1SQPE

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 38
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqpE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqpE02
3DQYA 3GL2A 2JZAA 1SQBE 1VM9A 4HM6A 1RIEA 2ZYLA 1SQQE 3GL0A 1RFSA 1SQXE 2FYUE 1O7NA 4NB8D 3FOUA 1ULIA 3L71E 1NTKE 3H1JE 2CKFA 4HM7A 4NBAD 2E4PA 2A06E 2GBXA 2Q3WA 1NU1E 4NBFD 3D89A 4QURA 2YFLA 2BMOA 3VMHD 3AZCA 2B1XA 3GZXA 2HMKA 4HM1A 1SJGA 4QDCA 1BCCE 1EZVE 2FYNC 2E4QA 4QDDA 1O7GA 4AAYB 3CX5E 2NUMA 2JO6A 2DE7D 4NBGD 2XSHA 2NWFA 1UUWA 3BCCE 2HMJA 3GTEA 1VCKA 3GZYA 3EN1A 1L0LE 2E74D 2YFIA 4HM8A 4NBHD 1O7HA 1O7MA 4H13D 2YIUC 2BMQA 2YVJB 4QDFB 3CXHE 4HM5A 4H44D 4NBED 2E76D 1NTZE 2D2CD 1VF5D 3H1KE 1G8JB 2B24A 4P1BH 3VCPA 4U3FE 1FQTA 2DE5D 1PP9E 3L74E 4NBDD 2QJKC 3GKEA 1EG9A 2HMNA 1ULJA 2HMLA 3H1LE 2NVGA 4QCKA 3L72E 2NVFA 4P1CH 2NVEA 3GB4A 5AEUA 3EQQA 3L70E 3L73E 4QUPA 4HM2A 3H1HE 2DE6D 1G8KB 1KB9E 5HL4A 4D6TE 1UUVA 2XRXA 4QDFA 4QUQA 5AEWA 1NYKA 1Q90C 4HM0A 4OGQD 4AIVA 1KYOE 2HMMA 4HKVA 2IBZE 4HM4A 1BE3E 2E75D 2QPZA 2QJYC 1O7WA 3GOBA 2ZT9D 1SQVE 2BMRA 2XR8A 1P84E 2QJPC 4HM3A 3L75E 3CWBE 1NDOA 5KKZC 4NB9D 2HMOA 2BCCE 3GTSA 4HJLA 4H0LD 2NUKA 3H1IE 1NTME 1BGYE 2GBWA 3TGUE 1JM1A 4PD4E 1SQPE 2XSOA 4PV1D 3VMGD 2YFJA 3GCEA 1L0NE 1ZRTE 3C0DA 5BOKA 3N0QA 5KLIC 5KLVE 3VMID 1WQLA 4NBCD 5CXMA 4NBBD 1PPJE 1O7PA 2I7FA 3VCAA 4EMJB
chains in the Genus database with same CATH superfamily
1N73A 2GM4A 4RO0A 2JZAA 1SQQE 1KD1Q 1PZQA 5KTBA 1UIIA 3L71E 1GL2B 1NTKE 2HODA 2IYPA 3H1HJ 1VQLP 4NBAD 1S72P 1NTKD 2ZYAA 4OWFA 4AAYB 2QVAA 2D2CB 1S5LH 2JR8A 4DOJA 4W80A 1HGVA 1NTKK 1NH4A 1SFCD 2M5AB 3B5NA 5APWA 3BVHA 3CCLP 1X9VA 1SQBG 4HH2A 1P84D 5CCGA 1L0LD 4DJGA 1PGJA 4R4LA 3VCPA 1EG9A 2WSFJ 1K05A 1NU1G 3L72E 4HYTB 1RF1C 4KT0J 1KV4A 1EDKA 2FXOA 1HJBA 1GK4A 1Q90C 2JP3A 2CPBA 2HMMA 3L74G 1LNQA 1U7MA 3RK3B 2VRSA 1GU5A 5AW4B 2KK7A 4PV1B 4DCKA 2OYOA 3AE8C 1R8EA 3AE9C 2YXQB 2HFED 1PGPA 2WSCH 2QJPB 2FFDA 1VDFA 1QX8A 2KSJA 1SFCB 4NBCD 3VN0A 1HTLC 3L72J 5AVSB 1NTZG 2A06G 1YIJP 1KORA 4JQ0D 1U7JA 3IR9A 5AVYB 1VQ8P 4MN4C 3H1LG 3RGUA 2YMYA 2BMOA 5APXA 2IFMA 2HR3A 2JWDA 4OH8B 3CCJP 1PPJG 1L2PA 2NUMA 2R3SA 2DE7D 2PGDA 2I1KA 3AECC 1YJ9P 1NTMD 4GKGA 3BCCG 1FOSE 1N7SA 2KSEA 1EQ7A 1GMJA 2IZ0A 2POHA 4C7NA 1HUCA 1PP9E 2QJKC 3FWNA 4QMAA 3RL0C 1L4AB 1ZLLA 2FBWC 1LP1A 2M3BA 1YJNP 3H1KD 1SS1A 3VTPC 1KB9E 2RH0A 3CCUP 2WPVB 1Q90D 3OJAB 2E75C 3CX5I 4HM4A 2QRXA 4GOFA 1XTGB 3H1LJ 2AXCA 2XR8A 3E7KA 1BSNA 2WQYC 3HUSC 1W5CE 2N9BA 4GOEA 3I55P 2E5YA 2C9NY 1JUNA 3L75G 3SWYA 1BE3G 1IFMA 2P67A 1K8AQ 1M1JC 2ZYDA 2I7FA 4EOTA 1Y9BA 1VM9A 1RIEA 3F5HA 1RFSA 1Q2NA 1HVVA 2GUSA 2GBXA 1DIPA 3D89A 1EXJA 3GMAA 1TU3F 3T97A 1N7SB 4QDCA 2E4QA 3C8VA 2XSHA 2HMJA 3EWKA 1LTJB 2ZXEB 1VCKA 3BATA 4WBAA 4L76A 4HM8A 1FZFA 2IFNA 5APVA 2OYIB 2M8RA 2K3RA 4TT3H 5AW0B 1KFMA 5BVZA 4L73A 2C0XA 2PAJA 1H89A 4GT1A 4XE5B 1YYCA 1A02J 5E79E 4UB6E 2AEJA 4DT0A 1JTHA 2LR2A 4OGQD 1KB9H 4HKVA 1OW8A 1SQPK 3Q3DA 2J5UA 4HM3A 5KKZC 1N7SC 1LTBC 2N9YB 2GBWA 4Y99B 2XSOA 3GLMA 3MTUE 3V2RA 5BOKA 3N0QA 5APSA 2IBZG 3HRNA 1RF0C 2H89C 2LKMA 3GL2A 4GDOA 1QEXA 2OTJP 1BGYG 1P84I 2CKFA 1LTIC 2FYUD 1T2KC 1VQPP 3A0BE 5AVQB 3NFQA 1ZOYC 1FZAA 1NKNA 2MKVA 3G4SP 4QDDA 1RQUA 1G2CA 1R5LA 5CHXA 1IZNB 3I56P 2P58A 3BCCE 2OTKE 1LT9A 3H32B 1MFZA 1OWAA 2E74D 4ZKUA 3L71G 5GTHE 2V7QH 1KFNA 2E76C 2RN0A 1AA0A 4L74A 3L74E 2M0BA 1L0NG 1NTZD 4YXWH 4ZMDA 3JSVC 3AEFC 3RK3D 4P1CH 2GUVA 1PL5A 5TJHA 3FWLA 3A3YB 5E79H 2N1TD 1T3JA 1OW6A 2O01J 4JBZA 1JOCA 1JY3O 1O7WA 2R44A 3HUSA 4NB9D 2PP6A 1NTMJ 3H1IJ 3CLQA 2FXMA 3NXSA 2YFJA 1EDLA 3C0DA 1LTGC 1URQD 1WQLA 2V7QJ 1LJ2A 4HM6A 4M3LA 1LGHB 2Q6QA 1FU1A 1L0LG 3WUTA 4EI2A 1SQQK 1AV1A 3AZCA 1N8RQ 3A0BH 3AE4C 1NOHA 4H44B 3CCRP 3G71P 5KAFE 3CXHH 2BCCD 1NJIQ 5AVXB 4JF7A 1LT1A 1L0ND 1G8JB 3T97B 2WMMA 3AE7C 5C39A 4QCKA 2KLVA 2JDIH 2NVEA 2Y0DA 3EQQA 2W8ZA 3HE5B 3MD0A 1G8KB 3TSIA 1EDJA 3HUSB 3CCEP 4ZKPA 1ZMEC 1BE3E 4TLFA 2QPZA 3L71J 1SQBK 3WU2H 2HPCB 1CW5A 1RHZB 4H0LB 1BGYE 5APUA 1ZR4A 1ZRTE 2ZT9B 1LTJA 2HYNA 1OIPA 3GW6A 2K9JB 3USSA 1GW3A 2N1TA 4RJTA 2KXPB 3MUDA 2I8DA 1H8AA 1NTKJ 1AJYA 3HE5A 3LIEA 1URQB 2WSEH 4NBFD 1K9MQ 3ABVC 1NVOA 2WSEJ 1G2CB 1LT9C 3TGUJ 2NWFA 1UUWA 4I1LA 2OARA 2FFDC 3GZYA 3D71A 3M91A 5KAFH 1IFJA 3CXHE 1DEEG 2GA1A 4NBED 5AVVB 3R2PA 4N6JA 3CMAP 1SP4A 1L0LK 1PV3A 2P10A 1FJKA 4AUWA 2Z5HA 2BEZF 2HMNA 2YIUB 4XFJA 3H1LE 1OXZA 1HGZA 1BE3J 3BRTB 1KQLA 3GB4A 3B4SA 2MJZA 1S9KD 5GTIE 3MHVA 2SPZA 5BU5A 2PRRA 1KN7A 3CI9A 1KTMA 1M56D 3IAOA 5AEWA 1SQXK 1KILA 2P7JA 1RE4A 1YHQP 2E75D 2KP8A 5CJ0A 2BMRA 4Y99C 3SSUA 1S2EA 4I6MC 2QIWA 4W7YA 2B87B 3HD7C 3WU2E 2YMKA 4EIJA 4PD4E 1AQTA 1FDMA 1SQQD 5K5GB 2XU6A 5KLIC 3RK2D 1OW7A 2KOGA 4EYYQ 2YNYA 2K37A 1NU1K 3PJSK 2BEQD 2FY8A 1KQGB 4UB6H 3U1CA 1JM0A 1SFCC 2RKLA 1HJ0A 4HJGH 3V2PA 2QG4A 1JY2O 1NYHA 5AW5B 1RE3A 2JO6A 2WPRA 3IN6A 4IL6H 3CD6P 1VQKP 1UIXA 3B5ND 3RK3C 1LTJC 2KI7B 2K1AA 2ZAEB 1J1EC 4H13C 1M8OB 1JTHB 1LT9B 1GL2C 2N1TC 2B87A 1N86A 1AVYA 3VP8A 4NBDD 1KB9D 2R32A 3L70G 2HODB 4C46A 2OYHB 3L70E 3A5TA 3H1IG 2IBZD 3L70D 1J1DB 3RK3E 3A2AA 3RBZA 4QUQA 3JCUE 1BGYD 5AVUB 1JY3N 2K88A 3OW2O 2HPCA 2KZIA 4I7ZC 3L75E 3CWBE 2BCCE 1AVOA 2KLUA 3FX0A 3M0DC 3VMGD 1DX7A 5GTHH 3AE1C 5AVTB 4PD4H 3UIAA 4NBBD 1X8YA 3V4QA 3DQYA 1X22A 1DD3A 1KYOD 1GTWA 3CWBG 2NPSC 1T6AA 3D6ZA 4JYBA 1PFIA 2RMZA 1BCCE 2FYNC 2QSIA 3SFDC 1VF5B 2I1JA 2JEEA 3L75J 1EXIA 3B5NC 5B5EE 2JKVA 1GK6A 5KLIB 2YFIA 4NBHD 4KHXA 3L72G 4H13D 1O7MA 1FAVA 2LXBA 4IL6E 1VQ5P 4N78D 1X79B 2Y0EA 3MGNA 5AW1B 2LXCB 3L37A 1FZEA 1MV8A 2B24A 4O9BA 1KQFB 2H43A 1L4AD 1QVGO 1YBKA 5AW2B 3H1HD 1NAFA 2HLOA 1UUVA 4IFDK 1LTTC 4HM0A 2W6BA 1MFTA 1URQA 2QJPC 3BCCJ 3JCUH 3HD7A 3EFGA 3D70A 2HG5D 4RKUJ 3L73J 3C1LA 2IZ1A 1QL1A 1ZN5A 5CCHD 5CMZA 2A45H 1H88A 2G8YA 2Q5UA 3PP5A 5L8RJ 1O7NA 2KB7P 2B88A 5APTA 1AQ5A 3KHUA 4BXLA 1DH3A 3GZXA 5AW6B 3AEEC 2Q3EA 1VL2A 3PH0A 4C7NB 1NU1D 1EDIA 4PD4D 2AEFA 5APYA 3M0DA 3AE5C 2XDJA 1S3JA 1FZCA 2A45G 1IFDA 2N1TB 3S9OA 3G6EP 1ZV8A 1VF5D 3CMEP 1N2DC 1BDDA 4IFFA 1NTZK 2KUBA 2W27A 1M1JA 2C9LY 2NVFA 4N78E 3PTZA 2PFXA 4PD4I 2YO3A 4WVZA 3MUDC 1W2EA 2OTLP 2Z4EA 1XTCC 1S1CX 5AVWB 1SQVE 4WY4B 1J2JB 1RH5B 4A7PA 3TNUA 1YQ3C 3IFMA 5EFWB 3CXHI 1G1JA 3RL0g 4NPDA 1ZW0A 3Q5RA 1BCCJ 2M3EA 4AQRD 5AW8B 2KNCA 1SQXE 2WPQA 3H6PA 2NPSA 3H1HG 3CL3D 3L73G 4WY4C 5GTIH 1Y47A 2XZRA 4QURA 2YFLA 1IFPA 4OVNF 1N7LA 2HMKA 1JY2N 3H1KG 1HF9A 3CC4P 1WT6A 3VMAA 2YO2A 5APQA 2AXTE 1YTZT 1L0LE 4C7RA 5CBNA 3O8ZA 3II6A 1IJDB 1L0NK 4YTPC 2QE7H 1IC2A 3L72D 2O1KA 2Z5IA 5H2FH 1JB0J 1D7MA 1Q81Q 1EZVI 4ZNCA 3NMDA 1NO4A 3KDPB 4NPFX 4B86A 4OGQB 5HL4A 2QM8A 1QLED 2ZYGA 3TYYA 3VOPA 3AEBC 1FBMA 3NTNA 5KJ7D 1URQC 3IF4A 1H0TA 1JCCA 3GOBA 1WRGA 3VMYA 1U57A 2BCCG 2WZ7A 2YKQA 2WSFH 3ZDMA 1N7SD 3H1JD 3KQGA 1SQXD 1JNMA 3CX5D 1L0NE 3P8CD 1M57D 1J1EB 4H13B 3GF3A 1A02F 5AW7B 3VCAA 1SQVD 4BRYA 3ITKA 1Q82Q 3FOUA 3V5BA 5KLVD 1KILC 2IYOA 5AVRB 1NU1E 2UWJE 1OFCX 3TGUD 4KJMA 4HB1A 4LC1A 2QJKB 1BSHA 3EFFK 1S4XA 1BCCG 2WVRA 2IBZI 4WWIA 2O01H 1QGKB 2P1JA 1O7HA 2XNDH 2B9BA 2YVJB 5DJTB 2AXTH 2O3JA 2NRGA 4IL6X 3H1LD 2FXPA 4JPZB 1RY3A 1FQTA 2HMLA 3C9IA 1JY2P 3V6IA 2FYUK 4QUPA 1YQ4C 1KYOH 2IX7C 1VF5C 1SQVG 2FYNB 1WMKA 3CWBJ 3AEGC 2ZFCA 1L4AA 2ZT9D 3MZWB 4PJ0H 1SQBJ 1NDOA 3GTSA 1HH0A 4H0LD 2FYUG 1GL2A 3L74D 5B5EH 1SQQJ 5DJUB 4DZOA 2ZVNB 5CCHA 2A06D 4PV1C 3KZIH 2WWWA 1EZVG 1JMBA 1FS0E 1KQSO 3D6YA 4U3FJ 2A45I 1EZVD 4ASVA 2WITA 3B8EB 3TGUG 2FYUE 2OYIA 1IK9A 2Q1KA 1KC8Q 1KILD 4HM7A 2E4PA 4I7ZB 3A7OA 2B89A 2WPSA 1ZXGA 3RK2C 1SQXG 3H1ID 3L4FA 3S4RA 2E42A 1JCDA 3RBXA 1OMIA 3VMZA 1DEBA 1CZQA 2J58A 5B66H 2OGUA 3F89A 3GTEA 3M06A 4LLHA 2P2UA 4EDFA 1QVFO 3RK2B 2YXRB 2Y0CA 1MKMA 2D2CC 2DW3A 3TNUB 5M1BA 3Q2YA 3QWOC 3K5BA 2E75B 3L70J 3V4WA 1W2BO 2K9JA 1HBWA 3HD7D 3PRJA 3A0HH 2XRXA 4QDFA 2ZJSE 1BGYJ 4AIVA 1KYOE 1ZR2A 2ZVOB 4GODA 3GHGC 3SWKA 3AE2C 3FGAD 1CI6B 2BCCJ 5KLVK 1MZ9A 3H25A 1NTMG 4PJ0E 4PV1D 1FZCB 1NWQA 1JEKA 5CCHC 2R5BA 2KS1A 1PGQA 3KZIE 2E5TA 3AE3C 1NTZJ 1YI2P 4NB8D 3CCQP 3W68A 2V4HA 4U3FD 2WTYA 2A06E 3Q5PA 1FC2C 2JWAA 2IDBA 2Q9IA 1JY3P 1EZVE 1GL2D 1OVUA 2OQQA 1BDCA 1P84H 3GF7A 1OZHA 1RE3C 4NPEA 3KYQA 2QM7A 1USDA 2Q7CA 3GHGB 2NPSD 3BRVB 3O6QB 3TF5A 1SVFA 2YIUC 1H0TB 1RF0A 1VQOP 2CK3H 3CCVP 4H44D 2E76D 1NTZE 2D2CD 2WT7B 2R3CA 4P1BH 4U3FE 3CC2P 3MP7B 2DE5D 5AW3B 1YJWP 4D6TG 3HE4A 2NVGA 1FE6A 1NGMB 3U1AA 4L75A 1LTAC 4HM2A 1LWUB 1Z56A 1SQQG 3H1KJ 3CCMP 3BASA 1NYKA 1RE4C 2E43A 2G3AA 1CI6A 1KZUB 2W83C 1L4AC 2L91A 3A0HE 3CCSP 1FZCC 3GHGA 3L73D 1LTSC 3HTKA 1J1DC 2ITAA 4ASWA 5CCGC 3OA7A 3TGUE 1JM1A 2E76B 1L0NJ 2C0WA 2QJYB 1PPJE 3FXDA 4N3YB 2ZT9C 3VYIA 4R4MA 5H2FE 1SQBE 3E1RA 2XKMA 3HD7B 4H0LC 1LWUC 2OYHA 4XA4A 1NTKG 1GDTA 1OVVA 2KIKA 3PLNA 2BASA 1K73Q 1T3UA 3WUVA 1G1IA 2WSCJ 2M5AA 1FZBA 1NKZB 2FFDB 3VMXA 2B1XA 3M9QA 1PP9G 4HM1A 3CWBD 1SJGA 1M1KQ 1O7GA 4W7ZA 1ZP0C 4BRYB 1SQPG 3P8CE 1VQ4P 2Y9YA 4GIFA 1NU1J 3EN1A 3RL0B 2FKWB 1FDIA 4WB4A 4QDFB 2O01N 3JC22 1AFOA 4RESB 2H7HA 2QEXP 4OGQC 1KILE 3CC7P 4UB8E 4Z1MH 2WSSH 5AW9B 3VP9A 5AEUA 1M90Q 3H1JG 1PP9J 1IO4A 5BU8B 3PHLA 1NAYA 1YITP 4K35A 4K3AA 2KYVA 4Y28J 2Y9ZA 3M0AA 2IBZE 3B5NB 5KJ7C 1SLQA 2K9YA 4D6TD 1EC5A 3H32A 1GW4A 2W6AA 1VQ9P 1Q7YQ 2NUKA 2AEMA 1SQPE 4AYCA 5TISE 1T2KD 2YKPA 3TK1A 1BCCD 1DD4A 2E74B 1KILB 1USEA 2NZ2A 2KZJA 3V2QA 3S1KA 4EMJB 3W67A 3U59A 2ZYLA 3GL0A 1N73C 4BWNA 3MIWA 1HWTC 1CSBA 2IPPA 3Q1MA 2Q3WA 2JO1A 5KAIH 1FJPA 3TDKA 3L35A 3P8MC 1PPJD 3WUUA 4U3FG 3GG2A 1IFNA 1BE3D 1E5WA 2FYUJ 3CX5E 1X0TA 3CPWO 1YTZI 2KNCB 1RF1B 2YKOA 1M7LA 1KB9I 1GZLA 2Q3IA 4LGDE 4CPGA 2BMQA 4HM5A 1KYOI 1PGOA 1S9KE 4I2LC 1IK7A 1LWUA 2OYHC 4IFMA 1R5SA 2J59M 1SQPD 3EQ2A 4JYCA 3HE4B 1JO5A 2JJLA 3B71A 1VQ6P 4UB8H 3KPEA 3O6QA 2R5DA 3WMM0 4H44C 3CXHD 5AVZB 4D6TE 2ZXXA 1VQMP 2H88C 1GD2E 3HTKB 1VQ7P 1PP9D 1FZGA 4YPCA 2W6JH 4IOIH 3RL0D 3SFEC 3LW5J 5KLVG 2QJYC 1SQXJ 3L75D 3FXEA 3H1JJ 2HMOA 5B66E 4HJLA 1FOSF 3H1IE 1NTME 3AEDC 2L5GB 4WY4D 3GCEA 4D6TJ 1LP1B 1S5LX 3I5CA 1RQVA 3N7NA 2XV5A 5TISH 3AE6C 1OX3A 1SQVK 3Q5SA 1SQVJ 4YXDC 1ULIA 1T8ZA 3G9RA 1GU4A 3H1JE 1E79H 1L0LJ 1NTMK 1JMMA 5KLVJ 3AEAC 2CPSA 1VPCA 1RF1A 2QA4P 3VMHD 1S5LE 3P7KA 3M9BA 3KXDA 1N73B 5KAIE 4NBGD 3BCCD 1K04A 2E74C 3CX5H 3L36A 2O1JA 3LIDA 2XNXA 2H8PD 2FYZA 2W90A 1ZRTD 3H1KE 3QH9A 2OYIC 1Y8AA 3GKEA 4HKZH 1ULJA 3OAKA 1Q86Q 1SFCA 1FDOA 1MUUA 3L73E 3H1HE 2DE6D 3R4YA 1KMIZ 5CCGD 1SQPJ 3N4XA 3E1IA 5KKZB 3P32A 4WY4A 2KS1B 3L71D 5KJ7A 3L74J 5CJ4A 3V2NA 1SQBD 3M9HA 1PIXA 1P84E 2WT7A 3G3ZA 1NHLA 1QL2A 3SWFA 3LW5H 1IFIA 5CBOA 1VQNP 1M1JB 1OVRA 5KLVE 3VMID 5CXMA 1O7PA 4U7JA 2NPSB
chains in the Genus database with same CATH topology
3DQYA 3GL2A 2JZAA 1SQBE 1VM9A 4HM6A 1RIEA 2ZYLA 1SQQE 3GL0A 1RFSA 1SQXE 2FYUE 1O7NA 4NB8D 3FOUA 1ULIA 3L71E 1NTKE 3H1JE 2CKFA 4HM7A 4NBAD 2E4PA 2A06E 2GBXA 2Q3WA 1NU1E 4NBFD 3D89A 4QURA 2YFLA 2BMOA 3VMHD 3AZCA 2B1XA 3GZXA 2HMKA 4HM1A 1SJGA 4QDCA 1BCCE 1EZVE 2FYNC 2E4QA 4QDDA 1O7GA 4AAYB 3CX5E 2NUMA 2JO6A 2DE7D 4NBGD 2XSHA 2NWFA 1UUWA 3BCCE 2HMJA 3GTEA 1VCKA 3GZYA 3EN1A 1L0LE 2E74D 2YFIA 4HM8A 4NBHD 1O7HA 1O7MA 4H13D 2YIUC 2BMQA 2YVJB 4QDFB 3CXHE 4HM5A 4H44D 4NBED 2E76D 1NTZE 2D2CD 1VF5D 3H1KE 1G8JB 2B24A 4P1BH 3VCPA 4U3FE 1FQTA 2DE5D 1PP9E 3L74E 4NBDD 2QJKC 3GKEA 1EG9A 2HMNA 1ULJA 2HMLA 3H1LE 2NVGA 4QCKA 3L72E 2NVFA 4P1CH 2NVEA 3GB4A 5AEUA 3EQQA 3L70E 3L73E 4QUPA 4HM2A 3H1HE 2DE6D 1G8KB 1KB9E 5HL4A 4D6TE 1UUVA 2XRXA 4QDFA 4QUQA 5AEWA 1NYKA 1Q90C 4HM0A 4OGQD 4AIVA 1KYOE 2HMMA 4HKVA 2IBZE 4HM4A 1BE3E 2E75D 2QPZA 2QJYC 1O7WA 3GOBA 2ZT9D 1SQVE 2BMRA 2XR8A 1P84E 2QJPC 4HM3A 3L75E 3CWBE 1NDOA 5KKZC 4NB9D 2HMOA 2BCCE 3GTSA 4HJLA 4H0LD 2NUKA 3H1IE 1NTME 1BGYE 2GBWA 3TGUE 1JM1A 4PD4E 1SQPE 2XSOA 4PV1D 3VMGD 2YFJA 3GCEA 1L0NE 1ZRTE 3C0DA 5BOKA 3N0QA 5KLIC 5KLVE 3VMID 1WQLA 4NBCD 5CXMA 4NBBD 1PPJE 1O7PA 2I7FA 3VCAA 4EMJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQY A;  3GL2 A;  2JZA A;  1SQB E;  1VM9 A;  4HM6 A;  1RIE A;  2ZYL A;  1SQQ E;  3GL0 A;  1RFS A;  1SQX E;  2FYU E;  1O7N A;  4NB8 D;  3FOU A;  1ULI A;  3L71 E;  1NTK E;  3H1J E;  2CKF A;  4HM7 A;  4NBA D;  2E4P A;  2A06 E;  2GBX A;  2Q3W A;  1NU1 E;  4NBF D;  3D89 A;  4QUR A;  2YFL A;  2BMO A;  3VMH D;  3AZC A;  2B1X A;  3GZX A;  2HMK A;  4HM1 A;  1SJG A;  4QDC A;  1BCC E;  1EZV E;  2FYN C;  2E4Q A;  4QDD A;  1O7G A;  4AAY B;  3CX5 E;  2NUM A;  2JO6 A;  2DE7 D;  4NBG D;  2XSH A;  2NWF A;  1UUW A;  3BCC E;  2HMJ A;  3GTE A;  1VCK A;  3GZY A;  3EN1 A;  1L0L E;  2E74 D;  2YFI A;  4HM8 A;  4NBH D;  1O7H A;  1O7M A;  4H13 D;  2YIU C;  2BMQ A;  2YVJ B;  4QDF B;  3CXH E;  4HM5 A;  4H44 D;  4NBE D;  2E76 D;  1NTZ E;  2D2C D;  1VF5 D;  3H1K E;  1G8J B;  2B24 A;  4P1B H;  3VCP A;  4U3F E;  1FQT A;  2DE5 D;  1PP9 E;  3L74 E;  4NBD D;  2QJK C;  3GKE A;  1EG9 A;  2HMN A;  1ULJ A;  2HML A;  3H1L E;  2NVG A;  4QCK A;  3L72 E;  2NVF A;  4P1C H;  2NVE A;  3GB4 A;  5AEU A;  3EQQ A;  3L70 E;  3L73 E;  4QUP A;  4HM2 A;  3H1H E;  2DE6 D;  1G8K B;  1KB9 E;  5HL4 A;  4D6T E;  1UUV A;  2XRX A;  4QDF A;  4QUQ A;  5AEW A;  1NYK A;  1Q90 C;  4HM0 A;  4OGQ D;  4AIV A;  1KYO E;  2HMM A;  4HKV A;  2IBZ E;  4HM4 A;  1BE3 E;  2E75 D;  2QPZ A;  2QJY C;  1O7W A;  3GOB A;  2ZT9 D;  1SQV E;  2BMR A;  2XR8 A;  1P84 E;  2QJP C;  4HM3 A;  3L75 E;  3CWB E;  1NDO A;  5KKZ C;  4NB9 D;  2HMO A;  2BCC E;  3GTS A;  4HJL A;  4H0L D;  2NUK A;  3H1I E;  1NTM E;  1BGY E;  2GBW A;  3TGU E;  1JM1 A;  4PD4 E;  1SQP E;  2XSO A;  4PV1 D;  3VMG D;  2YFJ A;  3GCE A;  1L0N E;  1ZRT E;  3C0D A;  5BOK A;  3N0Q A;  5KLI C;  5KLV E;  3VMI D;  1WQL A;  4NBC D;  5CXM A;  4NBB D;  1PPJ E;  1O7P A;  2I7F A;  3VCA A;  4EMJ B; 
#chains in the Genus database with same CATH topology
 1N73 A;  2GM4 A;  4RO0 A;  2JZA A;  1SQQ E;  1KD1 Q;  1PZQ A;  5KTB A;  1UII A;  3L71 E;  1GL2 B;  1NTK E;  2HOD A;  2IYP A;  3H1H J;  1VQL P;  4NBA D;  1S72 P;  1NTK D;  2ZYA A;  4OWF A;  4AAY B;  2QVA A;  2D2C B;  1S5L H;  2JR8 A;  4DOJ A;  4W80 A;  1HGV A;  1NTK K;  1NH4 A;  1SFC D;  2M5A B;  3B5N A;  5APW A;  3BVH A;  3CCL P;  1X9V A;  1SQB G;  4HH2 A;  1P84 D;  5CCG A;  1L0L D;  4DJG A;  1PGJ A;  4R4L A;  3VCP A;  1EG9 A;  2WSF J;  1K05 A;  1NU1 G;  3L72 E;  4HYT B;  1RF1 C;  4KT0 J;  1KV4 A;  1EDK A;  2FXO A;  1HJB A;  1GK4 A;  1Q90 C;  2JP3 A;  2CPB A;  2HMM A;  3L74 G;  1LNQ A;  1U7M A;  3RK3 B;  2VRS A;  1GU5 A;  5AW4 B;  2KK7 A;  4PV1 B;  4DCK A;  2OYO A;  3AE8 C;  1R8E A;  3AE9 C;  2YXQ B;  2HFE D;  1PGP A;  2WSC H;  2QJP B;  2FFD A;  1VDF A;  1QX8 A;  2KSJ A;  1SFC B;  4NBC D;  3VN0 A;  1HTL C;  3L72 J;  5AVS B;  1NTZ G;  2A06 G;  1YIJ P;  1KOR A;  4JQ0 D;  1U7J A;  3IR9 A;  5AVY B;  1VQ8 P;  4MN4 C;  3H1L G;  3RGU A;  2YMY A;  2BMO A;  5APX A;  2IFM A;  2HR3 A;  2JWD A;  4OH8 B;  3CCJ P;  1PPJ G;  1L2P A;  2NUM A;  2R3S A;  2DE7 D;  2PGD A;  2I1K A;  3AEC C;  1YJ9 P;  1NTM D;  4GKG A;  3BCC G;  1FOS E;  1N7S A;  2KSE A;  1EQ7 A;  1GMJ A;  2IZ0 A;  2POH A;  4C7N A;  1HUC A;  1PP9 E;  2QJK C;  3FWN A;  4QMA A;  3RL0 C;  1L4A B;  1ZLL A;  2FBW C;  1LP1 A;  2M3B A;  1YJN P;  3H1K D;  1SS1 A;  3VTP C;  1KB9 E;  2RH0 A;  3CCU P;  2WPV B;  1Q90 D;  3OJA B;  2E75 C;  3CX5 I;  4HM4 A;  2QRX A;  4GOF A;  1XTG B;  3H1L J;  2AXC A;  2XR8 A;  3E7K A;  1BSN A;  2WQY C;  3HUS C;  1W5C E;  2N9B A;  4GOE A;  3I55 P;  2E5Y A;  2C9N Y;  1JUN A;  3L75 G;  3SWY A;  1BE3 G;  1IFM A;  2P67 A;  1K8A Q;  1M1J C;  2ZYD A;  2I7F A;  4EOT A;  1Y9B A;  1VM9 A;  1RIE A;  3F5H A;  1RFS A;  1Q2N A;  1HVV A;  2GUS A;  2GBX A;  1DIP A;  3D89 A;  1EXJ A;  3GMA A;  1TU3 F;  3T97 A;  1N7S B;  4QDC A;  2E4Q A;  3C8V A;  2XSH A;  2HMJ A;  3EWK A;  1LTJ B;  2ZXE B;  1VCK A;  3BAT A;  4WBA A;  4L76 A;  4HM8 A;  1FZF A;  2IFN A;  5APV A;  2OYI B;  2M8R A;  2K3R A;  4TT3 H;  5AW0 B;  1KFM A;  5BVZ A;  4L73 A;  2C0X A;  2PAJ A;  1H89 A;  4GT1 A;  4XE5 B;  1YYC A;  1A02 J;  5E79 E;  4UB6 E;  2AEJ A;  4DT0 A;  1JTH A;  2LR2 A;  4OGQ D;  1KB9 H;  4HKV A;  1OW8 A;  1SQP K;  3Q3D A;  2J5U A;  4HM3 A;  5KKZ C;  1N7S C;  1LTB C;  2N9Y B;  2GBW A;  4Y99 B;  2XSO A;  3GLM A;  3MTU E;  3V2R A;  5BOK A;  3N0Q A;  5APS A;  2IBZ G;  3HRN A;  1RF0 C;  2H89 C;  2LKM A;  3GL2 A;  4GDO A;  1QEX A;  2OTJ P;  1BGY G;  1P84 I;  2CKF A;  1LTI C;  2FYU D;  1T2K C;  1VQP P;  3A0B E;  5AVQ B;  3NFQ A;  1ZOY C;  1FZA A;  1NKN A;  2MKV A;  3G4S P;  4QDD A;  1RQU A;  1G2C A;  1R5L A;  5CHX A;  1IZN B;  3I56 P;  2P58 A;  3BCC E;  2OTK E;  1LT9 A;  3H32 B;  1MFZ A;  1OWA A;  2E74 D;  4ZKU A;  3L71 G;  5GTH E;  2V7Q H;  1KFN A;  2E76 C;  2RN0 A;  1AA0 A;  4L74 A;  3L74 E;  2M0B A;  1L0N G;  1NTZ D;  4YXW H;  4ZMD A;  3JSV C;  3AEF C;  3RK3 D;  4P1C H;  2GUV A;  1PL5 A;  5TJH A;  3FWL A;  3A3Y B;  5E79 H;  2N1T D;  1T3J A;  1OW6 A;  2O01 J;  4JBZ A;  1JOC A;  1JY3 O;  1O7W A;  2R44 A;  3HUS A;  4NB9 D;  2PP6 A;  1NTM J;  3H1I J;  3CLQ A;  2FXM A;  3NXS A;  2YFJ A;  1EDL A;  3C0D A;  1LTG C;  1URQ D;  1WQL A;  2V7Q J;  1LJ2 A;  4HM6 A;  4M3L A;  1LGH B;  2Q6Q A;  1FU1 A;  1L0L G;  3WUT A;  4EI2 A;  1SQQ K;  1AV1 A;  3AZC A;  1N8R Q;  3A0B H;  3AE4 C;  1NOH A;  4H44 B;  3CCR P;  3G71 P;  5KAF E;  3CXH H;  2BCC D;  1NJI Q;  5AVX B;  4JF7 A;  1LT1 A;  1L0N D;  1G8J B;  3T97 B;  2WMM A;  3AE7 C;  5C39 A;  4QCK A;  2KLV A;  2JDI H;  2NVE A;  2Y0D A;  3EQQ A;  2W8Z A;  3HE5 B;  3MD0 A;  1G8K B;  3TSI A;  1EDJ A;  3HUS B;  3CCE P;  4ZKP A;  1ZME C;  1BE3 E;  4TLF A;  2QPZ A;  3L71 J;  1SQB K;  3WU2 H;  2HPC B;  1CW5 A;  1RHZ B;  4H0L B;  1BGY E;  5APU A;  1ZR4 A;  1ZRT E;  2ZT9 B;  1LTJ A;  2HYN A;  1OIP A;  3GW6 A;  2K9J B;  3USS A;  1GW3 A;  2N1T A;  4RJT A;  2KXP B;  3MUD A;  2I8D A;  1H8A A;  1NTK J;  1AJY A;  3HE5 A;  3LIE A;  1URQ B;  2WSE H;  4NBF D;  1K9M Q;  3ABV C;  1NVO A;  2WSE J;  1G2C B;  1LT9 C;  3TGU J;  2NWF A;  1UUW A;  4I1L A;  2OAR A;  2FFD C;  3GZY A;  3D71 A;  3M91 A;  5KAF H;  1IFJ A;  3CXH E;  1DEE G;  2GA1 A;  4NBE D;  5AVV B;  3R2P A;  4N6J A;  3CMA P;  1SP4 A;  1L0L K;  1PV3 A;  2P10 A;  1FJK A;  4AUW A;  2Z5H A;  2BEZ F;  2HMN A;  2YIU B;  4XFJ A;  3H1L E;  1OXZ A;  1HGZ A;  1BE3 J;  3BRT B;  1KQL A;  3GB4 A;  3B4S A;  2MJZ A;  1S9K D;  5GTI E;  3MHV A;  2SPZ A;  5BU5 A;  2PRR A;  1KN7 A;  3CI9 A;  1KTM A;  1M56 D;  3IAO A;  5AEW A;  1SQX K;  1KIL A;  2P7J A;  1RE4 A;  1YHQ P;  2E75 D;  2KP8 A;  5CJ0 A;  2BMR A;  4Y99 C;  3SSU A;  1S2E A;  4I6M C;  2QIW A;  4W7Y A;  2B87 B;  3HD7 C;  3WU2 E;  2YMK A;  4EIJ A;  4PD4 E;  1AQT A;  1FDM A;  1SQQ D;  5K5G B;  2XU6 A;  5KLI C;  3RK2 D;  1OW7 A;  2KOG A;  4EYY Q;  2YNY A;  2K37 A;  1NU1 K;  3PJS K;  2BEQ D;  2FY8 A;  1KQG B;  4UB6 H;  3U1C A;  1JM0 A;  1SFC C;  2RKL A;  1HJ0 A;  4HJG H;  3V2P A;  2QG4 A;  1JY2 O;  1NYH A;  5AW5 B;  1RE3 A;  2JO6 A;  2WPR A;  3IN6 A;  4IL6 H;  3CD6 P;  1VQK P;  1UIX A;  3B5N D;  3RK3 C;  1LTJ C;  2KI7 B;  2K1A A;  2ZAE B;  1J1E C;  4H13 C;  1M8O B;  1JTH B;  1LT9 B;  1GL2 C;  2N1T C;  2B87 A;  1N86 A;  1AVY A;  3VP8 A;  4NBD D;  1KB9 D;  2R32 A;  3L70 G;  2HOD B;  4C46 A;  2OYH B;  3L70 E;  3A5T A;  3H1I G;  2IBZ D;  3L70 D;  1J1D B;  3RK3 E;  3A2A A;  3RBZ A;  4QUQ A;  3JCU E;  1BGY D;  5AVU B;  1JY3 N;  2K88 A;  3OW2 O;  2HPC A;  2KZI A;  4I7Z C;  3L75 E;  3CWB E;  2BCC E;  1AVO A;  2KLU A;  3FX0 A;  3M0D C;  3VMG D;  1DX7 A;  5GTH H;  3AE1 C;  5AVT B;  4PD4 H;  3UIA A;  4NBB D;  1X8Y A;  3V4Q A;  3DQY A;  1X22 A;  1DD3 A;  1KYO D;  1GTW A;  3CWB G;  2NPS C;  1T6A A;  3D6Z A;  4JYB A;  1PFI A;  2RMZ A;  1BCC E;  2FYN C;  2QSI A;  3SFD C;  1VF5 B;  2I1J A;  2JEE A;  3L75 J;  1EXI A;  3B5N C;  5B5E E;  2JKV A;  1GK6 A;  5KLI B;  2YFI A;  4NBH D;  4KHX A;  3L72 G;  4H13 D;  1O7M A;  1FAV A;  2LXB A;  4IL6 E;  1VQ5 P;  4N78 D;  1X79 B;  2Y0E A;  3MGN A;  5AW1 B;  2LXC B;  3L37 A;  1FZE A;  1MV8 A;  2B24 A;  4O9B A;  1KQF B;  2H43 A;  1L4A D;  1QVG O;  1YBK A;  5AW2 B;  3H1H D;  1NAF A;  2HLO A;  1UUV A;  4IFD K;  1LTT C;  4HM0 A;  2W6B A;  1MFT A;  1URQ A;  2QJP C;  3BCC J;  3JCU H;  3HD7 A;  3EFG A;  3D70 A;  2HG5 D;  4RKU J;  3L73 J;  3C1L A;  2IZ1 A;  1QL1 A;  1ZN5 A;  5CCH D;  5CMZ A;  2A45 H;  1H88 A;  2G8Y A;  2Q5U A;  3PP5 A;  5L8R J;  1O7N A;  2KB7 P;  2B88 A;  5APT A;  1AQ5 A;  3KHU A;  4BXL A;  1DH3 A;  3GZX A;  5AW6 B;  3AEE C;  2Q3E A;  1VL2 A;  3PH0 A;  4C7N B;  1NU1 D;  1EDI A;  4PD4 D;  2AEF A;  5APY A;  3M0D A;  3AE5 C;  2XDJ A;  1S3J A;  1FZC A;  2A45 G;  1IFD A;  2N1T B;  3S9O A;  3G6E P;  1ZV8 A;  1VF5 D;  3CME P;  1N2D C;  1BDD A;  4IFF A;  1NTZ K;  2KUB A;  2W27 A;  1M1J A;  2C9L Y;  2NVF A;  4N78 E;  3PTZ A;  2PFX A;  4PD4 I;  2YO3 A;  4WVZ A;  3MUD C;  1W2E A;  2OTL P;  2Z4E A;  1XTC C;  1S1C X;  5AVW B;  1SQV E;  4WY4 B;  1J2J B;  1RH5 B;  4A7P A;  3TNU A;  1YQ3 C;  3IFM A;  5EFW B;  3CXH I;  1G1J A;  3RL0 g;  4NPD A;  1ZW0 A;  3Q5R A;  1BCC J;  2M3E A;  4AQR D;  5AW8 B;  2KNC A;  1SQX E;  2WPQ A;  3H6P A;  2NPS A;  3H1H G;  3CL3 D;  3L73 G;  4WY4 C;  5GTI H;  1Y47 A;  2XZR A;  4QUR A;  2YFL A;  1IFP A;  4OVN F;  1N7L A;  2HMK A;  1JY2 N;  3H1K G;  1HF9 A;  3CC4 P;  1WT6 A;  3VMA A;  2YO2 A;  5APQ A;  2AXT E;  1YTZ T;  1L0L E;  4C7R A;  5CBN A;  3O8Z A;  3II6 A;  1IJD B;  1L0N K;  4YTP C;  2QE7 H;  1IC2 A;  3L72 D;  2O1K A;  2Z5I A;  5H2F H;  1JB0 J;  1D7M A;  1Q81 Q;  1EZV I;  4ZNC A;  3NMD A;  1NO4 A;  3KDP B;  4NPF X;  4B86 A;  4OGQ B;  5HL4 A;  2QM8 A;  1QLE D;  2ZYG A;  3TYY A;  3VOP A;  3AEB C;  1FBM A;  3NTN A;  5KJ7 D;  1URQ C;  3IF4 A;  1H0T A;  1JCC A;  3GOB A;  1WRG A;  3VMY A;  1U57 A;  2BCC G;  2WZ7 A;  2YKQ A;  2WSF H;  3ZDM A;  1N7S D;  3H1J D;  3KQG A;  1SQX D;  1JNM A;  3CX5 D;  1L0N E;  3P8C D;  1M57 D;  1J1E B;  4H13 B;  3GF3 A;  1A02 F;  5AW7 B;  3VCA A;  1SQV D;  4BRY A;  3ITK A;  1Q82 Q;  3FOU A;  3V5B A;  5KLV D;  1KIL C;  2IYO A;  5AVR B;  1NU1 E;  2UWJ E;  1OFC X;  3TGU D;  4KJM A;  4HB1 A;  4LC1 A;  2QJK B;  1BSH A;  3EFF K;  1S4X A;  1BCC G;  2WVR A;  2IBZ I;  4WWI A;  2O01 H;  1QGK B;  2P1J A;  1O7H A;  2XND H;  2B9B A;  2YVJ B;  5DJT B;  2AXT H;  2O3J A;  2NRG A;  4IL6 X;  3H1L D;  2FXP A;  4JPZ B;  1RY3 A;  1FQT A;  2HML A;  3C9I A;  1JY2 P;  3V6I A;  2FYU K;  4QUP A;  1YQ4 C;  1KYO H;  2IX7 C;  1VF5 C;  1SQV G;  2FYN B;  1WMK A;  3CWB J;  3AEG C;  2ZFC A;  1L4A A;  2ZT9 D;  3MZW B;  4PJ0 H;  1SQB J;  1NDO A;  3GTS A;  1HH0 A;  4H0L D;  2FYU G;  1GL2 A;  3L74 D;  5B5E H;  1SQQ J;  5DJU B;  4DZO A;  2ZVN B;  5CCH A;  2A06 D;  4PV1 C;  3KZI H;  2WWW A;  1EZV G;  1JMB A;  1FS0 E;  1KQS O;  3D6Y A;  4U3F J;  2A45 I;  1EZV D;  4ASV A;  2WIT A;  3B8E B;  3TGU G;  2FYU E;  2OYI A;  1IK9 A;  2Q1K A;  1KC8 Q;  1KIL D;  4HM7 A;  2E4P A;  4I7Z B;  3A7O A;  2B89 A;  2WPS A;  1ZXG A;  3RK2 C;  1SQX G;  3H1I D;  3L4F A;  3S4R A;  2E42 A;  1JCD A;  3RBX A;  1OMI A;  3VMZ A;  1DEB A;  1CZQ A;  2J58 A;  5B66 H;  2OGU A;  3F89 A;  3GTE A;  3M06 A;  4LLH A;  2P2U A;  4EDF A;  1QVF O;  3RK2 B;  2YXR B;  2Y0C A;  1MKM A;  2D2C C;  2DW3 A;  3TNU B;  5M1B A;  3Q2Y A;  3QWO C;  3K5B A;  2E75 B;  3L70 J;  3V4W A;  1W2B O;  2K9J A;  1HBW A;  3HD7 D;  3PRJ A;  3A0H H;  2XRX A;  4QDF A;  2ZJS E;  1BGY J;  4AIV A;  1KYO E;  1ZR2 A;  2ZVO B;  4GOD A;  3GHG C;  3SWK A;  3AE2 C;  3FGA D;  1CI6 B;  2BCC J;  5KLV K;  1MZ9 A;  3H25 A;  1NTM G;  4PJ0 E;  4PV1 D;  1FZC B;  1NWQ A;  1JEK A;  5CCH C;  2R5B A;  2KS1 A;  1PGQ A;  3KZI E;  2E5T A;  3AE3 C;  1NTZ J;  1YI2 P;  4NB8 D;  3CCQ P;  3W68 A;  2V4H A;  4U3F D;  2WTY A;  2A06 E;  3Q5P A;  1FC2 C;  2JWA A;  2IDB A;  2Q9I A;  1JY3 P;  1EZV E;  1GL2 D;  1OVU A;  2OQQ A;  1BDC A;  1P84 H;  3GF7 A;  1OZH A;  1RE3 C;  4NPE A;  3KYQ A;  2QM7 A;  1USD A;  2Q7C A;  3GHG B;  2NPS D;  3BRV B;  3O6Q B;  3TF5 A;  1SVF A;  2YIU C;  1H0T B;  1RF0 A;  1VQO P;  2CK3 H;  3CCV P;  4H44 D;  2E76 D;  1NTZ E;  2D2C D;  2WT7 B;  2R3C A;  4P1B H;  4U3F E;  3CC2 P;  3MP7 B;  2DE5 D;  5AW3 B;  1YJW P;  4D6T G;  3HE4 A;  2NVG A;  1FE6 A;  1NGM B;  3U1A A;  4L75 A;  1LTA C;  4HM2 A;  1LWU B;  1Z56 A;  1SQQ G;  3H1K J;  3CCM P;  3BAS A;  1NYK A;  1RE4 C;  2E43 A;  2G3A A;  1CI6 A;  1KZU B;  2W83 C;  1L4A C;  2L91 A;  3A0H E;  3CCS P;  1FZC C;  3GHG A;  3L73 D;  1LTS C;  3HTK A;  1J1D C;  2ITA A;  4ASW A;  5CCG C;  3OA7 A;  3TGU E;  1JM1 A;  2E76 B;  1L0N J;  2C0W A;  2QJY B;  1PPJ E;  3FXD A;  4N3Y B;  2ZT9 C;  3VYI A;  4R4M A;  5H2F E;  1SQB E;  3E1R A;  2XKM A;  3HD7 B;  4H0L C;  1LWU C;  2OYH A;  4XA4 A;  1NTK G;  1GDT A;  1OVV A;  2KIK A;  3PLN A;  2BAS A;  1K73 Q;  1T3U A;  3WUV A;  1G1I A;  2WSC J;  2M5A A;  1FZB A;  1NKZ B;  2FFD B;  3VMX A;  2B1X A;  3M9Q A;  1PP9 G;  4HM1 A;  3CWB D;  1SJG A;  1M1K Q;  1O7G A;  4W7Z A;  1ZP0 C;  4BRY B;  1SQP G;  3P8C E;  1VQ4 P;  2Y9Y A;  4GIF A;  1NU1 J;  3EN1 A;  3RL0 B;  2FKW B;  1FDI A;  4WB4 A;  4QDF B;  2O01 N;  3JC2 2;  1AFO A;  4RES B;  2H7H A;  2QEX P;  4OGQ C;  1KIL E;  3CC7 P;  4UB8 E;  4Z1M H;  2WSS H;  5AW9 B;  3VP9 A;  5AEU A;  1M90 Q;  3H1J G;  1PP9 J;  1IO4 A;  5BU8 B;  3PHL A;  1NAY A;  1YIT P;  4K35 A;  4K3A A;  2KYV A;  4Y28 J;  2Y9Z A;  3M0A A;  2IBZ E;  3B5N B;  5KJ7 C;  1SLQ A;  2K9Y A;  4D6T D;  1EC5 A;  3H32 A;  1GW4 A;  2W6A A;  1VQ9 P;  1Q7Y Q;  2NUK A;  2AEM A;  1SQP E;  4AYC A;  5TIS E;  1T2K D;  2YKP A;  3TK1 A;  1BCC D;  1DD4 A;  2E74 B;  1KIL B;  1USE A;  2NZ2 A;  2KZJ A;  3V2Q A;  3S1K A;  4EMJ B;  3W67 A;  3U59 A;  2ZYL A;  3GL0 A;  1N73 C;  4BWN A;  3MIW A;  1HWT C;  1CSB A;  2IPP A;  3Q1M A;  2Q3W A;  2JO1 A;  5KAI H;  1FJP A;  3TDK A;  3L35 A;  3P8M C;  1PPJ D;  3WUU A;  4U3F G;  3GG2 A;  1IFN A;  1BE3 D;  1E5W A;  2FYU J;  3CX5 E;  1X0T A;  3CPW O;  1YTZ I;  2KNC B;  1RF1 B;  2YKO A;  1M7L A;  1KB9 I;  1GZL A;  2Q3I A;  4LGD E;  4CPG A;  2BMQ A;  4HM5 A;  1KYO I;  1PGO A;  1S9K E;  4I2L C;  1IK7 A;  1LWU A;  2OYH C;  4IFM A;  1R5S A;  2J59 M;  1SQP D;  3EQ2 A;  4JYC A;  3HE4 B;  1JO5 A;  2JJL A;  3B71 A;  1VQ6 P;  4UB8 H;  3KPE A;  3O6Q A;  2R5D A;  3WMM 0;  4H44 C;  3CXH D;  5AVZ B;  4D6T E;  2ZXX A;  1VQM P;  2H88 C;  1GD2 E;  3HTK B;  1VQ7 P;  1PP9 D;  1FZG A;  4YPC A;  2W6J H;  4IOI H;  3RL0 D;  3SFE C;  3LW5 J;  5KLV G;  2QJY C;  1SQX J;  3L75 D;  3FXE A;  3H1J J;  2HMO A;  5B66 E;  4HJL A;  1FOS F;  3H1I E;  1NTM E;  3AED C;  2L5G B;  4WY4 D;  3GCE A;  4D6T J;  1LP1 B;  1S5L X;  3I5C A;  1RQV A;  3N7N A;  2XV5 A;  5TIS H;  3AE6 C;  1OX3 A;  1SQV K;  3Q5S A;  1SQV J;  4YXD C;  1ULI A;  1T8Z A;  3G9R A;  1GU4 A;  3H1J E;  1E79 H;  1L0L J;  1NTM K;  1JMM A;  5KLV J;  3AEA C;  2CPS A;  1VPC A;  1RF1 A;  2QA4 P;  3VMH D;  1S5L E;  3P7K A;  3M9B A;  3KXD A;  1N73 B;  5KAI E;  4NBG D;  3BCC D;  1K04 A;  2E74 C;  3CX5 H;  3L36 A;  2O1J A;  3LID A;  2XNX A;  2H8P D;  2FYZ A;  2W90 A;  1ZRT D;  3H1K E;  3QH9 A;  2OYI C;  1Y8A A;  3GKE A;  4HKZ H;  1ULJ A;  3OAK A;  1Q86 Q;  1SFC A;  1FDO A;  1MUU A;  3L73 E;  3H1H E;  2DE6 D;  3R4Y A;  1KMI Z;  5CCG D;  1SQP J;  3N4X A;  3E1I A;  5KKZ B;  3P32 A;  4WY4 A;  2KS1 B;  3L71 D;  5KJ7 A;  3L74 J;  5CJ4 A;  3V2N A;  1SQB D;  3M9H A;  1PIX A;  1P84 E;  2WT7 A;  3G3Z A;  1NHL A;  1QL2 A;  3SWF A;  3LW5 H;  1IFI A;  5CBO A;  1VQN P;  1M1J B;  1OVR A;  5KLV E;  3VMI D;  5CXM A;  1O7P A;  4U7J A;  2NPS B; 
#chains in the Genus database with same CATH homology
 3DQY A;  3GL2 A;  2JZA A;  1SQB E;  1VM9 A;  4HM6 A;  1RIE A;  2ZYL A;  1SQQ E;  3GL0 A;  1RFS A;  1SQX E;  2FYU E;  1O7N A;  4NB8 D;  3FOU A;  1ULI A;  3L71 E;  1NTK E;  3H1J E;  2CKF A;  4HM7 A;  4NBA D;  2E4P A;  2A06 E;  2GBX A;  2Q3W A;  1NU1 E;  4NBF D;  3D89 A;  4QUR A;  2YFL A;  2BMO A;  3VMH D;  3AZC A;  2B1X A;  3GZX A;  2HMK A;  4HM1 A;  1SJG A;  4QDC A;  1BCC E;  1EZV E;  2FYN C;  2E4Q A;  4QDD A;  1O7G A;  4AAY B;  3CX5 E;  2NUM A;  2JO6 A;  2DE7 D;  4NBG D;  2XSH A;  2NWF A;  1UUW A;  3BCC E;  2HMJ A;  3GTE A;  1VCK A;  3GZY A;  3EN1 A;  1L0L E;  2E74 D;  2YFI A;  4HM8 A;  4NBH D;  1O7H A;  1O7M A;  4H13 D;  2YIU C;  2BMQ A;  2YVJ B;  4QDF B;  3CXH E;  4HM5 A;  4H44 D;  4NBE D;  2E76 D;  1NTZ E;  2D2C D;  1VF5 D;  3H1K E;  1G8J B;  2B24 A;  4P1B H;  3VCP A;  4U3F E;  1FQT A;  2DE5 D;  1PP9 E;  3L74 E;  4NBD D;  2QJK C;  3GKE A;  1EG9 A;  2HMN A;  1ULJ A;  2HML A;  3H1L E;  2NVG A;  4QCK A;  3L72 E;  2NVF A;  4P1C H;  2NVE A;  3GB4 A;  5AEU A;  3EQQ A;  3L70 E;  3L73 E;  4QUP A;  4HM2 A;  3H1H E;  2DE6 D;  1G8K B;  1KB9 E;  5HL4 A;  4D6T E;  1UUV A;  2XRX A;  4QDF A;  4QUQ A;  5AEW A;  1NYK A;  1Q90 C;  4HM0 A;  4OGQ D;  4AIV A;  1KYO E;  2HMM A;  4HKV A;  2IBZ E;  4HM4 A;  1BE3 E;  2E75 D;  2QPZ A;  2QJY C;  1O7W A;  3GOB A;  2ZT9 D;  1SQV E;  2BMR A;  2XR8 A;  1P84 E;  2QJP C;  4HM3 A;  3L75 E;  3CWB E;  1NDO A;  5KKZ C;  4NB9 D;  2HMO A;  2BCC E;  3GTS A;  4HJL A;  4H0L D;  2NUK A;  3H1I E;  1NTM E;  1BGY E;  2GBW A;  3TGU E;  1JM1 A;  4PD4 E;  1SQP E;  2XSO A;  4PV1 D;  3VMG D;  2YFJ A;  3GCE A;  1L0N E;  1ZRT E;  3C0D A;  5BOK A;  3N0Q A;  5KLI C;  5KLV E;  3VMI D;  1WQL A;  4NBC D;  5CXM A;  4NBB D;  1PPJ E;  1O7P A;  2I7F A;  3VCA A;  4EMJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...