1UMNA

Crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
151
structure length
151
Chain Sequence
LADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DPS-LIKE PEROXIDE RESISTANCE PROTEIN
publication title Crystal structure of Streptococcus suis Dps-like peroxide resistance protein Dpr: implications for iron incorporation.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Peroxide resistance
total genus 66
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1umnA00
3PWFA 1RYTA 2Z5PA 3PVRA 1FHAA 5CMQA 5J93A 3E1JA 3HIUA 1F30A 4TODA 1NF6A 2CLBA 3AJOA 3WVVA 4RC7B 3VNXA 5GOUA 4P18A 5D8RA 3F35A 4ZKXA 3PVYB 5JACA 3OJ5A 1OTKA 2CF7A 1BG7A 2ZG8X 2C2FA 3UOIA 1RCGA 3KA4A 3NOZX 2Z5QA 3AK9A 3E1PA 4LQHA 5GU0X 2G4HA 4OYNA 2V2MA 2CHPA 2ZG9X 4IWJA 3GE4A 1AEWA 4DASA 3PW1A 4DYXA 4EVBA 4Z5SA 4CVSA 3FSEA 3KA6A 5JKMG 2OC5A 2ITBA 4M35A 2QQYA 3UOFA 4ZJKA 4RC5A 1QYBA 1R03A 5FFEA 5CZUA 5IX6A 1H96A 4AM4A 1BFRA 4LPMA 3FVBA 3F36A 2IY4A 2BK6A 3A68A 2XJOA 3Q4QA 3KX9A 3RBCA 3NP2X 5JKLA 3ERZA 1TJOA 1N1QA 2ZA7A 3KA8A 2C41A 4CVPA 3EZ0A 4CVTA 4E6KA 4ZKHA 5JKMA 4ML5A 2JD80 2FG8A 3RE7A 4PG0A 3BVLA 2ZG7X 2FHAA 4YKHA 4DZ0A 3EZUA 4LYUA 3PWQA 1JGCA 2QF9A 2D5KA 4AM2A 1RCEA 3QVDA 1JI4A 2V2SA 2YJKA 2V2OA 3BKNA 1O9IA 2Z5RA 2BJYA 1ZUJA 2CHIA 4XGSA 1VELA 1VLGA 3OGHA 4II4B 1YV1A 5GU1X 3F37A 1TK6A 2WLAA 3E1QA 4PGKA 4M32A 4PG1A 4PGIA 4RC8A 2XJMA 2V2RA 4CYAA 2CLUA 2FJCA 5ERKA 1MOJA 2CN7A 4LQNA 4M33A 1RCIA 4ISMA 3R2HA 3SE1A 1O9RA 2YW7A 4DI0A 1QGHA 4IXKA 2PYBA 1L8IA 3RD0A 5D8PA 3KXUA 1IERA 5AXSA 2XJNA 2CEIA 1MFRA 5GN8B 5I4JA 4XKUA 1YUZA 1JYBA 4KVSA 3PVTA 2VXIA 5FFCA 1VEIA 3BT5A 1SQ3A 1J30A 4TOFA 5JKLG 3PZAA 3IS7A 2VZBA 1JREA 3IQ1A 3WNWA 4LYXA 3T9JA 3HL1A 4XKSA 1DPSA 1S30A 2GYQA 3PW8A 4TOCA 3O7RA 4CMYV 5FFDA 3WVWA 1Z6OA 2WTLA 4RC6B 4RC7A 1S3QA 2FFXJ 3Q4RA 4QUWA 4TO9A 4TOAA 3ISEA 3AF8X 3PVYA 3E1LA 3R2LA 2V15A 2X170 1JI5A 2YJJA 4LQVA 3TA8A 1DVBA 2CIHA 3U90A 5J9VA 1YUXA 2WLUA 2IB0A 3AK8A 1S2ZA 2FL0A 2BKCA 3SH6A 5D8QA 2Z6MA 3R2RA 4ZTTA 2C6RA 4XKTA 1RCDA 5J8SA 3UNOA 3FI6A 3PVRB 4TOBA 1NF4A 1VEQA 3ISFA 3R2KA 1ZS3A 5ERJA 2Y3QA 5K52A 3Q4OA 1JKUA 5D8SA 3AJQA 5HJHA 1BCFA 2RBDA 1Z4AA 3H7GA 3KA3A 4Z3BA 4MY7A 4AM5A 1KRQA 2V2NA 2BW1A 3RAVA 1DATA 1VJXA 3KA9A 1TKOA 4KVQA 5LS9A 4TW3A 3R2MA 1LKOA 1B71A 3E1MA 4ZL5A 4REUA 4DYZA 1UMNA 5C6FA 2V2JA 3BVFA 1XZ3A 3A9QA 2HTNA 3AF9X 4EVCA 4DE6A 4DYUA 1F33A 4CMYA 4ERUA 4TOGA 3F38A 3MPSA 2GYDA 2F7NA 3PW1B 1IESA 1TKPA 2IU2A 1EUMA 3SHXA 1NNQA 4EVEA 3F32A 4RC5B 2FG4A 4CY9A 1NFVA 2JD70 1XZ1A 4R42A 4MKUA 5GU2X 4U3GA 1JIGA 4II4A 2VXXA 5D8YA 4ITWA 2XKQA 2Z90A 2UX1A 5GU3X 2V2LA 5D8XA 3QHBA 4MJYA 3F34A 4ETRA 2V2IA 3EGMA 3Q4NA 2YW6A 2FZFA 4IWKA 3WVUA 3QB9A 3PWQC 2V2PA 4ZL6A 3GVYA 2JD60 4ZMCA 5FFBA 1L8HA 3NP0X 5J8WA 5E1UA 2C2UA 5E2DA 3O7SA 4MUDA 5GN8A 4DYYA 4ITTA 2ZURX 2CN6A 4LPJA 4ZLWA 1JKVA 3ES3A 1JTSA 3R2OA 4CYBA 4MN9A 3BVEA 5FFAA 3BVIA 1LKMA 3QHCA 4CVRA 2FKZA 3SIDA 2W0OA 3AJPA 3R2SA 5LBHA 1LKPA 3KWOA 5K53A 5LG8A 2ZA8A 3E1OA 4TOEA 4LPNA 4M34A 4TOHA 4Y08A 4RC6A 4ISPA 5HQOA 2HR5A 3GHQA 1Z6OM 5LG2A 2XGWA 1GWGA 1UVHA 3IS8A 2C2JA 2OH3A 3E2CA 3E1NA 4EVDA 4LQJA 5CMRA 3BVKA 3E6SA 5HJFA 4A25A 3PW8C 1SOFA 1RCCA 3QZ3A 3AF7X 4ZKWA 2ZA6A 3F39A 3PVTB 5D8OA 4KVRA 3E6RA 5FEJA 3F33A 3RGDA 1HRSA 2GS4A 1LB3A 3QD8A
chains in the Genus database with same CATH superfamily
3PWFA 1RYTA 2Z5PA 3PVRA 1FHAA 5CMQA 5J93A 3E1JA 3HIUA 1F30A 4TODA 1NF6A 3N6OA 2CLBA 3AJOA 3WVVA 4RC7B 3VNXA 5GOUA 4P18A 5D8RA 3F35A 4ZKXA 3PVYB 5JACA 3OJ5A 1OTKA 2CF7A 1BG7A 2ZG8X 2C2FA 3UOIA 1RCGA 3KA4A 3NOZX 2Z5QA 3AK9A 3E1PA 4LQHA 4YXMA 5GU0X 2G4HA 4OYNA 2V2MA 2CHPA 2ZG9X 4IWJA 3GE4A 1AEWA 4DASA 3PW1A 4DYXA 4EVBA 4Z5SA 4CVSA 3FSEA 3KA6A 5JKMG 2OC5A 2ITBA 4M35A 2QQYA 3UOFA 4ZJKA 4RC5A 1QYBA 1R03A 5FFEA 5CZUA 5IX6A 1H96A 4AM4A 1BFRA 4LPMA 3FVBA 3F36A 2IY4A 5JDOB 2BK6A 3A68A 2XJOA 3Q4QA 3KX9A 3RBCA 3NP2X 5JKLA 3ERZA 1TJOA 1N1QA 3GGZA 2ZA7A 3KA8A 2C41A 2WWXB 4CVPA 3EZ0A 4CVTA 4E6KA 4ZKHA 5JKMA 4ML5A 2JD80 4YXJA 2FG8A 3RE7A 4PG0A 3BVLA 2ZG7X 2FHAA 4YKHA 2AR0A 4DZ0A 3EZUA 4LYUA 3C1ZA 3PWQA 1JGCA 2QF9A 3M6JA 2D5KA 4AM2A 1RCEA 3QVDA 1JI4A 2V2SA 2YJKA 2V2OA 5HU6D 3BKNA 1O9IA 2Z5RA 2BJYA 3LKDA 1ZUJA 2CHIA 4XGSA 1VELA 1VLGA 3OGHA 4II4B 1YV1A 5GU1X 3F37A 1TK6A 2WLAA 4MXPA 3E1QA 4PGKA 4M32A 4PG1A 4PGIA 4RC8A 2XJMA 2V2RA 4CYAA 2CLUA 2FJCA 5ERKA 1MOJA 2CN7A 4LQNA 4M33A 1RCIA 4ISMA 3R2HA 3SE1A 1O9RA 2YW7A 4DI0A 1QGHA 4IXKA 2PYBA 1L8IA 3RD0A 5D8PA 3KXUA 1IERA 5AXSA 2XJNA 2CEIA 1MFRA 5GN8B 5I4JA 4XKUA 1YUZA 1JYBA 4KVSA 3PVTA 2VXIA 3KDQA 5FFCA 1VEIA 3BT5A 1SQ3A 1J30A 4TOFA 5JKLG 3PZAA 3IS7A 2VZBA 1JREA 3IQ1A 3WNWA 4LYXA 3T9JA 3HL1A 4XKSA 1DPSA 1S30A 2GYQA 2MGYA 3PW8A 4TOCA 3O7RA 4CMYV 5FFDA 3WVWA 1Z6OA 2WTLA 4RC6B 4RC7A 1S3QA 2FFXJ 4YVZA 3Q4RA 4QUWA 4TO9A 4TOAA 3ISEA 3AF8X 3PVYA 3E1LA 3R2LA 2V15A 2X170 3KHKA 1JI5A 2CWLA 2YJJA 4LQVA 3TA8A 1DVBA 2CIHA 3U90A 5J9VA 1YUXA 2WLUA 2IB0A 2OKCA 3AK8A 1S2ZA 2FL0A 2BKCA 3SH6A 5D8QA 2Z6MA 3R2RA 4ZTTA 2C6RA 4XKTA 1RCDA 5J8SA 3UNOA 3FI6A 3PVRB 3VVAA 4TOBA 1NF4A 1VEQA 3ISFA 3R2KA 1ZS3A 5ERJA 2Y3QA 5K52A 3Q4OA 1JKUA 3FRSA 5D8SA 3AJQA 5HJHA 5JDOA 1BCFA 2RBDA 2N02A 1Z4AA 3H7GA 3KA3A 4Z3BA 4MY7A 4AM5A 1KRQA 2V2NA 2BW1A 3RAVA 1DATA 1VJXA 3KA9A 1TKOA 4KVQA 5LS9A 4TW3A 3R2MA 1LKOA 1B71A 3E1MA 4ZL5A 4REUA 4DYZA 4W4LB 1UMNA 5C6FA 2V8UA 2V2JA 3BVFA 1XZ3A 3A9QA 2HTNA 3AF9X 4EVCA 4DE6A 4X0JA 4DYUA 1F33A 4CMYA 4ERUA 4TOGA 3F38A 3MPSA 2GYDA 2F7NA 3PW1B 1IESA 3JZ9A 1TKPA 2IU2A 1EUMA 3SHXA 1NNQA 4E40A 3F32A 4EVEA 4RC5B 2FG4A 4CY9A 1NFVA 2JD70 1XZ1A 4MKUA 4R42A 5GU2X 2G38B 4U3GA 1JIGA 4II4A 2VXXA 5D8YA 4ITWA 4W4KB 2XKQA 2Z90A 2UX1A 5GU3X 2V2LA 5D8XA 3QHBA 4MJYA 3F34A 3FRRA 4ETRA 2V2IA 3EGMA 3Q4NA 2YW6A 2FZFA 4IWKA 4KXRB 3QB9A 3WVUA 3PWQC 2V2PA 4ZL6A 3GVYA 3GGYA 2JD60 2Y44A 4ZMCA 5FFBA 1L8HA 3NP0X 5J8WA 3C1YA 5E1UA 2C2UA 3VV9A 5E2DA 3O7SA 4MUDA 5GN8A 4DYYA 4ITTA 2ZURX 2CN6A 4LPJA 4ZLWA 1JKVA 2V8TA 3ES3A 1JTSA 3R2OA 3D19A 4CYBA 4MN9A 3BVEA 5FFAA 3BVIA 3W54A 1LKMA 3QHCA 4CVRA 2FKZA 3SIDA 2W0OA 3JZAB 3AJPA 3R2SA 5LBHA 1LKPA 3KWOA 5K53A 3DBYA 3UFBA 5LG8A 2ZA8A 3E1OA 4TOEA 4LPNA 4M34A 4TOHA 4Y08A 4RC6A 4ISPA 5HQOA 2HR5A 3V3KB 3GHQA 1Z6OM 5LG2A 2XGWA 1GWGA 1UVHA 3IS8A 3L0MA 2C2JA 2OH3A 3E2CA 4WJG4 3C23A 3E1NA 4EVDA 4LQJA 5CMRA 3BVKA 3C21A 3E6SA 5HJFA 4A25A 3PW8C 1SOFA 1RCCA 3QZ3A 3AF7X 4ZKWA 2ZA6A 3F39A 3PVTB 5D8OA 4KVRA 3E6RA 5FEJA 3F33A 3RGDA 1HRSA 2GS4A 1LB3A 3QD8A
chains in the Genus database with same CATH topology
3PWFA 1RYTA 2Z5PA 3PVRA 1FHAA 5CMQA 5J93A 3E1JA 3HIUA 1F30A 4TODA 1NF6A 3N6OA 2CLBA 3AJOA 3WVVA 4RC7B 3VNXA 5GOUA 4P18A 5D8RA 3F35A 4ZKXA 3PVYB 5JACA 3OJ5A 1OTKA 2CF7A 1BG7A 2ZG8X 2C2FA 3UOIA 1RCGA 3KA4A 3NOZX 2Z5QA 3AK9A 3E1PA 4LQHA 4YXMA 5GU0X 2G4HA 4OYNA 2V2MA 2CHPA 2ZG9X 4IWJA 3GE4A 1AEWA 4DASA 3PW1A 4DYXA 4EVBA 4Z5SA 4CVSA 3FSEA 3KA6A 5JKMG 2OC5A 2ITBA 4M35A 2QQYA 3UOFA 4ZJKA 4RC5A 1QYBA 1R03A 5FFEA 5CZUA 5IX6A 1H96A 4AM4A 1BFRA 4LPMA 3FVBA 3F36A 2IY4A 5JDOB 2BK6A 3A68A 2XJOA 3Q4QA 3KX9A 3RBCA 3NP2X 5JKLA 3ERZA 1TJOA 1N1QA 3GGZA 2ZA7A 3KA8A 2C41A 2WWXB 4CVPA 3EZ0A 4CVTA 4E6KA 4ZKHA 5JKMA 4ML5A 2JD80 4YXJA 2FG8A 3RE7A 4PG0A 3BVLA 2ZG7X 2FHAA 4YKHA 2AR0A 4DZ0A 3EZUA 4LYUA 3C1ZA 3PWQA 1JGCA 2QF9A 3M6JA 2D5KA 4AM2A 1RCEA 3QVDA 1JI4A 2V2SA 2YJKA 2V2OA 5HU6D 3BKNA 1O9IA 2Z5RA 2BJYA 3LKDA 1ZUJA 2CHIA 4XGSA 1VELA 1VLGA 3OGHA 4II4B 1YV1A 5GU1X 3F37A 1TK6A 2WLAA 4MXPA 3E1QA 4PGKA 4M32A 4PG1A 4PGIA 4RC8A 2XJMA 2V2RA 4CYAA 2CLUA 2FJCA 5ERKA 1MOJA 2CN7A 4LQNA 4M33A 1RCIA 4ISMA 3R2HA 3SE1A 1O9RA 2YW7A 4DI0A 1QGHA 4IXKA 2PYBA 1L8IA 3RD0A 5D8PA 3KXUA 1IERA 5AXSA 2XJNA 2CEIA 1MFRA 5GN8B 5I4JA 4XKUA 1YUZA 1JYBA 4KVSA 3PVTA 2VXIA 3KDQA 5FFCA 1VEIA 3BT5A 1SQ3A 1J30A 4TOFA 5JKLG 3PZAA 3IS7A 2VZBA 1JREA 3IQ1A 3WNWA 4LYXA 3T9JA 3HL1A 4XKSA 1DPSA 1S30A 2GYQA 2MGYA 3PW8A 4TOCA 3O7RA 4CMYV 5FFDA 3WVWA 1Z6OA 2WTLA 4RC6B 4RC7A 1S3QA 2FFXJ 4YVZA 3Q4RA 4QUWA 4TO9A 4TOAA 3ISEA 3AF8X 3PVYA 3E1LA 3R2LA 2V15A 2X170 3KHKA 1JI5A 2CWLA 2YJJA 4LQVA 3TA8A 1DVBA 2CIHA 3U90A 5J9VA 1YUXA 2WLUA 2IB0A 2OKCA 3AK8A 1S2ZA 2FL0A 2BKCA 3SH6A 5D8QA 2Z6MA 3R2RA 4ZTTA 2C6RA 4XKTA 1RCDA 5J8SA 3UNOA 3FI6A 3PVRB 3VVAA 4TOBA 1NF4A 1VEQA 3ISFA 3R2KA 1ZS3A 5ERJA 2Y3QA 5K52A 3Q4OA 1JKUA 3FRSA 5D8SA 3AJQA 5HJHA 5JDOA 1BCFA 2RBDA 2N02A 1Z4AA 3H7GA 3KA3A 4Z3BA 4MY7A 4AM5A 1KRQA 2V2NA 2BW1A 3RAVA 1DATA 1VJXA 3KA9A 1TKOA 4KVQA 5LS9A 4TW3A 3R2MA 1LKOA 1B71A 3E1MA 4ZL5A 4REUA 4DYZA 4W4LB 1UMNA 5C6FA 2V8UA 2V2JA 3BVFA 1XZ3A 3A9QA 2HTNA 3AF9X 4EVCA 4DE6A 4X0JA 4DYUA 1F33A 4CMYA 4ERUA 4TOGA 3F38A 3MPSA 2GYDA 2F7NA 3PW1B 1IESA 3JZ9A 1TKPA 2IU2A 1EUMA 3SHXA 1NNQA 4E40A 3F32A 4EVEA 4RC5B 2FG4A 4CY9A 1NFVA 2JD70 1XZ1A 4MKUA 4R42A 5GU2X 2G38B 4U3GA 1JIGA 4II4A 2VXXA 5D8YA 4ITWA 4W4KB 2XKQA 2Z90A 2UX1A 5GU3X 2V2LA 5D8XA 3QHBA 4MJYA 3F34A 3FRRA 4ETRA 2V2IA 3EGMA 3Q4NA 2YW6A 2FZFA 4IWKA 4KXRB 3QB9A 3WVUA 3PWQC 2V2PA 4ZL6A 3GVYA 3GGYA 2JD60 2Y44A 4ZMCA 5FFBA 1L8HA 3NP0X 5J8WA 3C1YA 5E1UA 2C2UA 3VV9A 5E2DA 3O7SA 4MUDA 5GN8A 4DYYA 4ITTA 2ZURX 2CN6A 4LPJA 4ZLWA 1JKVA 2V8TA 3ES3A 1JTSA 3R2OA 3D19A 4CYBA 4MN9A 3BVEA 5FFAA 3BVIA 3W54A 1LKMA 3QHCA 4CVRA 2FKZA 3SIDA 2W0OA 3JZAB 3AJPA 3R2SA 5LBHA 1LKPA 3KWOA 5K53A 3DBYA 3UFBA 5LG8A 2ZA8A 3E1OA 4TOEA 4LPNA 4M34A 4TOHA 4Y08A 4RC6A 4ISPA 5HQOA 2HR5A 3V3KB 3GHQA 1Z6OM 5LG2A 2XGWA 1GWGA 1UVHA 3IS8A 3L0MA 2C2JA 2OH3A 3E2CA 4WJG4 3C23A 3E1NA 4EVDA 4LQJA 5CMRA 3BVKA 3C21A 3E6SA 5HJFA 4A25A 3PW8C 1SOFA 1RCCA 3QZ3A 3AF7X 4ZKWA 2ZA6A 3F39A 3PVTB 5D8OA 4KVRA 3E6RA 5FEJA 3F33A 3RGDA 1HRSA 2GS4A 1LB3A 3QD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PWF A;  1RYT A;  2Z5P A;  3PVR A;  1FHA A;  5CMQ A;  5J93 A;  3E1J A;  3HIU A;  1F30 A;  4TOD A;  1NF6 A;  2CLB A;  3AJO A;  3WVV A;  4RC7 B;  3VNX A;  5GOU A;  4P18 A;  5D8R A;  3F35 A;  4ZKX A;  3PVY B;  5JAC A;  3OJ5 A;  1OTK A;  2CF7 A;  1BG7 A;  2ZG8 X;  2C2F A;  3UOI A;  1RCG A;  3KA4 A;  3NOZ X;  2Z5Q A;  3AK9 A;  3E1P A;  4LQH A;  5GU0 X;  2G4H A;  4OYN A;  2V2M A;  2CHP A;  2ZG9 X;  4IWJ A;  3GE4 A;  1AEW A;  4DAS A;  3PW1 A;  4DYX A;  4EVB A;  4Z5S A;  4CVS A;  3FSE A;  3KA6 A;  5JKM G;  2OC5 A;  2ITB A;  4M35 A;  2QQY A;  3UOF A;  4ZJK A;  4RC5 A;  1QYB A;  1R03 A;  5FFE A;  5CZU A;  5IX6 A;  1H96 A;  4AM4 A;  1BFR A;  4LPM A;  3FVB A;  3F36 A;  2IY4 A;  2BK6 A;  3A68 A;  2XJO A;  3Q4Q A;  3KX9 A;  3RBC A;  3NP2 X;  5JKL A;  3ERZ A;  1TJO A;  1N1Q A;  2ZA7 A;  3KA8 A;  2C41 A;  4CVP A;  3EZ0 A;  4CVT A;  4E6K A;  4ZKH A;  5JKM A;  4ML5 A;  2JD8 0;  2FG8 A;  3RE7 A;  4PG0 A;  3BVL A;  2ZG7 X;  2FHA A;  4YKH A;  4DZ0 A;  3EZU A;  4LYU A;  3PWQ A;  1JGC A;  2QF9 A;  2D5K A;  4AM2 A;  1RCE A;  3QVD A;  1JI4 A;  2V2S A;  2YJK A;  2V2O A;  3BKN A;  1O9I A;  2Z5R A;  2BJY A;  1ZUJ A;  2CHI A;  4XGS A;  1VEL A;  1VLG A;  3OGH A;  4II4 B;  1YV1 A;  5GU1 X;  3F37 A;  1TK6 A;  2WLA A;  3E1Q A;  4PGK A;  4M32 A;  4PG1 A;  4PGI A;  4RC8 A;  2XJM A;  2V2R A;  4CYA A;  2CLU A;  2FJC A;  5ERK A;  1MOJ A;  2CN7 A;  4LQN A;  4M33 A;  1RCI A;  4ISM A;  3R2H A;  3SE1 A;  1O9R A;  2YW7 A;  4DI0 A;  1QGH A;  4IXK A;  2PYB A;  1L8I A;  3RD0 A;  5D8P A;  3KXU A;  1IER A;  5AXS A;  2XJN A;  2CEI A;  1MFR A;  5GN8 B;  5I4J A;  4XKU A;  1YUZ A;  1JYB A;  4KVS A;  3PVT A;  2VXI A;  5FFC A;  1VEI A;  3BT5 A;  1SQ3 A;  1J30 A;  4TOF A;  5JKL G;  3PZA A;  3IS7 A;  2VZB A;  1JRE A;  3IQ1 A;  3WNW A;  4LYX A;  3T9J A;  3HL1 A;  4XKS A;  1DPS A;  1S30 A;  2GYQ A;  3PW8 A;  4TOC A;  3O7R A;  4CMY V;  5FFD A;  3WVW A;  1Z6O A;  2WTL A;  4RC6 B;  4RC7 A;  1S3Q A;  2FFX J;  3Q4R A;  4QUW A;  4TO9 A;  4TOA A;  3ISE A;  3AF8 X;  3PVY A;  3E1L A;  3R2L A;  2V15 A;  2X17 0;  1JI5 A;  2YJJ A;  4LQV A;  3TA8 A;  1DVB A;  2CIH A;  3U90 A;  5J9V A;  1YUX A;  2WLU A;  2IB0 A;  3AK8 A;  1S2Z A;  2FL0 A;  2BKC A;  3SH6 A;  5D8Q A;  2Z6M A;  3R2R A;  4ZTT A;  2C6R A;  4XKT A;  1RCD A;  5J8S A;  3UNO A;  3FI6 A;  3PVR B;  4TOB A;  1NF4 A;  1VEQ A;  3ISF A;  3R2K A;  1ZS3 A;  5ERJ A;  2Y3Q A;  5K52 A;  3Q4O A;  1JKU A;  5D8S A;  3AJQ A;  5HJH A;  1BCF A;  2RBD A;  1Z4A A;  3H7G A;  3KA3 A;  4Z3B A;  4MY7 A;  4AM5 A;  1KRQ A;  2V2N A;  2BW1 A;  3RAV A;  1DAT A;  1VJX A;  3KA9 A;  1TKO A;  4KVQ A;  5LS9 A;  4TW3 A;  3R2M A;  1LKO A;  1B71 A;  3E1M A;  4ZL5 A;  4REU A;  4DYZ A;  1UMN A;  5C6F A;  2V2J A;  3BVF A;  1XZ3 A;  3A9Q A;  2HTN A;  3AF9 X;  4EVC A;  4DE6 A;  4DYU A;  1F33 A;  4CMY A;  4ERU A;  4TOG A;  3F38 A;  3MPS A;  2GYD A;  2F7N A;  3PW1 B;  1IES A;  1TKP A;  2IU2 A;  1EUM A;  3SHX A;  1NNQ A;  4EVE A;  3F32 A;  4RC5 B;  2FG4 A;  4CY9 A;  1NFV A;  2JD7 0;  1XZ1 A;  4R42 A;  4MKU A;  5GU2 X;  4U3G A;  1JIG A;  4II4 A;  2VXX A;  5D8Y A;  4ITW A;  2XKQ A;  2Z90 A;  2UX1 A;  5GU3 X;  2V2L A;  5D8X A;  3QHB A;  4MJY A;  3F34 A;  4ETR A;  2V2I A;  3EGM A;  3Q4N A;  2YW6 A;  2FZF A;  4IWK A;  3WVU A;  3QB9 A;  3PWQ C;  2V2P A;  4ZL6 A;  3GVY A;  2JD6 0;  4ZMC A;  5FFB A;  1L8H A;  3NP0 X;  5J8W A;  5E1U A;  2C2U A;  5E2D A;  3O7S A;  4MUD A;  5GN8 A;  4DYY A;  4ITT A;  2ZUR X;  2CN6 A;  4LPJ A;  4ZLW A;  1JKV A;  3ES3 A;  1JTS A;  3R2O A;  4CYB A;  4MN9 A;  3BVE A;  5FFA A;  3BVI A;  1LKM A;  3QHC A;  4CVR A;  2FKZ A;  3SID A;  2W0O A;  3AJP A;  3R2S A;  5LBH A;  1LKP A;  3KWO A;  5K53 A;  5LG8 A;  2ZA8 A;  3E1O A;  4TOE A;  4LPN A;  4M34 A;  4TOH A;  4Y08 A;  4RC6 A;  4ISP A;  5HQO A;  2HR5 A;  3GHQ A;  1Z6O M;  5LG2 A;  2XGW A;  1GWG A;  1UVH A;  3IS8 A;  2C2J A;  2OH3 A;  3E2C A;  3E1N A;  4EVD A;  4LQJ A;  5CMR A;  3BVK A;  3E6S A;  5HJF A;  4A25 A;  3PW8 C;  1SOF A;  1RCC A;  3QZ3 A;  3AF7 X;  4ZKW A;  2ZA6 A;  3F39 A;  3PVT B;  5D8O A;  4KVR A;  3E6R A;  5FEJ A;  3F33 A;  3RGD A;  1HRS A;  2GS4 A;  1LB3 A;  3QD8 A; 
#chains in the Genus database with same CATH topology
 3PWF A;  1RYT A;  2Z5P A;  3PVR A;  1FHA A;  5CMQ A;  5J93 A;  3E1J A;  3HIU A;  1F30 A;  4TOD A;  1NF6 A;  3N6O A;  2CLB A;  3AJO A;  3WVV A;  4RC7 B;  3VNX A;  5GOU A;  4P18 A;  5D8R A;  3F35 A;  4ZKX A;  3PVY B;  5JAC A;  3OJ5 A;  1OTK A;  2CF7 A;  1BG7 A;  2ZG8 X;  2C2F A;  3UOI A;  1RCG A;  3KA4 A;  3NOZ X;  2Z5Q A;  3AK9 A;  3E1P A;  4LQH A;  4YXM A;  5GU0 X;  2G4H A;  4OYN A;  2V2M A;  2CHP A;  2ZG9 X;  4IWJ A;  3GE4 A;  1AEW A;  4DAS A;  3PW1 A;  4DYX A;  4EVB A;  4Z5S A;  4CVS A;  3FSE A;  3KA6 A;  5JKM G;  2OC5 A;  2ITB A;  4M35 A;  2QQY A;  3UOF A;  4ZJK A;  4RC5 A;  1QYB A;  1R03 A;  5FFE A;  5CZU A;  5IX6 A;  1H96 A;  4AM4 A;  1BFR A;  4LPM A;  3FVB A;  3F36 A;  2IY4 A;  5JDO B;  2BK6 A;  3A68 A;  2XJO A;  3Q4Q A;  3KX9 A;  3RBC A;  3NP2 X;  5JKL A;  3ERZ A;  1TJO A;  1N1Q A;  3GGZ A;  2ZA7 A;  3KA8 A;  2C41 A;  2WWX B;  4CVP A;  3EZ0 A;  4CVT A;  4E6K A;  4ZKH A;  5JKM A;  4ML5 A;  2JD8 0;  4YXJ A;  2FG8 A;  3RE7 A;  4PG0 A;  3BVL A;  2ZG7 X;  2FHA A;  4YKH A;  2AR0 A;  4DZ0 A;  3EZU A;  4LYU A;  3C1Z A;  3PWQ A;  1JGC A;  2QF9 A;  3M6J A;  2D5K A;  4AM2 A;  1RCE A;  3QVD A;  1JI4 A;  2V2S A;  2YJK A;  2V2O A;  5HU6 D;  3BKN A;  1O9I A;  2Z5R A;  2BJY A;  3LKD A;  1ZUJ A;  2CHI A;  4XGS A;  1VEL A;  1VLG A;  3OGH A;  4II4 B;  1YV1 A;  5GU1 X;  3F37 A;  1TK6 A;  2WLA A;  4MXP A;  3E1Q A;  4PGK A;  4M32 A;  4PG1 A;  4PGI A;  4RC8 A;  2XJM A;  2V2R A;  4CYA A;  2CLU A;  2FJC A;  5ERK A;  1MOJ A;  2CN7 A;  4LQN A;  4M33 A;  1RCI A;  4ISM A;  3R2H A;  3SE1 A;  1O9R A;  2YW7 A;  4DI0 A;  1QGH A;  4IXK A;  2PYB A;  1L8I A;  3RD0 A;  5D8P A;  3KXU A;  1IER A;  5AXS A;  2XJN A;  2CEI A;  1MFR A;  5GN8 B;  5I4J A;  4XKU A;  1YUZ A;  1JYB A;  4KVS A;  3PVT A;  2VXI A;  3KDQ A;  5FFC A;  1VEI A;  3BT5 A;  1SQ3 A;  1J30 A;  4TOF A;  5JKL G;  3PZA A;  3IS7 A;  2VZB A;  1JRE A;  3IQ1 A;  3WNW A;  4LYX A;  3T9J A;  3HL1 A;  4XKS A;  1DPS A;  1S30 A;  2GYQ A;  2MGY A;  3PW8 A;  4TOC A;  3O7R A;  4CMY V;  5FFD A;  3WVW A;  1Z6O A;  2WTL A;  4RC6 B;  4RC7 A;  1S3Q A;  2FFX J;  4YVZ A;  3Q4R A;  4QUW A;  4TO9 A;  4TOA A;  3ISE A;  3AF8 X;  3PVY A;  3E1L A;  3R2L A;  2V15 A;  2X17 0;  3KHK A;  1JI5 A;  2CWL A;  2YJJ A;  4LQV A;  3TA8 A;  1DVB A;  2CIH A;  3U90 A;  5J9V A;  1YUX A;  2WLU A;  2IB0 A;  2OKC A;  3AK8 A;  1S2Z A;  2FL0 A;  2BKC A;  3SH6 A;  5D8Q A;  2Z6M A;  3R2R A;  4ZTT A;  2C6R A;  4XKT A;  1RCD A;  5J8S A;  3UNO A;  3FI6 A;  3PVR B;  3VVA A;  4TOB A;  1NF4 A;  1VEQ A;  3ISF A;  3R2K A;  1ZS3 A;  5ERJ A;  2Y3Q A;  5K52 A;  3Q4O A;  1JKU A;  3FRS A;  5D8S A;  3AJQ A;  5HJH A;  5JDO A;  1BCF A;  2RBD A;  2N02 A;  1Z4A A;  3H7G A;  3KA3 A;  4Z3B A;  4MY7 A;  4AM5 A;  1KRQ A;  2V2N A;  2BW1 A;  3RAV A;  1DAT A;  1VJX A;  3KA9 A;  1TKO A;  4KVQ A;  5LS9 A;  4TW3 A;  3R2M A;  1LKO A;  1B71 A;  3E1M A;  4ZL5 A;  4REU A;  4DYZ A;  4W4L B;  1UMN A;  5C6F A;  2V8U A;  2V2J A;  3BVF A;  1XZ3 A;  3A9Q A;  2HTN A;  3AF9 X;  4EVC A;  4DE6 A;  4X0J A;  4DYU A;  1F33 A;  4CMY A;  4ERU A;  4TOG A;  3F38 A;  3MPS A;  2GYD A;  2F7N A;  3PW1 B;  1IES A;  3JZ9 A;  1TKP A;  2IU2 A;  1EUM A;  3SHX A;  1NNQ A;  4E40 A;  3F32 A;  4EVE A;  4RC5 B;  2FG4 A;  4CY9 A;  1NFV A;  2JD7 0;  1XZ1 A;  4MKU A;  4R42 A;  5GU2 X;  2G38 B;  4U3G A;  1JIG A;  4II4 A;  2VXX A;  5D8Y A;  4ITW A;  4W4K B;  2XKQ A;  2Z90 A;  2UX1 A;  5GU3 X;  2V2L A;  5D8X A;  3QHB A;  4MJY A;  3F34 A;  3FRR A;  4ETR A;  2V2I A;  3EGM A;  3Q4N A;  2YW6 A;  2FZF A;  4IWK A;  4KXR B;  3QB9 A;  3WVU A;  3PWQ C;  2V2P A;  4ZL6 A;  3GVY A;  3GGY A;  2JD6 0;  2Y44 A;  4ZMC A;  5FFB A;  1L8H A;  3NP0 X;  5J8W A;  3C1Y A;  5E1U A;  2C2U A;  3VV9 A;  5E2D A;  3O7S A;  4MUD A;  5GN8 A;  4DYY A;  4ITT A;  2ZUR X;  2CN6 A;  4LPJ A;  4ZLW A;  1JKV A;  2V8T A;  3ES3 A;  1JTS A;  3R2O A;  3D19 A;  4CYB A;  4MN9 A;  3BVE A;  5FFA A;  3BVI A;  3W54 A;  1LKM A;  3QHC A;  4CVR A;  2FKZ A;  3SID A;  2W0O A;  3JZA B;  3AJP A;  3R2S A;  5LBH A;  1LKP A;  3KWO A;  5K53 A;  3DBY A;  3UFB A;  5LG8 A;  2ZA8 A;  3E1O A;  4TOE A;  4LPN A;  4M34 A;  4TOH A;  4Y08 A;  4RC6 A;  4ISP A;  5HQO A;  2HR5 A;  3V3K B;  3GHQ A;  1Z6O M;  5LG2 A;  2XGW A;  1GWG A;  1UVH A;  3IS8 A;  3L0M A;  2C2J A;  2OH3 A;  3E2C A;  4WJG 4;  3C23 A;  3E1N A;  4EVD A;  4LQJ A;  5CMR A;  3BVK A;  3C21 A;  3E6S A;  5HJF A;  4A25 A;  3PW8 C;  1SOF A;  1RCC A;  3QZ3 A;  3AF7 X;  4ZKW A;  2ZA6 A;  3F39 A;  3PVT B;  5D8O A;  4KVR A;  3E6R A;  5FEJ A;  3F33 A;  3RGD A;  1HRS A;  2GS4 A;  1LB3 A;  3QD8 A; 
#chains in the Genus database with same CATH homology
 3PWF A;  1RYT A;  2Z5P A;  3PVR A;  1FHA A;  5CMQ A;  5J93 A;  3E1J A;  3HIU A;  1F30 A;  4TOD A;  1NF6 A;  3N6O A;  2CLB A;  3AJO A;  3WVV A;  4RC7 B;  3VNX A;  5GOU A;  4P18 A;  5D8R A;  3F35 A;  4ZKX A;  3PVY B;  5JAC A;  3OJ5 A;  1OTK A;  2CF7 A;  1BG7 A;  2ZG8 X;  2C2F A;  3UOI A;  1RCG A;  3KA4 A;  3NOZ X;  2Z5Q A;  3AK9 A;  3E1P A;  4LQH A;  4YXM A;  5GU0 X;  2G4H A;  4OYN A;  2V2M A;  2CHP A;  2ZG9 X;  4IWJ A;  3GE4 A;  1AEW A;  4DAS A;  3PW1 A;  4DYX A;  4EVB A;  4Z5S A;  4CVS A;  3FSE A;  3KA6 A;  5JKM G;  2OC5 A;  2ITB A;  4M35 A;  2QQY A;  3UOF A;  4ZJK A;  4RC5 A;  1QYB A;  1R03 A;  5FFE A;  5CZU A;  5IX6 A;  1H96 A;  4AM4 A;  1BFR A;  4LPM A;  3FVB A;  3F36 A;  2IY4 A;  5JDO B;  2BK6 A;  3A68 A;  2XJO A;  3Q4Q A;  3KX9 A;  3RBC A;  3NP2 X;  5JKL A;  3ERZ A;  1TJO A;  1N1Q A;  3GGZ A;  2ZA7 A;  3KA8 A;  2C41 A;  2WWX B;  4CVP A;  3EZ0 A;  4CVT A;  4E6K A;  4ZKH A;  5JKM A;  4ML5 A;  2JD8 0;  4YXJ A;  2FG8 A;  3RE7 A;  4PG0 A;  3BVL A;  2ZG7 X;  2FHA A;  4YKH A;  2AR0 A;  4DZ0 A;  3EZU A;  4LYU A;  3C1Z A;  3PWQ A;  1JGC A;  2QF9 A;  3M6J A;  2D5K A;  4AM2 A;  1RCE A;  3QVD A;  1JI4 A;  2V2S A;  2YJK A;  2V2O A;  5HU6 D;  3BKN A;  1O9I A;  2Z5R A;  2BJY A;  3LKD A;  1ZUJ A;  2CHI A;  4XGS A;  1VEL A;  1VLG A;  3OGH A;  4II4 B;  1YV1 A;  5GU1 X;  3F37 A;  1TK6 A;  2WLA A;  4MXP A;  3E1Q A;  4PGK A;  4M32 A;  4PG1 A;  4PGI A;  4RC8 A;  2XJM A;  2V2R A;  4CYA A;  2CLU A;  2FJC A;  5ERK A;  1MOJ A;  2CN7 A;  4LQN A;  4M33 A;  1RCI A;  4ISM A;  3R2H A;  3SE1 A;  1O9R A;  2YW7 A;  4DI0 A;  1QGH A;  4IXK A;  2PYB A;  1L8I A;  3RD0 A;  5D8P A;  3KXU A;  1IER A;  5AXS A;  2XJN A;  2CEI A;  1MFR A;  5GN8 B;  5I4J A;  4XKU A;  1YUZ A;  1JYB A;  4KVS A;  3PVT A;  2VXI A;  3KDQ A;  5FFC A;  1VEI A;  3BT5 A;  1SQ3 A;  1J30 A;  4TOF A;  5JKL G;  3PZA A;  3IS7 A;  2VZB A;  1JRE A;  3IQ1 A;  3WNW A;  4LYX A;  3T9J A;  3HL1 A;  4XKS A;  1DPS A;  1S30 A;  2GYQ A;  2MGY A;  3PW8 A;  4TOC A;  3O7R A;  4CMY V;  5FFD A;  3WVW A;  1Z6O A;  2WTL A;  4RC6 B;  4RC7 A;  1S3Q A;  2FFX J;  4YVZ A;  3Q4R A;  4QUW A;  4TO9 A;  4TOA A;  3ISE A;  3AF8 X;  3PVY A;  3E1L A;  3R2L A;  2V15 A;  2X17 0;  3KHK A;  1JI5 A;  2CWL A;  2YJJ A;  4LQV A;  3TA8 A;  1DVB A;  2CIH A;  3U90 A;  5J9V A;  1YUX A;  2WLU A;  2IB0 A;  2OKC A;  3AK8 A;  1S2Z A;  2FL0 A;  2BKC A;  3SH6 A;  5D8Q A;  2Z6M A;  3R2R A;  4ZTT A;  2C6R A;  4XKT A;  1RCD A;  5J8S A;  3UNO A;  3FI6 A;  3PVR B;  3VVA A;  4TOB A;  1NF4 A;  1VEQ A;  3ISF A;  3R2K A;  1ZS3 A;  5ERJ A;  2Y3Q A;  5K52 A;  3Q4O A;  1JKU A;  3FRS A;  5D8S A;  3AJQ A;  5HJH A;  5JDO A;  1BCF A;  2RBD A;  2N02 A;  1Z4A A;  3H7G A;  3KA3 A;  4Z3B A;  4MY7 A;  4AM5 A;  1KRQ A;  2V2N A;  2BW1 A;  3RAV A;  1DAT A;  1VJX A;  3KA9 A;  1TKO A;  4KVQ A;  5LS9 A;  4TW3 A;  3R2M A;  1LKO A;  1B71 A;  3E1M A;  4ZL5 A;  4REU A;  4DYZ A;  4W4L B;  1UMN A;  5C6F A;  2V8U A;  2V2J A;  3BVF A;  1XZ3 A;  3A9Q A;  2HTN A;  3AF9 X;  4EVC A;  4DE6 A;  4X0J A;  4DYU A;  1F33 A;  4CMY A;  4ERU A;  4TOG A;  3F38 A;  3MPS A;  2GYD A;  2F7N A;  3PW1 B;  1IES A;  3JZ9 A;  1TKP A;  2IU2 A;  1EUM A;  3SHX A;  1NNQ A;  4E40 A;  3F32 A;  4EVE A;  4RC5 B;  2FG4 A;  4CY9 A;  1NFV A;  2JD7 0;  1XZ1 A;  4MKU A;  4R42 A;  5GU2 X;  2G38 B;  4U3G A;  1JIG A;  4II4 A;  2VXX A;  5D8Y A;  4ITW A;  4W4K B;  2XKQ A;  2Z90 A;  2UX1 A;  5GU3 X;  2V2L A;  5D8X A;  3QHB A;  4MJY A;  3F34 A;  3FRR A;  4ETR A;  2V2I A;  3EGM A;  3Q4N A;  2YW6 A;  2FZF A;  4IWK A;  4KXR B;  3QB9 A;  3WVU A;  3PWQ C;  2V2P A;  4ZL6 A;  3GVY A;  3GGY A;  2JD6 0;  2Y44 A;  4ZMC A;  5FFB A;  1L8H A;  3NP0 X;  5J8W A;  3C1Y A;  5E1U A;  2C2U A;  3VV9 A;  5E2D A;  3O7S A;  4MUD A;  5GN8 A;  4DYY A;  4ITT A;  2ZUR X;  2CN6 A;  4LPJ A;  4ZLW A;  1JKV A;  2V8T A;  3ES3 A;  1JTS A;  3R2O A;  3D19 A;  4CYB A;  4MN9 A;  3BVE A;  5FFA A;  3BVI A;  3W54 A;  1LKM A;  3QHC A;  4CVR A;  2FKZ A;  3SID A;  2W0O A;  3JZA B;  3AJP A;  3R2S A;  5LBH A;  1LKP A;  3KWO A;  5K53 A;  3DBY A;  3UFB A;  5LG8 A;  2ZA8 A;  3E1O A;  4TOE A;  4LPN A;  4M34 A;  4TOH A;  4Y08 A;  4RC6 A;  4ISP A;  5HQO A;  2HR5 A;  3V3K B;  3GHQ A;  1Z6O M;  5LG2 A;  2XGW A;  1GWG A;  1UVH A;  3IS8 A;  3L0M A;  2C2J A;  2OH3 A;  3E2C A;  4WJG 4;  3C23 A;  3E1N A;  4EVD A;  4LQJ A;  5CMR A;  3BVK A;  3C21 A;  3E6S A;  5HJF A;  4A25 A;  3PW8 C;  1SOF A;  1RCC A;  3QZ3 A;  3AF7 X;  4ZKW A;  2ZA6 A;  3F39 A;  3PVT B;  5D8O A;  4KVR A;  3E6R A;  5FEJ A;  3F33 A;  3RGD A;  1HRS A;  2GS4 A;  1LB3 A;  3QD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...