1FQTA

Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
MKFTRVCDRRDVPEGEALKVESGGTSVAIFNVDGELFATQDRCTHGDWSLSDGGYLEGDVVECSLHMGKFCVRTGKVKSPPPCEALKIFPIRIEDNDVLVDFEAGYLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIESKE-TYPE FERREDOXIN OF BIPHENYL DIOXYGENASE
publication title A cluster exposed: structure of the Rieske ferredoxin from biphenyl dioxygenase and the redox properties of Rieske Fe-S proteins.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 22
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 1.14.12.-:
pdb deposition date 2000-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1fqtA00
3VMGD 2DE6D 1PP9E 2HMOA 5CXMA 1SQPE 4QDCA 3GTEA 2DE7D 2NVEA 1SQBE 4H44D 4HM5A 4QDFB 2E4PA 1O7HA 1UUVA 1RIEA 4HM2A 1BE3E 2BCCE 2NVFA 4QCKA 1O7NA 3DQYA 3VCPA 3L73E 3EN1A 3AZCA 4H13D 3C0DA 1EZVE 2ZT9D 2YFIA 3GCEA 2B1XA 4AIVA 1KYOE 2JO6A 1L0LE 4HJLA 2NVGA 4QURA 4HM3A 4QUQA 5KLVE 1BCCE 2E76D 3CX5E 1VCKA 3FOUA 1G8JB 2YFJA 2HMJA 2FYNC 2HMKA 4HKVA 4HM6A 4AAYB 1L0NE 2E74D 3GZXA 2QJPC 2QJKC 3VMID 2BMRA 4U3FE 1VM9A 3GL0A 1SQQE 5BOKA 2NWFA 4NBBD 2XSOA 1NTZE 2I7FA 4HM8A 3BCCE 4PD4E 2FYUE 2GBXA 4P1CH 4QDFA 1SQXE 2D2CD 2HMLA 1NDOA 2NUMA 3CWBE 3H1KE 2A06E 5HL4A 3H1IE 3CXHE 4QDDA 3GB4A 2ZYLA 3H1LE 1P84E 1PPJE 4NBHD 2QPZA 1RFSA 2CKFA 4P1BH 2JZAA 4HM4A 3L70E 2BMOA 3H1JE 3L71E 1SQVE 4NB9D 1NTME 2YVJB 5AEWA 5AEUA 4NB8D 3L72E 1NYKA 1O7WA 3D89A 2QJYC 4NBAD 3L74E 4HM7A 3TGUE 4NBED 3H1HE 4EMJB 2YIUC 3VMHD 1ULJA 2Q3WA 3VCAA 2BMQA 1ZRTE 1ULIA 3GTSA 4H0LD 2E75D 2XR8A 1O7MA 2IBZE 1KB9E 3L75E 1G8KB 1O7PA 3GOBA 2HMNA 4PV1D 4NBFD 2E4QA 5KLIC 1NU1E 5KKZC 3N0QA 1FQTA 1WQLA 4HM1A 4HM0A 2NUKA 2XRXA 3GKEA 2YFLA 1EG9A 3GZYA 4NBGD 1VF5D 3EQQA 3GL2A 1Q90C 2XSHA 1O7GA 4NBCD 2B24A 2GBWA 4QUPA 1UUWA 4NBDD 1SJGA 2DE5D 1NTKE 4OGQD 2HMMA 1JM1A
chains in the Genus database with same CATH superfamily
3VMGD 2DE6D 1PP9E 2HMOA 5CXMA 1SQPE 4QDCA 3GTEA 2DE7D 2NVEA 1SQBE 4H44D 4HM5A 4QDFB 2E4PA 1O7HA 1UUVA 1RIEA 4HM2A 1BE3E 2BCCE 2NVFA 4QCKA 1O7NA 3DQYA 3VCPA 3L73E 3EN1A 3AZCA 4H13D 3C0DA 1EZVE 2ZT9D 2YFIA 3GCEA 2B1XA 4AIVA 1KYOE 2JO6A 1L0LE 4HJLA 2NVGA 4QURA 4HM3A 4QUQA 5KLVE 1BCCE 2E76D 3CX5E 1VCKA 3FOUA 1G8JB 2YFJA 2HMJA 2FYNC 2HMKA 4HKVA 4HM6A 4AAYB 1L0NE 2E74D 3GZXA 2QJPC 2QJKC 3VMID 2BMRA 4U3FE 1VM9A 3GL0A 1SQQE 5BOKA 2NWFA 4NBBD 2XSOA 1NTZE 2I7FA 4HM8A 3BCCE 4PD4E 2FYUE 2GBXA 4P1CH 4QDFA 1SQXE 2D2CD 2HMLA 1NDOA 2NUMA 3CWBE 3H1KE 2A06E 5HL4A 3H1IE 3CXHE 4QDDA 3GB4A 2ZYLA 3H1LE 1P84E 1PPJE 4NBHD 2QPZA 1RFSA 2CKFA 4P1BH 2JZAA 4HM4A 3L70E 2BMOA 3H1JE 3L71E 1SQVE 4NB9D 1NTME 2YVJB 5AEWA 5AEUA 4NB8D 3L72E 1NYKA 1O7WA 3D89A 2QJYC 4NBAD 3L74E 4HM7A 3TGUE 4NBED 3H1HE 4EMJB 2YIUC 3VMHD 1ULJA 2Q3WA 3VCAA 2BMQA 1ZRTE 1ULIA 3GTSA 4H0LD 2E75D 2XR8A 1O7MA 2IBZE 1KB9E 3L75E 1G8KB 1O7PA 3GOBA 2HMNA 4PV1D 4NBFD 2E4QA 5KLIC 1NU1E 5KKZC 3N0QA 1FQTA 1WQLA 4HM1A 4HM0A 2NUKA 2XRXA 3GKEA 2YFLA 1EG9A 3GZYA 4NBGD 1VF5D 3EQQA 3GL2A 1Q90C 2XSHA 1O7GA 4NBCD 2B24A 2GBWA 4QUPA 1UUWA 4NBDD 1SJGA 2DE5D 1NTKE 4OGQD 2HMMA 1JM1A
chains in the Genus database with same CATH topology
3VMGD 2DE6D 1PP9E 2HMOA 5CXMA 1SQPE 4QDCA 3GTEA 2DE7D 2NVEA 1SQBE 4H44D 4HM5A 4QDFB 2E4PA 1O7HA 1UUVA 1RIEA 4HM2A 1BE3E 2BCCE 2NVFA 4QCKA 1O7NA 3DQYA 3VCPA 3L73E 3EN1A 3AZCA 4H13D 3C0DA 1EZVE 2ZT9D 2YFIA 3GCEA 2B1XA 4AIVA 1KYOE 2JO6A 1L0LE 4HJLA 2NVGA 4QURA 4HM3A 4QUQA 5KLVE 1BCCE 2E76D 3CX5E 1VCKA 3FOUA 1G8JB 2YFJA 2HMJA 2FYNC 2HMKA 4HKVA 4HM6A 4AAYB 1L0NE 2E74D 3GZXA 2QJPC 2QJKC 3VMID 2BMRA 4U3FE 1VM9A 3GL0A 1SQQE 5BOKA 2NWFA 4NBBD 2XSOA 1NTZE 2I7FA 4HM8A 3BCCE 4PD4E 2FYUE 2GBXA 4P1CH 4QDFA 1SQXE 2D2CD 2HMLA 1NDOA 2NUMA 3CWBE 3H1KE 2A06E 5HL4A 3H1IE 3CXHE 4QDDA 3GB4A 2ZYLA 3H1LE 1P84E 1PPJE 4NBHD 2QPZA 1RFSA 2CKFA 4P1BH 2JZAA 4HM4A 3L70E 2BMOA 3H1JE 3L71E 1SQVE 4NB9D 1NTME 2YVJB 5AEWA 5AEUA 4NB8D 3L72E 1NYKA 1O7WA 3D89A 2QJYC 4NBAD 3L74E 4HM7A 3TGUE 4NBED 3H1HE 4EMJB 2YIUC 3VMHD 1ULJA 2Q3WA 3VCAA 2BMQA 1ZRTE 1ULIA 3GTSA 4H0LD 2E75D 2XR8A 1O7MA 2IBZE 1KB9E 3L75E 1G8KB 1O7PA 3GOBA 2HMNA 4PV1D 4NBFD 2E4QA 5KLIC 1NU1E 5KKZC 3N0QA 1FQTA 1WQLA 4HM1A 4HM0A 2NUKA 2XRXA 3GKEA 2YFLA 1EG9A 3GZYA 4NBGD 1VF5D 3EQQA 3GL2A 1Q90C 2XSHA 1O7GA 4NBCD 2B24A 2GBWA 4QUPA 1UUWA 4NBDD 1SJGA 2DE5D 1NTKE 4OGQD 2HMMA 1JM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMG D;  2DE6 D;  1PP9 E;  2HMO A;  5CXM A;  1SQP E;  4QDC A;  3GTE A;  2DE7 D;  2NVE A;  1SQB E;  4H44 D;  4HM5 A;  4QDF B;  2E4P A;  1O7H A;  1UUV A;  1RIE A;  4HM2 A;  1BE3 E;  2BCC E;  2NVF A;  4QCK A;  1O7N A;  3DQY A;  3VCP A;  3L73 E;  3EN1 A;  3AZC A;  4H13 D;  3C0D A;  1EZV E;  2ZT9 D;  2YFI A;  3GCE A;  2B1X A;  4AIV A;  1KYO E;  2JO6 A;  1L0L E;  4HJL A;  2NVG A;  4QUR A;  4HM3 A;  4QUQ A;  5KLV E;  1BCC E;  2E76 D;  3CX5 E;  1VCK A;  3FOU A;  1G8J B;  2YFJ A;  2HMJ A;  2FYN C;  2HMK A;  4HKV A;  4HM6 A;  4AAY B;  1L0N E;  2E74 D;  3GZX A;  2QJP C;  2QJK C;  3VMI D;  2BMR A;  4U3F E;  1VM9 A;  3GL0 A;  1SQQ E;  5BOK A;  2NWF A;  4NBB D;  2XSO A;  1NTZ E;  2I7F A;  4HM8 A;  3BCC E;  4PD4 E;  2FYU E;  2GBX A;  4P1C H;  4QDF A;  1SQX E;  2D2C D;  2HML A;  1NDO A;  2NUM A;  3CWB E;  3H1K E;  2A06 E;  5HL4 A;  3H1I E;  3CXH E;  4QDD A;  3GB4 A;  2ZYL A;  3H1L E;  1P84 E;  1PPJ E;  4NBH D;  2QPZ A;  1RFS A;  2CKF A;  4P1B H;  2JZA A;  4HM4 A;  3L70 E;  2BMO A;  3H1J E;  3L71 E;  1SQV E;  4NB9 D;  1NTM E;  2YVJ B;  5AEW A;  5AEU A;  4NB8 D;  3L72 E;  1NYK A;  1O7W A;  3D89 A;  2QJY C;  4NBA D;  3L74 E;  4HM7 A;  3TGU E;  4NBE D;  3H1H E;  4EMJ B;  2YIU C;  3VMH D;  1ULJ A;  2Q3W A;  3VCA A;  2BMQ A;  1ZRT E;  1ULI A;  3GTS A;  4H0L D;  2E75 D;  2XR8 A;  1O7M A;  2IBZ E;  1KB9 E;  3L75 E;  1G8K B;  1O7P A;  3GOB A;  2HMN A;  4PV1 D;  4NBF D;  2E4Q A;  5KLI C;  1NU1 E;  5KKZ C;  3N0Q A;  1FQT A;  1WQL A;  4HM1 A;  4HM0 A;  2NUK A;  2XRX A;  3GKE A;  2YFL A;  1EG9 A;  3GZY A;  4NBG D;  1VF5 D;  3EQQ A;  3GL2 A;  1Q90 C;  2XSH A;  1O7G A;  4NBC D;  2B24 A;  2GBW A;  4QUP A;  1UUW A;  4NBD D;  1SJG A;  2DE5 D;  1NTK E;  4OGQ D;  2HMM A;  1JM1 A; 
#chains in the Genus database with same CATH topology
 3VMG D;  2DE6 D;  1PP9 E;  2HMO A;  5CXM A;  1SQP E;  4QDC A;  3GTE A;  2DE7 D;  2NVE A;  1SQB E;  4H44 D;  4HM5 A;  4QDF B;  2E4P A;  1O7H A;  1UUV A;  1RIE A;  4HM2 A;  1BE3 E;  2BCC E;  2NVF A;  4QCK A;  1O7N A;  3DQY A;  3VCP A;  3L73 E;  3EN1 A;  3AZC A;  4H13 D;  3C0D A;  1EZV E;  2ZT9 D;  2YFI A;  3GCE A;  2B1X A;  4AIV A;  1KYO E;  2JO6 A;  1L0L E;  4HJL A;  2NVG A;  4QUR A;  4HM3 A;  4QUQ A;  5KLV E;  1BCC E;  2E76 D;  3CX5 E;  1VCK A;  3FOU A;  1G8J B;  2YFJ A;  2HMJ A;  2FYN C;  2HMK A;  4HKV A;  4HM6 A;  4AAY B;  1L0N E;  2E74 D;  3GZX A;  2QJP C;  2QJK C;  3VMI D;  2BMR A;  4U3F E;  1VM9 A;  3GL0 A;  1SQQ E;  5BOK A;  2NWF A;  4NBB D;  2XSO A;  1NTZ E;  2I7F A;  4HM8 A;  3BCC E;  4PD4 E;  2FYU E;  2GBX A;  4P1C H;  4QDF A;  1SQX E;  2D2C D;  2HML A;  1NDO A;  2NUM A;  3CWB E;  3H1K E;  2A06 E;  5HL4 A;  3H1I E;  3CXH E;  4QDD A;  3GB4 A;  2ZYL A;  3H1L E;  1P84 E;  1PPJ E;  4NBH D;  2QPZ A;  1RFS A;  2CKF A;  4P1B H;  2JZA A;  4HM4 A;  3L70 E;  2BMO A;  3H1J E;  3L71 E;  1SQV E;  4NB9 D;  1NTM E;  2YVJ B;  5AEW A;  5AEU A;  4NB8 D;  3L72 E;  1NYK A;  1O7W A;  3D89 A;  2QJY C;  4NBA D;  3L74 E;  4HM7 A;  3TGU E;  4NBE D;  3H1H E;  4EMJ B;  2YIU C;  3VMH D;  1ULJ A;  2Q3W A;  3VCA A;  2BMQ A;  1ZRT E;  1ULI A;  3GTS A;  4H0L D;  2E75 D;  2XR8 A;  1O7M A;  2IBZ E;  1KB9 E;  3L75 E;  1G8K B;  1O7P A;  3GOB A;  2HMN A;  4PV1 D;  4NBF D;  2E4Q A;  5KLI C;  1NU1 E;  5KKZ C;  3N0Q A;  1FQT A;  1WQL A;  4HM1 A;  4HM0 A;  2NUK A;  2XRX A;  3GKE A;  2YFL A;  1EG9 A;  3GZY A;  4NBG D;  1VF5 D;  3EQQ A;  3GL2 A;  1Q90 C;  2XSH A;  1O7G A;  4NBC D;  2B24 A;  2GBW A;  4QUP A;  1UUW A;  4NBD D;  1SJG A;  2DE5 D;  1NTK E;  4OGQ D;  2HMM A;  1JM1 A; 
#chains in the Genus database with same CATH homology
 3VMG D;  2DE6 D;  1PP9 E;  2HMO A;  5CXM A;  1SQP E;  4QDC A;  3GTE A;  2DE7 D;  2NVE A;  1SQB E;  4H44 D;  4HM5 A;  4QDF B;  2E4P A;  1O7H A;  1UUV A;  1RIE A;  4HM2 A;  1BE3 E;  2BCC E;  2NVF A;  4QCK A;  1O7N A;  3DQY A;  3VCP A;  3L73 E;  3EN1 A;  3AZC A;  4H13 D;  3C0D A;  1EZV E;  2ZT9 D;  2YFI A;  3GCE A;  2B1X A;  4AIV A;  1KYO E;  2JO6 A;  1L0L E;  4HJL A;  2NVG A;  4QUR A;  4HM3 A;  4QUQ A;  5KLV E;  1BCC E;  2E76 D;  3CX5 E;  1VCK A;  3FOU A;  1G8J B;  2YFJ A;  2HMJ A;  2FYN C;  2HMK A;  4HKV A;  4HM6 A;  4AAY B;  1L0N E;  2E74 D;  3GZX A;  2QJP C;  2QJK C;  3VMI D;  2BMR A;  4U3F E;  1VM9 A;  3GL0 A;  1SQQ E;  5BOK A;  2NWF A;  4NBB D;  2XSO A;  1NTZ E;  2I7F A;  4HM8 A;  3BCC E;  4PD4 E;  2FYU E;  2GBX A;  4P1C H;  4QDF A;  1SQX E;  2D2C D;  2HML A;  1NDO A;  2NUM A;  3CWB E;  3H1K E;  2A06 E;  5HL4 A;  3H1I E;  3CXH E;  4QDD A;  3GB4 A;  2ZYL A;  3H1L E;  1P84 E;  1PPJ E;  4NBH D;  2QPZ A;  1RFS A;  2CKF A;  4P1B H;  2JZA A;  4HM4 A;  3L70 E;  2BMO A;  3H1J E;  3L71 E;  1SQV E;  4NB9 D;  1NTM E;  2YVJ B;  5AEW A;  5AEU A;  4NB8 D;  3L72 E;  1NYK A;  1O7W A;  3D89 A;  2QJY C;  4NBA D;  3L74 E;  4HM7 A;  3TGU E;  4NBE D;  3H1H E;  4EMJ B;  2YIU C;  3VMH D;  1ULJ A;  2Q3W A;  3VCA A;  2BMQ A;  1ZRT E;  1ULI A;  3GTS A;  4H0L D;  2E75 D;  2XR8 A;  1O7M A;  2IBZ E;  1KB9 E;  3L75 E;  1G8K B;  1O7P A;  3GOB A;  2HMN A;  4PV1 D;  4NBF D;  2E4Q A;  5KLI C;  1NU1 E;  5KKZ C;  3N0Q A;  1FQT A;  1WQL A;  4HM1 A;  4HM0 A;  2NUK A;  2XRX A;  3GKE A;  2YFL A;  1EG9 A;  3GZY A;  4NBG D;  1VF5 D;  3EQQ A;  3GL2 A;  1Q90 C;  2XSH A;  1O7G A;  4NBC D;  2B24 A;  2GBW A;  4QUP A;  1UUW A;  4NBD D;  1SJG A;  2DE5 D;  1NTK E;  4OGQ D;  2HMM A;  1JM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...