZURX 5CMRA 2VXIA 3F39A 2Z90A 3QVDA 1S2ZA 3E1QA 2Y3QA 2XJOA 4AM2A 2WLAA 1ZS3A 4X0JA 3WVWA 5D8PA 3KA4A 3SIDA 4A25A 2CEIA 4REUA 2F7NA 1RYTA 1EUMA 3GHQA 3R2MA 3AJOA 4MKUA 5K52A 3JZ9A 1JTSA 4RC8A 4IXKA 2IU2A 4LPJA 2ZA7A 5FFAA 1NF6A 3QHCA 3AJPA 1HRSA 2CN6A 4LQNA 2IY4A 3BVKA 2JD60 4II4B 5LS9A 1BG7A 1N1QA 4II4A 3E6RA 4MN9A 5FFBA 1S3QA 1F33A 3L0MA 4ZKHA 5J93A 3IS7A 3GE4A 3WVVA 3KA6A 2V2MA 5I4JA 5E2DA 1NFVA 1Z6OM 4MY7A 5CMQA 3QD8A 3VV9A 2Z6MA 3KX9A 3R2HA 2BJYA 3RD0A 4CY9A 1QYBA 1Z4AA 3HL1A 1TJOA 4TOHA 3OGHA 5FFCA 2CLBA 2V2SA 5JKLG 2V8TA 3BVIA 4CYAA 2CF7A 4WJG4 4CVPA 3AF7X 2C2FA 1IERA 4Y08A 3GGZA 3KHKA 3PW8C 4M32A
chains in the Genus database with same CATH topology
4LYUA 1B71A 3FVBA 1XZ3A 4RC6B 1OTKA 3WVUA 1NF4A 3FSEA 3VNXA 4RC6A 4M34A 3SH6A 4DYXA 3E2CA 2C41A 2N02A 5HJFA 1BCFA 4E40A 1VEQA 1L8IA 2JD70 5LBHA 3RAVA 3BT5A 4M35A 4DYZA 1RCGA 4LPMA 3KDQA 2C2UA 3Q4OA 2ZG8X 4E6KA 2YW6A 4YXJA 1UMNA 5JKLA 1VJXA 4DE6A 3AJQA 3FRRA 4EVEA 4LQJA 1DVBA 3PZAA 4PG1A 4KVQA 2Y44A 4ZL6A 4AM4A 3EGMA 2HR5A 4ITTA 2Z5PA 5D8OA 3R2KA 4ZMCA 3F37A 2XGWA 2C6RA 2FZFA 5CZUA 5D8QA 4XKUA 5GOUA 5FFEA 1RCEA 4PG0A 3N6OA 4M33A 3H7GA 2YW7A 3UNOA 2RBDA 1R03A 2MGYA 3O7RA 4DYYA 1TKPA 4LQHA 4ML5A 5JDOB 3W54A 3F36A 3SHXA 4CVSA 2V15A 3PVYB 3E1MA 4XGSA 3IQ1A 5JDOA 1VEIA 4IWKA 3PVYA 3RGDA 2V2NA 4KVSA 4ZLWA 1GWGA 3C1ZA 2WTLA 4YVZA 4EVCA 2FHAA 1O9IA 4ZL5A 3WNWA 3F38A 4TOEA 3ERZA 4TW3A 4DASA 3JZAB 4OYNA 5J9VA 5J8SA 4EVDA 4LYXA 3F35A 1SOFA 3PWQA 2FFXJ 1LKOA 1XZ1A 1MOJA 3AF8X 1JKUA 4TOAA 1TK6A 1H96A 3ISFA 3PW1B 2G38B 1RCDA 1S30A 2Z5RA 1DPSA 2FJCA 3PW1A 3KWOA 2V2PA 2CHPA 2BKCA 4ETRA 5LG2A 3KA3A 1UVHA 2CLUA 1JI5A 3QZ3A 1YV1A 4ZKWA 3KXUA 2Z5QA 3U90A 3F33A 2W0OA 2ITBA 4Z3BA 2ZG7X 1JREA 2PYBA 4ISPA 3E6SA 4DYUA 1L8HA 1NNQA 4R42A 1TKOA 3AK9A 5ERJA 2OKCA 3BVFA 3E1JA 4TOFA 1SQ3A 5FFDA 3RBCA 3VVAA 5D8SA 5ERKA 2AR0A 3HIUA 3R2SA 3ES3A 2YJJA 5GU1X 4TOGA 4Z5SA 3AF9X 3PWFA 2C2JA 5GN8B 3FI6A 2GYDA 5GN8A 5GU2X 4MXPA 2XKQA 3R2RA 4CYBA 4ERUA 2JD80 2V2IA 2XJMA 3C21A 3V3KB 4QUWA 1JGCA 1KRQA 4TOBA 3RE7A 3NP2X 3GVYA 3D19A 2OC5A 2QF9A 1QGHA 2V2LA 4CMYA 1VLGA 3PVRA 2YJKA 3C1YA 2VXXA 3E1LA 5D8YA 4DZ0A 1BFRA 3QB9A 2CWLA 4LQVA 5IX6A 2OH3A 4ZTTA 3F34A 3SE1A 5J8WA 3NOZX 4EVBA 5AXSA 2UX1A 1JIGA 4TO9A 1DATA 3OJ5A 5GU3X 1J30A 4MJYA 4PGIA 3UOIA 4YKHA 3QHBA 2GYQA 1IESA 5JACA 5LG8A 3Q4NA 4W4KB 1YUZA 2ZA6A 4W4LB 4AM5A 3NP0X 3FRSA 3EZ0A 3E1PA 3IS8A 2XJNA 3PVTB 3PWQC 3TA8A 4KXRB 4P18A 2ZG9X 3PVTA 1LKPA 4YXMA 3BVLA 3E1OA 1VELA 4CVRA 5HU6D 1JYBA 5E1UA 1RCCA 1F30A 3T9JA 4RC7B 3UOFA 3R2OA 4ZKXA 2FG4A 2GS4A 4RC7A 5GU0X 3O7SA 4DI0A 2WWXB 2ZA8A 4TOCA 4PGKA 1O9RA 4CMYV 4IWJA 2BK6A 2BW1A 3M6JA 4U3GA 5HJHA 5JKMG 5C6FA 3Q4RA 2FG8A 3LKDA 1JKVA 4XKSA 4LPNA 3C23A 3PW8A 3ISEA 3F32A 2IB0A 2CIHA 3R2LA 4KVRA 2V2RA 4ZJKA 3Q4QA 2FL0A 4RC5B 1AEWA 1FHAA 4ITWA 2QQYA 2V8UA 4RC5A 1LKMA 2FKZA 2V2JA 3AK8A 1YUXA 1LB3A 3A9QA 1RCIA 5D8RA 3BVEA 2V2OA 2CN7A 3E1NA 2VZBA 3EZUA 1MFRA 5FEJA 3GGYA 4TODA 5D8XA 5JKMA 4ISMA 3KA8A 1JI4A 3PVRB 3BKNA 2G4HA 4XKTA 3A68A 2D5KA 4MUDA 1ZUJA 3UFBA 1Z6OA 2WLUA 5K53A 3KA9A 2CHIA 3MPSA 3DBYA 4CVTA 2HTNA 2X170 5HQOA 2ZURX 5CMRA 2VXIA 3F39A 2Z90A 3QVDA 1S2ZA 3E1QA 2Y3QA 2XJOA 4AM2A 2WLAA 1ZS3A 4X0JA 3WVWA 5D8PA 3KA4A 3SIDA 4A25A 2CEIA 4REUA 2F7NA 1RYTA 1EUMA 3GHQA 3R2MA 3AJOA 4MKUA 5K52A 3JZ9A 1JTSA 4RC8A 4IXKA 2IU2A 4LPJA 2ZA7A 5FFAA 1NF6A 3QHCA 3AJPA 1HRSA 2CN6A 4LQNA 2IY4A 3BVKA 2JD60 4II4B 5LS9A 1BG7A 1N1QA 4II4A 3E6RA 4MN9A 5FFBA 1S3QA 1F33A 3L0MA 4ZKHA 5J93A 3IS7A 3GE4A 3WVVA 3KA6A 2V2MA 5I4JA 5E2DA 1NFVA 1Z6OM 4MY7A 5CMQA 3QD8A 3VV9A 2Z6MA 3KX9A 3R2HA 2BJYA 3RD0A 4CY9A 1QYBA 1Z4AA 3HL1A 1TJOA 4TOHA 3OGHA 5FFCA 2CLBA 2V2SA 5JKLG 2V8TA 3BVIA 4CYAA 2CF7A 4WJG4 4CVPA 3AF7X 2C2FA 1IERA 4Y08A 3GGZA 3KHKA 3PW8C 4M32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LYU A;  1B71 A;  3FVB A;  1XZ3 A;  4RC6 B;  1OTK A;  3WVU A;  1NF4 A;  3FSE A;  3VNX A;  4RC6 A;  4M34 A;  3SH6 A;  4DYX A;  3E2C A;  2C41 A;  5HJF A;  1BCF A;  1VEQ A;  1L8I A;  2JD7 0;  5LBH A;  3RAV A;  3BT5 A;  4M35 A;  4DYZ A;  1RCG A;  4LPM A;  2C2U A;  3Q4O A;  2ZG8 X;  4E6K A;  2YW6 A;  1UMN A;  5JKL A;  1VJX A;  4DE6 A;  3AJQ A;  4EVE A;  4LQJ A;  1DVB A;  3PZA A;  4PG1 A;  4KVQ A;  4ZL6 A;  4AM4 A;  3EGM A;  2HR5 A;  4ITT A;  2Z5P A;  5D8O A;  3R2K A;  4ZMC A;  3F37 A;  2XGW A;  2C6R A;  2FZF A;  5CZU A;  5D8Q A;  4XKU A;  5GOU A;  5FFE A;  1RCE A;  4PG0 A;  4M33 A;  3H7G A;  2YW7 A;  3UNO A;  2RBD A;  1R03 A;  3O7R A;  4DYY A;  1TKP A;  4LQH A;  4ML5 A;  3F36 A;  3SHX A;  4CVS A;  2V15 A;  3PVY B;  3E1M A;  4XGS A;  3IQ1 A;  1VEI A;  4IWK A;  3PVY A;  3RGD A;  2V2N A;  4KVS A;  4ZLW A;  1GWG A;  2WTL A;  4EVC A;  2FHA A;  1O9I A;  4ZL5 A;  3WNW A;  3F38 A;  4TOE A;  3ERZ A;  4TW3 A;  4DAS A;  4OYN A;  5J9V A;  5J8S A;  4EVD A;  4LYX A;  3F35 A;  1SOF A;  3PWQ A;  2FFX J;  1LKO A;  1XZ1 A;  1MOJ A;  3AF8 X;  1JKU A;  4TOA A;  1TK6 A;  1H96 A;  3ISF A;  3PW1 B;  1RCD A;  1S30 A;  2Z5R A;  1DPS A;  2FJC A;  3PW1 A;  3KWO A;  2V2P A;  2CHP A;  2BKC A;  4ETR A;  5LG2 A;  3KA3 A;  1UVH A;  2CLU A;  1JI5 A;  3QZ3 A;  1YV1 A;  4ZKW A;  3KXU A;  2Z5Q A;  3U90 A;  3F33 A;  2W0O A;  2ITB A;  4Z3B A;  2ZG7 X;  1JRE A;  2PYB A;  4ISP A;  3E6S A;  4DYU A;  1L8H A;  1NNQ A;  4R42 A;  1TKO A;  3AK9 A;  5ERJ A;  3BVF A;  3E1J A;  4TOF A;  1SQ3 A;  5FFD A;  3RBC A;  5D8S A;  5ERK A;  3HIU A;  3R2S A;  3ES3 A;  2YJJ A;  5GU1 X;  4TOG A;  4Z5S A;  3AF9 X;  3PWF A;  2C2J A;  5GN8 B;  3FI6 A;  2GYD A;  5GN8 A;  5GU2 X;  2XKQ A;  3R2R A;  4CYB A;  4ERU A;  2JD8 0;  2V2I A;  2XJM A;  4QUW A;  1JGC A;  1KRQ A;  4TOB A;  3RE7 A;  3NP2 X;  3GVY A;  2OC5 A;  2QF9 A;  1QGH A;  2V2L A;  4CMY A;  1VLG A;  3PVR A;  2YJK A;  2VXX A;  3E1L A;  5D8Y A;  4DZ0 A;  1BFR A;  3QB9 A;  4LQV A;  5IX6 A;  2OH3 A;  4ZTT A;  3F34 A;  3SE1 A;  5J8W A;  3NOZ X;  4EVB A;  5AXS A;  2UX1 A;  1JIG A;  4TO9 A;  1DAT A;  3OJ5 A;  5GU3 X;  1J30 A;  4MJY A;  4PGI A;  3UOI A;  4YKH A;  3QHB A;  2GYQ A;  1IES A;  5JAC A;  5LG8 A;  3Q4N A;  1YUZ A;  2ZA6 A;  4AM5 A;  3NP0 X;  3EZ0 A;  3E1P A;  3IS8 A;  2XJN A;  3PVT B;  3PWQ C;  3TA8 A;  4P18 A;  2ZG9 X;  3PVT A;  1LKP A;  3BVL A;  3E1O A;  1VEL A;  4CVR A;  1JYB A;  5E1U A;  1RCC A;  1F30 A;  3T9J A;  4RC7 B;  3UOF A;  3R2O A;  4ZKX A;  2FG4 A;  2GS4 A;  4RC7 A;  5GU0 X;  3O7S A;  4DI0 A;  2ZA8 A;  4TOC A;  4PGK A;  1O9R A;  4CMY V;  4IWJ A;  2BK6 A;  2BW1 A;  4U3G A;  5HJH A;  5JKM G;  5C6F A;  3Q4R A;  2FG8 A;  1JKV A;  4XKS A;  4LPN A;  3PW8 A;  3ISE A;  3F32 A;  2IB0 A;  2CIH A;  3R2L A;  4KVR A;  2V2R A;  4ZJK A;  3Q4Q A;  2FL0 A;  4RC5 B;  1AEW A;  1FHA A;  4ITW A;  2QQY A;  4RC5 A;  1LKM A;  2FKZ A;  2V2J A;  3AK8 A;  1YUX A;  1LB3 A;  3A9Q A;  1RCI A;  5D8R A;  3BVE A;  2V2O A;  2CN7 A;  3E1N A;  2VZB A;  3EZU A;  1MFR A;  5FEJ A;  4TOD A;  5D8X A;  5JKM A;  4ISM A;  3KA8 A;  1JI4 A;  3PVR B;  3BKN A;  2G4H A;  4XKT A;  3A68 A;  2D5K A;  4MUD A;  1ZUJ A;  1Z6O A;  2WLU A;  5K53 A;  3KA9 A;  2CHI A;  3MPS A;  4CVT A;  2HTN A;  2X17 0;  5HQO A;  2ZUR X;  5CMR A;  2VXI A;  3F39 A;  2Z90 A;  3QVD A;  1S2Z A;  3E1Q A;  2Y3Q A;  2XJO A;  4AM2 A;  2WLA A;  1ZS3 A;  3WVW A;  5D8P A;  3KA4 A;  3SID A;  4A25 A;  2CEI A;  4REU A;  2F7N A;  1RYT A;  1EUM A;  3GHQ A;  3R2M A;  3AJO A;  4MKU A;  5K52 A;  1JTS A;  4RC8 A;  4IXK A;  2IU2 A;  4LPJ A;  2ZA7 A;  5FFA A;  1NF6 A;  3QHC A;  3AJP A;  1HRS A;  2CN6 A;  4LQN A;  2IY4 A;  3BVK A;  2JD6 0;  4II4 B;  5LS9 A;  1BG7 A;  1N1Q A;  4II4 A;  3E6R A;  4MN9 A;  5FFB A;  1S3Q A;  1F33 A;  4ZKH A;  5J93 A;  3IS7 A;  3GE4 A;  3WVV A;  3KA6 A;  2V2M A;  5I4J A;  5E2D A;  1NFV A;  1Z6O M;  4MY7 A;  5CMQ A;  3QD8 A;  2Z6M A;  3KX9 A;  3R2H A;  2BJY A;  3RD0 A;  4CY9 A;  1QYB A;  1Z4A A;  3HL1 A;  1TJO A;  4TOH A;  3OGH A;  5FFC A;  2CLB A;  2V2S A;  5JKL G;  3BVI A;  4CYA A;  2CF7 A;  4CVP A;  3AF7 X;  2C2F A;  1IER A;  4Y08 A;  3PW8 C;  4M32 A; 
#chains in the Genus database with same CATH topology
 4LYU A;  1B71 A;  3FVB A;  1XZ3 A;  4RC6 B;  1OTK A;  3WVU A;  1NF4 A;  3FSE A;  3VNX A;  4RC6 A;  4M34 A;  3SH6 A;  4DYX A;  3E2C A;  2C41 A;  2N02 A;  5HJF A;  1BCF A;  4E40 A;  1VEQ A;  1L8I A;  2JD7 0;  5LBH A;  3RAV A;  3BT5 A;  4M35 A;  4DYZ A;  1RCG A;  4LPM A;  3KDQ A;  2C2U A;  3Q4O A;  2ZG8 X;  4E6K A;  2YW6 A;  4YXJ A;  1UMN A;  5JKL A;  1VJX A;  4DE6 A;  3AJQ A;  3FRR A;  4EVE A;  4LQJ A;  1DVB A;  3PZA A;  4PG1 A;  4KVQ A;  2Y44 A;  4ZL6 A;  4AM4 A;  3EGM A;  2HR5 A;  4ITT A;  2Z5P A;  5D8O A;  3R2K A;  4ZMC A;  3F37 A;  2XGW A;  2C6R A;  2FZF A;  5CZU A;  5D8Q A;  4XKU A;  5GOU A;  5FFE A;  1RCE A;  4PG0 A;  3N6O A;  4M33 A;  3H7G A;  2YW7 A;  3UNO A;  2RBD A;  1R03 A;  2MGY A;  3O7R A;  4DYY A;  1TKP A;  4LQH A;  4ML5 A;  5JDO B;  3W54 A;  3F36 A;  3SHX A;  4CVS A;  2V15 A;  3PVY B;  3E1M A;  4XGS A;  3IQ1 A;  5JDO A;  1VEI A;  4IWK A;  3PVY A;  3RGD A;  2V2N A;  4KVS A;  4ZLW A;  1GWG A;  3C1Z A;  2WTL A;  4YVZ A;  4EVC A;  2FHA A;  1O9I A;  4ZL5 A;  3WNW A;  3F38 A;  4TOE A;  3ERZ A;  4TW3 A;  4DAS A;  3JZA B;  4OYN A;  5J9V A;  5J8S A;  4EVD A;  4LYX A;  3F35 A;  1SOF A;  3PWQ A;  2FFX J;  1LKO A;  1XZ1 A;  1MOJ A;  3AF8 X;  1JKU A;  4TOA A;  1TK6 A;  1H96 A;  3ISF A;  3PW1 B;  2G38 B;  1RCD A;  1S30 A;  2Z5R A;  1DPS A;  2FJC A;  3PW1 A;  3KWO A;  2V2P A;  2CHP A;  2BKC A;  4ETR A;  5LG2 A;  3KA3 A;  1UVH A;  2CLU A;  1JI5 A;  3QZ3 A;  1YV1 A;  4ZKW A;  3KXU A;  2Z5Q A;  3U90 A;  3F33 A;  2W0O A;  2ITB A;  4Z3B A;  2ZG7 X;  1JRE A;  2PYB A;  4ISP A;  3E6S A;  4DYU A;  1L8H A;  1NNQ A;  4R42 A;  1TKO A;  3AK9 A;  5ERJ A;  2OKC A;  3BVF A;  3E1J A;  4TOF A;  1SQ3 A;  5FFD A;  3RBC A;  3VVA A;  5D8S A;  5ERK A;  2AR0 A;  3HIU A;  3R2S A;  3ES3 A;  2YJJ A;  5GU1 X;  4TOG A;  4Z5S A;  3AF9 X;  3PWF A;  2C2J A;  5GN8 B;  3FI6 A;  2GYD A;  5GN8 A;  5GU2 X;  4MXP A;  2XKQ A;  3R2R A;  4CYB A;  4ERU A;  2JD8 0;  2V2I A;  2XJM A;  3C21 A;  3V3K B;  4QUW A;  1JGC A;  1KRQ A;  4TOB A;  3RE7 A;  3NP2 X;  3GVY A;  3D19 A;  2OC5 A;  2QF9 A;  1QGH A;  2V2L A;  4CMY A;  1VLG A;  3PVR A;  2YJK A;  3C1Y A;  2VXX A;  3E1L A;  5D8Y A;  4DZ0 A;  1BFR A;  3QB9 A;  2CWL A;  4LQV A;  5IX6 A;  2OH3 A;  4ZTT A;  3F34 A;  3SE1 A;  5J8W A;  3NOZ X;  4EVB A;  5AXS A;  2UX1 A;  1JIG A;  4TO9 A;  1DAT A;  3OJ5 A;  5GU3 X;  1J30 A;  4MJY A;  4PGI A;  3UOI A;  4YKH A;  3QHB A;  2GYQ A;  1IES A;  5JAC A;  5LG8 A;  3Q4N A;  4W4K B;  1YUZ A;  2ZA6 A;  4W4L B;  4AM5 A;  3NP0 X;  3FRS A;  3EZ0 A;  3E1P A;  3IS8 A;  2XJN A;  3PVT B;  3PWQ C;  3TA8 A;  4KXR B;  4P18 A;  2ZG9 X;  3PVT A;  1LKP A;  4YXM A;  3BVL A;  3E1O A;  1VEL A;  4CVR A;  5HU6 D;  1JYB A;  5E1U A;  1RCC A;  1F30 A;  3T9J A;  4RC7 B;  3UOF A;  3R2O A;  4ZKX A;  2FG4 A;  2GS4 A;  4RC7 A;  5GU0 X;  3O7S A;  4DI0 A;  2WWX B;  2ZA8 A;  4TOC A;  4PGK A;  1O9R A;  4CMY V;  4IWJ A;  2BK6 A;  2BW1 A;  3M6J A;  4U3G A;  5HJH A;  5JKM G;  5C6F A;  3Q4R A;  2FG8 A;  3LKD A;  1JKV A;  4XKS A;  4LPN A;  3C23 A;  3PW8 A;  3ISE A;  3F32 A;  2IB0 A;  2CIH A;  3R2L A;  4KVR A;  2V2R A;  4ZJK A;  3Q4Q A;  2FL0 A;  4RC5 B;  1AEW A;  1FHA A;  4ITW A;  2QQY A;  2V8U A;  4RC5 A;  1LKM A;  2FKZ A;  2V2J A;  3AK8 A;  1YUX A;  1LB3 A;  3A9Q A;  1RCI A;  5D8R A;  3BVE A;  2V2O A;  2CN7 A;  3E1N A;  2VZB A;  3EZU A;  1MFR A;  5FEJ A;  3GGY A;  4TOD A;  5D8X A;  5JKM A;  4ISM A;  3KA8 A;  1JI4 A;  3PVR B;  3BKN A;  2G4H A;  4XKT A;  3A68 A;  2D5K A;  4MUD A;  1ZUJ A;  3UFB A;  1Z6O A;  2WLU A;  5K53 A;  3KA9 A;  2CHI A;  3MPS A;  3DBY A;  4CVT A;  2HTN A;  2X17 0;  5HQO A;  2ZUR X;  5CMR A;  2VXI A;  3F39 A;  2Z90 A;  3QVD A;  1S2Z A;  3E1Q A;  2Y3Q A;  2XJO A;  4AM2 A;  2WLA A;  1ZS3 A;  4X0J A;  3WVW A;  5D8P A;  3KA4 A;  3SID A;  4A25 A;  2CEI A;  4REU A;  2F7N A;  1RYT A;  1EUM A;  3GHQ A;  3R2M A;  3AJO A;  4MKU A;  5K52 A;  3JZ9 A;  1JTS A;  4RC8 A;  4IXK A;  2IU2 A;  4LPJ A;  2ZA7 A;  5FFA A;  1NF6 A;  3QHC A;  3AJP A;  1HRS A;  2CN6 A;  4LQN A;  2IY4 A;  3BVK A;  2JD6 0;  4II4 B;  5LS9 A;  1BG7 A;  1N1Q A;  4II4 A;  3E6R A;  4MN9 A;  5FFB A;  1S3Q A;  1F33 A;  3L0M A;  4ZKH A;  5J93 A;  3IS7 A;  3GE4 A;  3WVV A;  3KA6 A;  2V2M A;  5I4J A;  5E2D A;  1NFV A;  1Z6O M;  4MY7 A;  5CMQ A;  3QD8 A;  3VV9 A;  2Z6M A;  3KX9 A;  3R2H A;  2BJY A;  3RD0 A;  4CY9 A;  1QYB A;  1Z4A A;  3HL1 A;  1TJO A;  4TOH A;  3OGH A;  5FFC A;  2CLB A;  2V2S A;  5JKL G;  2V8T A;  3BVI A;  4CYA A;  2CF7 A;  4WJG 4;  4CVP A;  3AF7 X;  2C2F A;  1IER A;  4Y08 A;  3GGZ A;  3KHK A;  3PW8 C;  4M32 A; 
#chains in the Genus database with same CATH homology
 4LYU A;  1B71 A;  3FVB A;  1XZ3 A;  4RC6 B;  1OTK A;  3WVU A;  1NF4 A;  3FSE A;  3VNX A;  4RC6 A;  4M34 A;  3SH6 A;  4DYX A;  3E2C A;  2C41 A;  2N02 A;  5HJF A;  1BCF A;  4E40 A;  1VEQ A;  1L8I A;  2JD7 0;  5LBH A;  3RAV A;  3BT5 A;  4M35 A;  4DYZ A;  1RCG A;  4LPM A;  3KDQ A;  2C2U A;  3Q4O A;  2ZG8 X;  4E6K A;  2YW6 A;  4YXJ A;  1UMN A;  5JKL A;  1VJX A;  4DE6 A;  3AJQ A;  3FRR A;  4EVE A;  4LQJ A;  1DVB A;  3PZA A;  4PG1 A;  4KVQ A;  2Y44 A;  4ZL6 A;  4AM4 A;  3EGM A;  2HR5 A;  4ITT A;  2Z5P A;  5D8O A;  3R2K A;  4ZMC A;  3F37 A;  2XGW A;  2C6R A;  2FZF A;  5CZU A;  5D8Q A;  4XKU A;  5GOU A;  5FFE A;  1RCE A;  4PG0 A;  3N6O A;  4M33 A;  3H7G A;  2YW7 A;  3UNO A;  2RBD A;  1R03 A;  2MGY A;  3O7R A;  4DYY A;  1TKP A;  4LQH A;  4ML5 A;  5JDO B;  3W54 A;  3F36 A;  3SHX A;  4CVS A;  2V15 A;  3PVY B;  3E1M A;  4XGS A;  3IQ1 A;  5JDO A;  1VEI A;  4IWK A;  3PVY A;  3RGD A;  2V2N A;  4KVS A;  4ZLW A;  1GWG A;  3C1Z A;  2WTL A;  4YVZ A;  4EVC A;  2FHA A;  1O9I A;  4ZL5 A;  3WNW A;  3F38 A;  4TOE A;  3ERZ A;  4TW3 A;  4DAS A;  3JZA B;  4OYN A;  5J9V A;  5J8S A;  4EVD A;  4LYX A;  3F35 A;  1SOF A;  3PWQ A;  2FFX J;  1LKO A;  1XZ1 A;  1MOJ A;  3AF8 X;  1JKU A;  4TOA A;  1TK6 A;  1H96 A;  3ISF A;  3PW1 B;  2G38 B;  1RCD A;  1S30 A;  2Z5R A;  1DPS A;  2FJC A;  3PW1 A;  3KWO A;  2V2P A;  2CHP A;  2BKC A;  4ETR A;  5LG2 A;  3KA3 A;  1UVH A;  2CLU A;  1JI5 A;  3QZ3 A;  1YV1 A;  4ZKW A;  3KXU A;  2Z5Q A;  3U90 A;  3F33 A;  2W0O A;  2ITB A;  4Z3B A;  2ZG7 X;  1JRE A;  2PYB A;  4ISP A;  3E6S A;  4DYU A;  1L8H A;  1NNQ A;  4R42 A;  1TKO A;  3AK9 A;  5ERJ A;  2OKC A;  3BVF A;  3E1J A;  4TOF A;  1SQ3 A;  5FFD A;  3RBC A;  3VVA A;  5D8S A;  5ERK A;  2AR0 A;  3HIU A;  3R2S A;  3ES3 A;  2YJJ A;  5GU1 X;  4TOG A;  4Z5S A;  3AF9 X;  3PWF A;  2C2J A;  5GN8 B;  3FI6 A;  2GYD A;  5GN8 A;  5GU2 X;  4MXP A;  2XKQ A;  3R2R A;  4CYB A;  4ERU A;  2JD8 0;  2V2I A;  2XJM A;  3C21 A;  3V3K B;  4QUW A;  1JGC A;  1KRQ A;  4TOB A;  3RE7 A;  3NP2 X;  3GVY A;  3D19 A;  2OC5 A;  2QF9 A;  1QGH A;  2V2L A;  4CMY A;  1VLG A;  3PVR A;  2YJK A;  3C1Y A;  2VXX A;  3E1L A;  5D8Y A;  4DZ0 A;  1BFR A;  3QB9 A;  2CWL A;  4LQV A;  5IX6 A;  2OH3 A;  4ZTT A;  3F34 A;  3SE1 A;  5J8W A;  3NOZ X;  4EVB A;  5AXS A;  2UX1 A;  1JIG A;  4TO9 A;  1DAT A;  3OJ5 A;  5GU3 X;  1J30 A;  4MJY A;  4PGI A;  3UOI A;  4YKH A;  3QHB A;  2GYQ A;  1IES A;  5JAC A;  5LG8 A;  3Q4N A;  4W4K B;  1YUZ A;  2ZA6 A;  4W4L B;  4AM5 A;  3NP0 X;  3FRS A;  3EZ0 A;  3E1P A;  3IS8 A;  2XJN A;  3PVT B;  3PWQ C;  3TA8 A;  4KXR B;  4P18 A;  2ZG9 X;  3PVT A;  1LKP A;  4YXM A;  3BVL A;  3E1O A;  1VEL A;  4CVR A;  5HU6 D;  1JYB A;  5E1U A;  1RCC A;  1F30 A;  3T9J A;  4RC7 B;  3UOF A;  3R2O A;  4ZKX A;  2FG4 A;  2GS4 A;  4RC7 A;  5GU0 X;  3O7S A;  4DI0 A;  2WWX B;  2ZA8 A;  4TOC A;  4PGK A;  1O9R A;  4CMY V;  4IWJ A;  2BK6 A;  2BW1 A;  3M6J A;  4U3G A;  5HJH A;  5JKM G;  5C6F A;  3Q4R A;  2FG8 A;  3LKD A;  1JKV A;  4XKS A;  4LPN A;  3C23 A;  3PW8 A;  3ISE A;  3F32 A;  2IB0 A;  2CIH A;  3R2L A;  4KVR A;  2V2R A;  4ZJK A;  3Q4Q A;  2FL0 A;  4RC5 B;  1AEW A;  1FHA A;  4ITW A;  2QQY A;  2V8U A;  4RC5 A;  1LKM A;  2FKZ A;  2V2J A;  3AK8 A;  1YUX A;  1LB3 A;  3A9Q A;  1RCI A;  5D8R A;  3BVE A;  2V2O A;  2CN7 A;  3E1N A;  2VZB A;  3EZU A;  1MFR A;  5FEJ A;  3GGY A;  4TOD A;  5D8X A;  5JKM A;  4ISM A;  3KA8 A;  1JI4 A;  3PVR B;  3BKN A;  2G4H A;  4XKT A;  3A68 A;  2D5K A;  4MUD A;  1ZUJ A;  3UFB A;  1Z6O A;  2WLU A;  5K53 A;  3KA9 A;  2CHI A;  3MPS A;  3DBY A;  4CVT A;  2HTN A;  2X17 0;  5HQO A;  2ZUR X;  5CMR A;  2VXI A;  3F39 A;  2Z90 A;  3QVD A;  1S2Z A;  3E1Q A;  2Y3Q A;  2XJO A;  4AM2 A;  2WLA A;  1ZS3 A;  4X0J A;  3WVW A;  5D8P A;  3KA4 A;  3SID A;  4A25 A;  2CEI A;  4REU A;  2F7N A;  1RYT A;  1EUM A;  3GHQ A;  3R2M A;  3AJO A;  4MKU A;  5K52 A;  3JZ9 A;  1JTS A;  4RC8 A;  4IXK A;  2IU2 A;  4LPJ A;  2ZA7 A;  5FFA A;  1NF6 A;  3QHC A;  3AJP A;  1HRS A;  2CN6 A;  4LQN A;  2IY4 A;  3BVK A;  2JD6 0;  4II4 B;  5LS9 A;  1BG7 A;  1N1Q A;  4II4 A;  3E6R A;  4MN9 A;  5FFB A;  1S3Q A;  1F33 A;  3L0M A;  4ZKH A;  5J93 A;  3IS7 A;  3GE4 A;  3WVV A;  3KA6 A;  2V2M A;  5I4J A;  5E2D A;  1NFV A;  1Z6O M;  4MY7 A;  5CMQ A;  3QD8 A;  3VV9 A;  2Z6M A;  3KX9 A;  3R2H A;  2BJY A;  3RD0 A;  4CY9 A;  1QYB A;  1Z4A A;  3HL1 A;  1TJO A;  4TOH A;  3OGH A;  5FFC A;  2CLB A;  2V2S A;  5JKL G;  2V8T A;  3BVI A;  4CYA A;  2CF7 A;  4WJG 4;  4CVP A;  3AF7 X;  2C2F A;  1IER A;  4Y08 A;  3GGZ A;  3KHK A;  3PW8 C;  4M32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...