1FQTA

Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
MKFTRVCDRRDVPEGEALKVESGGTSVAIFNVDGELFATQDRCTHGDWSLSDGGYLEGDVVECSLHMGKFCVRTGKVKSPPPCEALKIFPIRIEDNDVLVDFEAGYLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords RIESKE-TYPE FERREDOXIN OF BIPHENYL DIOXYGENASE
publication title A cluster exposed: structure of the Rieske ferredoxin from biphenyl dioxygenase and the redox properties of Rieske Fe-S proteins.
pubmed doi rcsb
source organism Burkholderia xenovorans
total genus 22
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 1.14.12.-:
pdb deposition date 2000-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1fqtA00
4P1BH 1SQBE 2HMMA 1ULJA 2NVFA 3L72E 2NWFA 2QJKC 4NBBD 1VM9A 3CX5E 1O7PA 1RIEA 3L70E 4NBHD 2JZAA 4EMJB 1BE3E 3BCCE 4NB9D 3VCAA 4HM5A 3FOUA 4P1CH 1ULIA 3CWBE 5AEWA 2XSOA 1NDOA 1NTME 1O7WA 2D2CD 2HMJA 4HKVA 2YFIA 4HM6A 1WQLA 1BCCE 4HM0A 2QPZA 1VCKA 3GZYA 2IBZE 2YFJA 4QCKA 1P84E 3GTEA 1G8KB 2HMKA 5KKZC 4AAYB 5CXMA 2DE7D 2YFLA 2FYNC 2GBXA 2YIUC 1NTZE 1UUVA 5AEUA 3C0DA 4HM4A 2NVEA 1SJGA 2NUKA 2BCCE 3GCEA 3L71E 4NBED 1SQPE 1NU1E 4PD4E 4AIVA 2BMRA 1L0NE 1UUWA 2A06E 3VMHD 3L74E 1EZVE 4U3FE 1KB9E 3GKEA 1NTKE 2HMOA 1NYKA 1FQTA 3L73E 4HM3A 1KYOE 3CXHE 1O7GA 3GB4A 4OGQD 2XSHA 3L75E 4QDFB 1SQQE 2ZT9D 2HMLA 2E74D 3N0QA 3VMGD 5KLVE 2E4QA 1G8JB 1PP9E 2B1XA 2QJYC 2DE6D 5BOKA 4QDFA 1SQXE 3GOBA 1SQVE 2E75D 3EQQA 3H1IE 4H0LD 4NBGD 4NBDD 2BMOA 3AZCA 2E4PA 4QDDA 1RFSA 1O7NA 3H1HE 2CKFA 1VF5D 3H1LE 4HJLA 2B24A 4QURA 4HM2A 2ZYLA 4QDCA 5HL4A 2BMQA 2NUMA 2YVJB 3GL2A 4QUPA 2QJPC 1L0LE 2E76D 4NBCD 4HM7A 2GBWA 1EG9A 3D89A 3VMID 4QUQA 1O7MA 4HM1A 1Q90C 3H1KE 5KLIC 2FYUE 4NBAD 2XR8A 3GTSA 1JM1A 2DE5D 2XRXA 2HMNA 3H1JE 4NBFD 3GL0A 3EN1A 2Q3WA 4H44D 3GZXA 4NB8D 3DQYA 3TGUE 1PPJE 2I7FA 1ZRTE 2JO6A 1O7HA 2NVGA 3VCPA 4H13D 4PV1D 4HM8A
chains in the Genus database with same CATH superfamily
4P1BH 1SQBE 2HMMA 1ULJA 2NVFA 3L72E 2NWFA 2QJKC 4NBBD 1VM9A 3CX5E 1O7PA 1RIEA 3L70E 4NBHD 2JZAA 4EMJB 1BE3E 3BCCE 4NB9D 3VCAA 4HM5A 3FOUA 4P1CH 1ULIA 3CWBE 5AEWA 2XSOA 1NDOA 1NTME 1O7WA 2D2CD 2HMJA 4HKVA 2YFIA 4HM6A 1WQLA 1BCCE 4HM0A 2QPZA 1VCKA 3GZYA 2IBZE 2YFJA 4QCKA 1P84E 3GTEA 1G8KB 2HMKA 5KKZC 4AAYB 5CXMA 2DE7D 2YFLA 2FYNC 2GBXA 2YIUC 1NTZE 1UUVA 5AEUA 3C0DA 4HM4A 2NVEA 1SJGA 2NUKA 2BCCE 3GCEA 3L71E 4NBED 1SQPE 1NU1E 4PD4E 4AIVA 2BMRA 1L0NE 1UUWA 2A06E 3VMHD 3L74E 1EZVE 4U3FE 1KB9E 3GKEA 1NTKE 2HMOA 1NYKA 1FQTA 3L73E 4HM3A 1KYOE 3CXHE 1O7GA 3GB4A 4OGQD 2XSHA 3L75E 4QDFB 1SQQE 2ZT9D 2HMLA 2E74D 3N0QA 3VMGD 5KLVE 2E4QA 1G8JB 1PP9E 2B1XA 2QJYC 2DE6D 5BOKA 4QDFA 1SQXE 3GOBA 1SQVE 2E75D 3EQQA 3H1IE 4H0LD 4NBGD 4NBDD 2BMOA 3AZCA 2E4PA 4QDDA 1RFSA 1O7NA 3H1HE 2CKFA 1VF5D 3H1LE 4HJLA 2B24A 4QURA 4HM2A 2ZYLA 4QDCA 5HL4A 2BMQA 2NUMA 2YVJB 3GL2A 4QUPA 2QJPC 1L0LE 2E76D 4NBCD 4HM7A 2GBWA 1EG9A 3D89A 3VMID 4QUQA 1O7MA 4HM1A 1Q90C 3H1KE 5KLIC 2FYUE 4NBAD 2XR8A 3GTSA 1JM1A 2DE5D 2XRXA 2HMNA 3H1JE 4NBFD 3GL0A 3EN1A 2Q3WA 4H44D 3GZXA 4NB8D 3DQYA 3TGUE 1PPJE 2I7FA 1ZRTE 2JO6A 1O7HA 2NVGA 3VCPA 4H13D 4PV1D 4HM8A
chains in the Genus database with same CATH topology
4P1BH 1SQBE 2HMMA 1ULJA 2NVFA 3L72E 2NWFA 2QJKC 4NBBD 1VM9A 3CX5E 1O7PA 1RIEA 3L70E 4NBHD 2JZAA 4EMJB 1BE3E 3BCCE 4NB9D 3VCAA 4HM5A 3FOUA 4P1CH 1ULIA 3CWBE 5AEWA 2XSOA 1NDOA 1NTME 1O7WA 2D2CD 2HMJA 4HKVA 2YFIA 4HM6A 1WQLA 1BCCE 4HM0A 2QPZA 1VCKA 3GZYA 2IBZE 2YFJA 4QCKA 1P84E 3GTEA 1G8KB 2HMKA 5KKZC 4AAYB 5CXMA 2DE7D 2YFLA 2FYNC 2GBXA 2YIUC 1NTZE 1UUVA 5AEUA 3C0DA 4HM4A 2NVEA 1SJGA 2NUKA 2BCCE 3GCEA 3L71E 4NBED 1SQPE 1NU1E 4PD4E 4AIVA 2BMRA 1L0NE 1UUWA 2A06E 3VMHD 3L74E 1EZVE 4U3FE 1KB9E 3GKEA 1NTKE 2HMOA 1NYKA 1FQTA 3L73E 4HM3A 1KYOE 3CXHE 1O7GA 3GB4A 4OGQD 2XSHA 3L75E 4QDFB 1SQQE 2ZT9D 2HMLA 2E74D 3N0QA 3VMGD 5KLVE 2E4QA 1G8JB 1PP9E 2B1XA 2QJYC 2DE6D 5BOKA 4QDFA 1SQXE 3GOBA 1SQVE 2E75D 3EQQA 3H1IE 4H0LD 4NBGD 4NBDD 2BMOA 3AZCA 2E4PA 4QDDA 1RFSA 1O7NA 3H1HE 2CKFA 1VF5D 3H1LE 4HJLA 2B24A 4QURA 4HM2A 2ZYLA 4QDCA 5HL4A 2BMQA 2NUMA 2YVJB 3GL2A 4QUPA 2QJPC 1L0LE 2E76D 4NBCD 4HM7A 2GBWA 1EG9A 3D89A 3VMID 4QUQA 1O7MA 4HM1A 1Q90C 3H1KE 5KLIC 2FYUE 4NBAD 2XR8A 3GTSA 1JM1A 2DE5D 2XRXA 2HMNA 3H1JE 4NBFD 3GL0A 3EN1A 2Q3WA 4H44D 3GZXA 4NB8D 3DQYA 3TGUE 1PPJE 2I7FA 1ZRTE 2JO6A 1O7HA 2NVGA 3VCPA 4H13D 4PV1D 4HM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1B H;  1SQB E;  2HMM A;  1ULJ A;  2NVF A;  3L72 E;  2NWF A;  2QJK C;  4NBB D;  1VM9 A;  3CX5 E;  1O7P A;  1RIE A;  3L70 E;  4NBH D;  2JZA A;  4EMJ B;  1BE3 E;  3BCC E;  4NB9 D;  3VCA A;  4HM5 A;  3FOU A;  4P1C H;  1ULI A;  3CWB E;  5AEW A;  2XSO A;  1NDO A;  1NTM E;  1O7W A;  2D2C D;  2HMJ A;  4HKV A;  2YFI A;  4HM6 A;  1WQL A;  1BCC E;  4HM0 A;  2QPZ A;  1VCK A;  3GZY A;  2IBZ E;  2YFJ A;  4QCK A;  1P84 E;  3GTE A;  1G8K B;  2HMK A;  5KKZ C;  4AAY B;  5CXM A;  2DE7 D;  2YFL A;  2FYN C;  2GBX A;  2YIU C;  1NTZ E;  1UUV A;  5AEU A;  3C0D A;  4HM4 A;  2NVE A;  1SJG A;  2NUK A;  2BCC E;  3GCE A;  3L71 E;  4NBE D;  1SQP E;  1NU1 E;  4PD4 E;  4AIV A;  2BMR A;  1L0N E;  1UUW A;  2A06 E;  3VMH D;  3L74 E;  1EZV E;  4U3F E;  1KB9 E;  3GKE A;  1NTK E;  2HMO A;  1NYK A;  1FQT A;  3L73 E;  4HM3 A;  1KYO E;  3CXH E;  1O7G A;  3GB4 A;  4OGQ D;  2XSH A;  3L75 E;  4QDF B;  1SQQ E;  2ZT9 D;  2HML A;  2E74 D;  3N0Q A;  3VMG D;  5KLV E;  2E4Q A;  1G8J B;  1PP9 E;  2B1X A;  2QJY C;  2DE6 D;  5BOK A;  4QDF A;  1SQX E;  3GOB A;  1SQV E;  2E75 D;  3EQQ A;  3H1I E;  4H0L D;  4NBG D;  4NBD D;  2BMO A;  3AZC A;  2E4P A;  4QDD A;  1RFS A;  1O7N A;  3H1H E;  2CKF A;  1VF5 D;  3H1L E;  4HJL A;  2B24 A;  4QUR A;  4HM2 A;  2ZYL A;  4QDC A;  5HL4 A;  2BMQ A;  2NUM A;  2YVJ B;  3GL2 A;  4QUP A;  2QJP C;  1L0L E;  2E76 D;  4NBC D;  4HM7 A;  2GBW A;  1EG9 A;  3D89 A;  3VMI D;  4QUQ A;  1O7M A;  4HM1 A;  1Q90 C;  3H1K E;  5KLI C;  2FYU E;  4NBA D;  2XR8 A;  3GTS A;  1JM1 A;  2DE5 D;  2XRX A;  2HMN A;  3H1J E;  4NBF D;  3GL0 A;  3EN1 A;  2Q3W A;  4H44 D;  3GZX A;  4NB8 D;  3DQY A;  3TGU E;  1PPJ E;  2I7F A;  1ZRT E;  2JO6 A;  1O7H A;  2NVG A;  3VCP A;  4H13 D;  4PV1 D;  4HM8 A; 
#chains in the Genus database with same CATH topology
 4P1B H;  1SQB E;  2HMM A;  1ULJ A;  2NVF A;  3L72 E;  2NWF A;  2QJK C;  4NBB D;  1VM9 A;  3CX5 E;  1O7P A;  1RIE A;  3L70 E;  4NBH D;  2JZA A;  4EMJ B;  1BE3 E;  3BCC E;  4NB9 D;  3VCA A;  4HM5 A;  3FOU A;  4P1C H;  1ULI A;  3CWB E;  5AEW A;  2XSO A;  1NDO A;  1NTM E;  1O7W A;  2D2C D;  2HMJ A;  4HKV A;  2YFI A;  4HM6 A;  1WQL A;  1BCC E;  4HM0 A;  2QPZ A;  1VCK A;  3GZY A;  2IBZ E;  2YFJ A;  4QCK A;  1P84 E;  3GTE A;  1G8K B;  2HMK A;  5KKZ C;  4AAY B;  5CXM A;  2DE7 D;  2YFL A;  2FYN C;  2GBX A;  2YIU C;  1NTZ E;  1UUV A;  5AEU A;  3C0D A;  4HM4 A;  2NVE A;  1SJG A;  2NUK A;  2BCC E;  3GCE A;  3L71 E;  4NBE D;  1SQP E;  1NU1 E;  4PD4 E;  4AIV A;  2BMR A;  1L0N E;  1UUW A;  2A06 E;  3VMH D;  3L74 E;  1EZV E;  4U3F E;  1KB9 E;  3GKE A;  1NTK E;  2HMO A;  1NYK A;  1FQT A;  3L73 E;  4HM3 A;  1KYO E;  3CXH E;  1O7G A;  3GB4 A;  4OGQ D;  2XSH A;  3L75 E;  4QDF B;  1SQQ E;  2ZT9 D;  2HML A;  2E74 D;  3N0Q A;  3VMG D;  5KLV E;  2E4Q A;  1G8J B;  1PP9 E;  2B1X A;  2QJY C;  2DE6 D;  5BOK A;  4QDF A;  1SQX E;  3GOB A;  1SQV E;  2E75 D;  3EQQ A;  3H1I E;  4H0L D;  4NBG D;  4NBD D;  2BMO A;  3AZC A;  2E4P A;  4QDD A;  1RFS A;  1O7N A;  3H1H E;  2CKF A;  1VF5 D;  3H1L E;  4HJL A;  2B24 A;  4QUR A;  4HM2 A;  2ZYL A;  4QDC A;  5HL4 A;  2BMQ A;  2NUM A;  2YVJ B;  3GL2 A;  4QUP A;  2QJP C;  1L0L E;  2E76 D;  4NBC D;  4HM7 A;  2GBW A;  1EG9 A;  3D89 A;  3VMI D;  4QUQ A;  1O7M A;  4HM1 A;  1Q90 C;  3H1K E;  5KLI C;  2FYU E;  4NBA D;  2XR8 A;  3GTS A;  1JM1 A;  2DE5 D;  2XRX A;  2HMN A;  3H1J E;  4NBF D;  3GL0 A;  3EN1 A;  2Q3W A;  4H44 D;  3GZX A;  4NB8 D;  3DQY A;  3TGU E;  1PPJ E;  2I7F A;  1ZRT E;  2JO6 A;  1O7H A;  2NVG A;  3VCP A;  4H13 D;  4PV1 D;  4HM8 A; 
#chains in the Genus database with same CATH homology
 4P1B H;  1SQB E;  2HMM A;  1ULJ A;  2NVF A;  3L72 E;  2NWF A;  2QJK C;  4NBB D;  1VM9 A;  3CX5 E;  1O7P A;  1RIE A;  3L70 E;  4NBH D;  2JZA A;  4EMJ B;  1BE3 E;  3BCC E;  4NB9 D;  3VCA A;  4HM5 A;  3FOU A;  4P1C H;  1ULI A;  3CWB E;  5AEW A;  2XSO A;  1NDO A;  1NTM E;  1O7W A;  2D2C D;  2HMJ A;  4HKV A;  2YFI A;  4HM6 A;  1WQL A;  1BCC E;  4HM0 A;  2QPZ A;  1VCK A;  3GZY A;  2IBZ E;  2YFJ A;  4QCK A;  1P84 E;  3GTE A;  1G8K B;  2HMK A;  5KKZ C;  4AAY B;  5CXM A;  2DE7 D;  2YFL A;  2FYN C;  2GBX A;  2YIU C;  1NTZ E;  1UUV A;  5AEU A;  3C0D A;  4HM4 A;  2NVE A;  1SJG A;  2NUK A;  2BCC E;  3GCE A;  3L71 E;  4NBE D;  1SQP E;  1NU1 E;  4PD4 E;  4AIV A;  2BMR A;  1L0N E;  1UUW A;  2A06 E;  3VMH D;  3L74 E;  1EZV E;  4U3F E;  1KB9 E;  3GKE A;  1NTK E;  2HMO A;  1NYK A;  1FQT A;  3L73 E;  4HM3 A;  1KYO E;  3CXH E;  1O7G A;  3GB4 A;  4OGQ D;  2XSH A;  3L75 E;  4QDF B;  1SQQ E;  2ZT9 D;  2HML A;  2E74 D;  3N0Q A;  3VMG D;  5KLV E;  2E4Q A;  1G8J B;  1PP9 E;  2B1X A;  2QJY C;  2DE6 D;  5BOK A;  4QDF A;  1SQX E;  3GOB A;  1SQV E;  2E75 D;  3EQQ A;  3H1I E;  4H0L D;  4NBG D;  4NBD D;  2BMO A;  3AZC A;  2E4P A;  4QDD A;  1RFS A;  1O7N A;  3H1H E;  2CKF A;  1VF5 D;  3H1L E;  4HJL A;  2B24 A;  4QUR A;  4HM2 A;  2ZYL A;  4QDC A;  5HL4 A;  2BMQ A;  2NUM A;  2YVJ B;  3GL2 A;  4QUP A;  2QJP C;  1L0L E;  2E76 D;  4NBC D;  4HM7 A;  2GBW A;  1EG9 A;  3D89 A;  3VMI D;  4QUQ A;  1O7M A;  4HM1 A;  1Q90 C;  3H1K E;  5KLI C;  2FYU E;  4NBA D;  2XR8 A;  3GTS A;  1JM1 A;  2DE5 D;  2XRX A;  2HMN A;  3H1J E;  4NBF D;  3GL0 A;  3EN1 A;  2Q3W A;  4H44 D;  3GZX A;  4NB8 D;  3DQY A;  3TGU E;  1PPJ E;  2I7F A;  1ZRT E;  2JO6 A;  1O7H A;  2NVG A;  3VCP A;  4H13 D;  4PV1 D;  4HM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...