1SQPE

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 38
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqpE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqpE02
3L75E 3L72E 4H44D 4H0LD 4QDCA 5AEUA 1BGYE 2B1XA 3GZYA 4NB9D 1RIEA 2A06E 3GTEA 3CXHE 1G8KB 2BMRA 2NUMA 5CXMA 2E75D 1UUWA 3VMID 4HKVA 1VF5D 4NBBD 1PP9E 1O7MA 2I7FA 2NVFA 4D6TE 4PD4E 1VCKA 1SQQE 4NBFD 3VMGD 1L0LE 3GZXA 2HMKA 2E76D 4HM5A 4NBED 1JM1A 1WQLA 1P84E 1RFSA 3TGUE 4U3FE 3D89A 1SJGA 1BE3E 4AAYB 4NBAD 4HM4A 2B24A 3GCEA 3EN1A 1NTME 2YVJB 4H13D 1SQXE 5KLVE 3L74E 4QDFA 4P1BH 2YFJA 3BCCE 2QPZA 5AEWA 3DQYA 4HM0A 1KYOE 1O7HA 3H1LE 3GTSA 3CWBE 2HMLA 4QDDA 2GBXA 2QJPC 1L0NE 1Q90C 2BMQA 4HJLA 3GOBA 1SQVE 4QCKA 1NYKA 3H1JE 2DE5D 4AIVA 2CKFA 1FQTA 4NBGD 2E74D 3GL0A 3VCPA 2E4PA 2XSHA 3L73E 3GKEA 2QJYC 1ZRTE 1PPJE 1ULIA 5BOKA 1NDOA 5KLIC 1BCCE 2GBWA 2BCCE 4QURA 1ULJA 2HMMA 1G8JB 3GL2A 4NB8D 4HM6A 1O7WA 4HM1A 4HM7A 2E4QA 2QJKC 1KB9E 4NBDD 3EQQA 2FYNC 2NUKA 4PV1D 3C0DA 4HM2A 2NWFA 3VCAA 4OGQD 2XSOA 1EG9A 2Q3WA 2ZYLA 4QDFB 3GB4A 4QUPA 4HM3A 1UUVA 1O7NA 1SQBE 2YIUC 3FOUA 2XRXA 2XR8A 2HMJA 2JZAA 4NBCD 2NVGA 3AZCA 1EZVE 5HL4A 2YFLA 4P1CH 1NTKE 2ZT9D 1VM9A 4HM8A 1NTZE 3N0QA 2DE7D 2HMOA 3H1IE 3H1HE 2NVEA 4EMJB 2HMNA 1SQPE 1NU1E 2BMOA 3CX5E 2FYUE 2JO6A 2IBZE 4NBHD 5KKZC 3H1KE 1O7PA 3VMHD 2DE6D 3L70E 4QUQA 3L71E 1O7GA 2D2CD 2YFIA
chains in the Genus database with same CATH superfamily
2SPZA 3H32B 1L4AD 2P2UA 2OYHB 3CCSP 4PD4H 3TYYA 1MFZA 1GK6A 4R4MA 2YIUB 1DH3A 1VF5D 3B5ND 3LIEA 4PD4E 1L0LE 1SJGA 3NTNA 2WSFJ 1A02J 5CJ4A 3CCJP 1L0NJ 3O6QA 2QJPC 5KKZB 2H89C 1NH4A 4L73A 4UB8H 4GODA 1Q7YQ 4AIVA 1WRGA 3Q5SA 4UB8E 1J1DB 2ZT9C 1JCDA 3SWYA 2RN0A 1JB0J 4HM6A 1HJBA 3IR9A 1JY3O 3HD7A 2YMYA 1L0LK 3FX0A 1GW4A 4BWNA 1L0LG 2AXTH 3TGUD 1SFCB 2KK7A 3L70G 4H0LC 4H44C 1DD3A 2JWDA 2AXTE 3PJSK 2IYOA 3RGUA 1X79B 1HF9A 1JY3P 1CZQA 1OW8A 2BASA 3H1JD 2IFMA 3N4XA 5KJ7A 4DZOA 4RO0A 4Y99C 2QJKB 5GTHH 1NTZD 3L72E 1HWTC 1S9KD 3CC4P 5GTHE 4BRYA 2Q6QA 2KSEA 4D6TE 3QWOC 1EXJA 1RE3C 4EI2A 5KLVJ 4ZKPA 1U57A 2YVJB 3DQYA 2C0WA 1JUNA 3H1LE 4QDDA 2OQQA 2BMQA 2FFDB 1PFIA 3VOPA 1FQTA 2GUVA 3V2PA 1AA0A 3I5CA 1SQXD 1ULIA 1IJDB 1YIJP 3USSA 3FWNA 1XTGB 4PV1D 1T3UA 2KXPB 3C8VA 4HJGH 3AE1C 2O01N 1KQGB 4OWFA 5CHXA 2E75C 1NTKE 3H1HJ 1FZAA 3AE3C 2IPPA 3TSIA 1NU1J 1Y9BA 2KUBA 1U7JA 2J59M 3PH0A 1RY3A 4AQRD 4HH2A 2Y0DA 2Q7CA 1MUUA 1L4AA 5AW4B 2NUMA 1QGKB 4H44B 4H0LB 1SQQJ 2WSCJ 3VMGD 3H1KJ 2E76D 3M9HA 1EZVD 3D89A 3E1IA 1LWUC 4AAYB 1NTKK 2R3CA 4OH8B 3CCVP 3P7KA 2IZ1A 3L74E 1RE3A 3G6EP 3L37A 1AQ5A 4Y99B 5AVTB 1T8ZA 3L36A 2ZXXA 2W8ZA 3OA7A 1MKMA 1JY3N 1ZRTE 1S5LH 1JM0A 2WITA 5KLIC 2I1KA 5KTBA 3I55P 2OTKE 3MTUE 3EQQA 1NOHA 2NUKA 2KIKA 2QJYB 3V2QA 3W68A 5CMZA 1FZBA 1KILD 3N7NA 1Q90D 2D2CC 3AE5C 1RE4A 2PGDA 1VL2A 1Y47A 1URQD 3L74G 5AVRB 3WMM0 1SQPE 1N7SC 1SQBK 3M0AA 2KYVA 2VRSA 5AW2B 1QVFO 1HBWA 3EWKA 2M0BA 3PHLA 2KS1A 2V7QJ 3GZYA 1RIEA 4O9BA 5CCGC 1HJ0A 3R2PA 3G71P 2ITAA 4JF7A 5AVQB 1L0LJ 3GZXA 2I8DA 4HM5A 1JTHA 3L70J 2E75B 3L75D 1BE3E 4HM4A 1LWUA 2QPZA 1K73Q 1SQPK 1IK9A 2E5TA 3CC2P 2YMKA 4ZKUA 1VQ5P 1KORA 1SQPG 1QVGO 2H43A 2NRGA 3LIDA 2XSHA 2IBZI 2ZYAA 4EYYQ 1CW5A 2YO3A 2KI7B 3FGAD 4KHXA 5L8RJ 4QURA 2A06D 4N78E 2KB7P 3TF5A 3B4SA 4RKUJ 2NWFA 4W80A 1HUCA 2O1JA 2YO2A 1LWUB 1ZLLA 3GF7A 3PTZA 4N3YB 5K5GB 2FYNB 2NVGA 3R4YA 4IL6X 4JYCA 3AE7C 2Q9IA 3F89A 2JDIH 1YQ3C 1K04A 1KMIZ 2K1AA 3HD7D 1YJWP 1AJYA 2OYHC 4TLFA 3E7KA 3TNUA 3H1ID 2WPVB 1NTMG 4NB9D 3OW2O 5APVA 1OW7A 5CXMA 1RHZB 1RH5B 2P1JA 2K9YA 3P8MC 1PP9E 3A7OA 3KYQA 4EIJA 2WSEJ 3TGUE 1JEKA 2WSSH 2QA4P 1N7SB 3AEGC 3CWBE 2GBXA 2QM7A 1ZMEC 2CPSA 1SQVE 4QCKA 1NYKA 3H1JE 3AEDC 2QIWA 1PV3A 3L71D 1JCCA 1PPJE 1IC2A 4KJMA 4DT0A 2E5YA 1L0ND 1SFCC 1OVRA 2FXPA 3KXDA 1YJNP 5BVZA 2KLUA 1PP9G 2JP3A 1R5LA 2Z4EA 3VMYA 3V2NA 1KILA 1YJ9P 3H6PA 3TGUG 4Z1MH 2LXBA 5AW9B 2JZAA 1OMIA 1YTZI 1KB9D 2ZT9D 3CWBG 3T97A 3BRVB 1SQVK 5CCHC 1ZN5A 5CJ0A 1LP1A 3C9IA 1SQVG 1RF0C 2YNYA 1PGPA 1FZCC 1IO4A 1PIXA 1PPJG 2OYHA 3G4SP 4H44D 4H0LD 1BGYE 2PAJA 2M3BA 2KP8A 4XFJA 4TT3H 2AEFA 3M0DC 3T97B 1OXZA 3M06A 1AV1A 3L73G 2FFDC 1LTAC 1WT6A 4U3FE 2W90A 1IFDA 3L74J 1K9MQ 4I2LC 2XNDH 1BDCA 1USEA 2YKOA 3GOBA 3QH9A 3G9RA 1LNQA 3CD6P 3BATA 3MP7B 5APSA 2GA1A 3IF4A 5KLVD 1EDJA 1DX7A 1BCCE 4GT1A 1G8JB 1BGYG 4NPEA 4LLHA 1GD2E 3MHVA 3KQGA 3HE4A 1SFCA 2YKPA 3M9QA 4QUPA 4HM3A 1YYCA 2B89A 3IN6A 4U3FG 2FBWC 1GK4A 5APXA 3M91A 3AZCA 1EZVE 3WU2H 5DJTB 3RK3C 2B87B 3F5HA 3A2AA 1SQPJ 1BSHA 5TISH 3WU2E 3BVHA 1NKNA 3JCUH 2A45H 2IX7C 5TISE 3HE4B 1G1IA 1RF0A 3CL3D 3JCUE 1BCCG 3H1HD 2XKMA 5AEUA 1J2JB 2AEMA 4RESB 3AE9C 1NU1D 1YITP 3CX5D 4L75A 4LC1A 4DJGA 2E75D 2K37A 1R5SA 3SFDC 1FJPA 1VCKA 2LKMA 2KSJA 2Q1KA 2K88A 1QLED 1OZHA 3NMDA 4HB1A 1EZVG 2FFDA 2KLVA 3MGNA 3GTSA 1FZCB 2O1KA 2P7JA 2R32A 2WPSA 1M56D 1SQQD 3NXSA 3H1KD 1AVOA 2BEZF 3U1CA 2ZFCA 2KZJA 3GW6A 1UIXA 2QJYC 4OGQB 3V4QA 2A45G 2W6JH 1H0TA 1NTMJ 2HMMA 2KOGA 4MN4C 1M90Q 4NB8D 1EZVI 4HM7A 1JY2N 4OVNF 3Q5RA 2Q3WA 4QMAA 3HUSC 2BCCJ 4IL6H 1S2EA 3L72G 5HL4A 2A45I 4YXDC 1YI2P 2NPSB 2HG5D 4IL6E 1H0TB 2QE7H 1LTJC 3FXEA 1SP4A 3P8CE 4D6TG 2O01J 2WZ7A 4WVZA 3GHGC 2D2CD 2YFIA 1CI6B 2QG4A 1EDIA 4PJ0H 2R5DA 2A06E 3H1LG 1NGMB 2HFED 1BDDA 3AE8C 5APTA 1PP9J 3B71A 2B88A 3D6YA 4WWIA 2OTLP 3SSUA 1N7SD 3JSVC 3TGUJ 1M1JC 2ZVOB 3RK3B 3AEEC 1FBMA 1FDIA 2E74B 1VQ9P 3CWBJ 3BCCE 1OVUA 1SQVJ 4PD4D 1FOSE 1L0LD 2FYUD 5APQA 2ZVNB 3HE5B 5CCGD 1FC2C 3L70D 4IFMA 4ASWA 2H7HA 1LT9C 2J5UA 2KZIA 3CXHD 1NTKG 1O7WA 1AFOA 1GU5A 2FYNC 1IZNB 2Q3EA 2V4HA 1P84D 1S3JA 1G1JA 1LTTC 2J58A 3L73J 1SQBE 1QL1A 2OGUA 5EFWB 2XU6A 1MZ9A 3BCCG 1PL5A 2NVEA 1S5LE 4EOTA 3OAKA 2JO6A 2IBZE 1O7PA 3L71E 1VF5B 3B5NB 3RL0C 1KD1Q 3RBXA 3GHGA 1AVYA 1BGYJ 3CC7P 3FXDA 2QVAA 2DW3A 1FS0E 1UUWA 3HUSB 5AW6B 1SQBG 1JM1A 4U3FJ 2R44A 3EN1A 1RQUA 4XA4A 2FYZA 4P1BH 2G8YA 1LTJB 4AUWA 3V5BA 4KT0J 3GHGB 1NO4A 2IBZG 3TDKA 3VCPA 2MJZA 1T2KC 3L71G 2BEQD 2N9BA 2YXQB 1BCCJ 3VTPC 5APWA 3GL2A 1LT9A 1FOSF 5E79H 3VCAA 4HM2A 1M1JB 2XSOA 2N1TB 5E79E 1O7NA 1N73B 2QSIA 4JPZB 4A7PA 2Q5UA 5APYA 1YBKA 1M8OB 3V4WA 1SFCD 1UIIA 3GG2A 3CLQA 1LT9B 1GL2C 2P10A 4L76A 5AVUB 4H13C 1USDA 1BE3G 1IFJA 5AW0B 3AEAC 2R5BA 1OFCX 1ZV8A 2GM4A 3VMXA 5CCHD 1SVFA 1VPCA 1FZEA 2HMKA 3CMEP 2OYIC 1N7SA 1QX8A 1PGJA 4GDOA 4NBED 3CCLP 2Z5HA 2JWAA 1A02F 1W2BO 3L72J 2B24A 4ASVA 5AEWA 1QEXA 1VQLP 1Y8AA 2K9JB 2Y0EA 1FU1A 1KFMA 4GKGA 3RL0B 4D6TJ 1N7LA 1LTIC 5CCGA 3L35A 3GKEA 5KLVK 2LR2A 3S4RA 3CX5H 3KHUA 4UB6H 3H1LJ 1N8RQ 3II6A 1PGOA 2PP6A 1E79H 1ZRTD 2Y9YA 2E43A 4WBAA 3VMZA 1GZLA 1VQOP 2WT7B 3C1LA 2HMJA 4NBCD 4HM8A 1NTZE 2WSCH 3OJAB 4L74A 5BU8B 3SFEC 3BASA 1S9KE 2R3SA 1OIPA 4EDFA 2H8PD 4AYCA 2HYNA 3H1KE 1GL2A 3D71A 4K35A 2E76B 3ITKA 4NPDA 1NTKJ 1NU1K 3MZWB 1SQPD 2POHA 3GTEA 2OYOA 3PP5A 3RK3D 3VMID 4HKVA 4NBBD 1IFMA 3H1JG 1SS1A 2AEJA 4DCKA 3ABVC 3L4FA 2AXCA 1WQLA 1NTZK 1SQXE 3BCCJ 4IFFA 1NTZG 1GL2B 4YTPC 4OGQC 5AVSB 4H13B 3K5BA 4YPCA 3CX5I 1FAVA 1X8YA 2W83C 2WMMA 5APUA 1KFNA 2E4PA 1NDOA 2GBWA 1YQ4C 3IAOA 1K8AQ 3LW5H 5KJ7C 2OYIB 2WPQA 3HRNA 3VYIA 3D70A 1SQBJ 2NPSC 1DD4A 1ZOYC 1KZUB 2B87A 1SQXK 1NTMD 2L5GB 2JKVA 3WUVA 1KC8Q 2O3JA 1SQXG 1KYOD 2YFLA 4P1CH 1EC5A 2HMOA 1R8EA 1EQ7A 1MV8A 2FKWB 2M5AB 5AW8B 3CCUP 1LT1A 2C0XA 2FYUE 4N6JA 4XE5B 3L71J 2DE6D 5KAIH 3L70E 3NFQA 2BCCD 3MIWA 1O7GA 2RMZA 3EFFK 3CXHH 4WY4C 1N2DC 4QDCA 1LGHB 5KAIE 1FE6A 2OARA 4JYBA 2RKLA 3CXHE 4K3AA 1KN7A 2ZYGA 2E74C 1P84H 2QRXA 2ZAEB 5CCHA 2I1JA 3AE4C 1P84E 1ZXGA 1M1KQ 1FZCA 4NBAD 4R4LA 2IZ0A 3CI9A 3M9BA 2YFJA 1O7HA 1PP9D 4Y28J 3CCQP 2FYUK 4HJLA 2DE5D 2FYUG 2P67A 3O6QB 3AEFC 1KILE 4U7JA 1JMMA 1IFNA 1BE3J 3M0DA 5BOKA 3RK2C 2W27A 1TU3F 3CWBD 2N1TD 1SQVD 1X0TA 1Q82Q 1DIPA 1U7MA 3A5TA 1ZW0A 1PPJD 1JOCA 4PD4I 1UUVA 3HD7B 2HPCA 5B66H 3FOUA 3HTKA 1L4AC 2NPSA 1OX3A 1Q81Q 1HVVA 5H2FH 5B66E 1VM9A 1VF5C 3B5NC 3O8ZA 3VP8A 2WSEH 3CXHI 5H2FE 1W2EA 2K3RA 1QL2A 3L73D 1M7LA 1CI6A 1NWQA 5AW3B 1OWAA 3V6IA 1FZGA 2XZRA 4W7ZA 2OTJP 4HKZH 5GTIH 2IFNA 3KPEA 1MFTA 1P84I 3L75E 2P58A 2JR8A 2CPBA 2ZXEB 2HPCB 1NYHA 4WY4A 3HTKB 5GTIE 1KTMA 2E42A 4I7ZB 3VP9A 1H8AA 3Q1MA 1ZR2A 2NVFA 3U1AA 1BGYD 4BRYB 3B8EB 1GMJA 1J1EC 2ZJSE 3HE5A 2W6AA 3PLNA 3RL0D 1NJIQ 3VN0A 1RE4C 4PJ0E 4WY4B 1S4XA 1PGQA 4HYTB 5CBOA 4U3FD 1IK7A 3GL0A 2QJPB 2WVRA 3L75G 2N1TC 3CPWO 1M57D 2E4QA 1N73C 1NVOA 1T3JA 1OW6A 3EQ2A 3H1JJ 3S1KA 2ZT9B 1LTBC 2ZYLA 3MD0A 1H89A 3KZIH 1E5WA 1BCCD 2XR8A 4M3LA 3KZIE 1PZQA 1T2KD 1NTZJ 3UIAA 4B86A 5DJUB 4DOJA 1KQLA 2A06G 3H1IE 1FDMA 4EMJB 5AVYB 3SWKA 2FY8A 3BRTB 3B5NA 1VQPP 4C7RA 2Y0CA 1S72P 3RK2B 3VMHD 2WPRA 2ZYDA 4QUQA 4W7YA 1RQVA 1RF1C 1VQNP 2M3EA 3HUSA 2B1XA 4GOEA 1AQTA 1L4AB 3VMAA 5B5EH 4CPGA 1O7MA 2N9YB 4NBFD 2XDJA 1D7MA 5AVVB 2WSFH 1GL2D 1LTJA 2WWWA 5B5EE 1VQ8P 3TK1A 1FZFA 4C46A 4RJTA 1VQKP 1SQXJ 3GCEA 2LXCB 3FWLA 2UWJE 4H13D 4PV1C 4QDFA 3E1RA 3H1IG 1L0NE 1GW3A 2C9NY 4GIFA 1G2CA 3AE2C 2HR3A 3L72D 1KB9H 1N86A 3KDPB 1JMBA 1M1JA 1DEEG 2N1TA 3PRJA 1KB9E 3U59A 1XTCC 3LW5J 4D6TD 1N73A 1EG9A 3RL0g 4QDFB 3RK3E 1KQSO 1NAFA 3GB4A 1J1EB 3MUDC 1YHQP 5CBNA 1G2CB 3GMAA 5AW7B 3H1LD 1OVVA 2MKVA 1L0NK 2DE7D 1VQ7P 2HLOA 1VDFA 2M8RA 1L0NG 2E76C 1VQ4P 2FYUJ 1LTGC 5C39A 2JO1A 3ZDMA 2QEXP 1LTSC 5AVXB 3H25A 1EDLA 1K05A 3EFGA 1RF1A 1Q2NA 2B9BA 2YKQA 3P8CD 3CMAP 4I1LA 1S1CX 2KS1B 1BSNA 1X22A 1HTLC 2FXOA 5M1BA 2Q3IA 2JEEA 1KYOH 1NTKD 2K9JA 3I56P 1NTME 1JTHB 5KLVE 1EXIA 5AW1B 3Q3DA 4HM0A 1KYOE 2IDBA 3JC22 1KILC 1Q90C 1Q86Q 4ZNCA 1KB9I 3D6ZA 1RF1B 2H88C 3V2RA 1T6AA 2IYPA 2JJLA 1NAYA 4GOFA 4LGDE 1URQC 3WUUA 1X9VA 3BCCD 2BCCE 2G3AA 5KAFH 2FXMA 4IFDK 4HM1A 1SLQA 2O01H 5KAFE 4ZMDA 3C0DA 1CSBA 4OGQD 2WT7A 5KLIB 1GU4A 3P32A 2HODA 2KNCA 4PV1B 2YIUC 1NKZB 3A3YB 3S9OA 1NTMK 2XRXA 1JO5A 3MUDA 3L74D 2L91A 4C7NA 5KLVG 1WMKA 3N0QA 5BU5A 3SWFA 4I6MC 3H1HE 3A0HH 2D2CB 1KQFB 1W5CE 2HMNA 1NU1E 2BMOA 3CX5E 1SQBD 1IFPA 3A0HE 4IOIH 4UB6E 5KJ7D 5KKZC 1FJKA 1LJ2A 1EDKA 3Q5PA 3AECC 2NPSD 3L75J 1KV4A 2BCCG 1HH0A 3WUTA 1J1DC 2HODB 2KNCB 1ZP0C 3AEBC 4NPFX 2WTYA 3A0BH 3TNUB 1G8KB 2BMRA 1YTZT 1KYOI 3Q2YA 1VQ6P 2IBZD 1GTWA 4C7NB 1HGZA 1FDOA 2I7FA 1SQQE 3A0BE 4JBZA 2Z5IA 3IFMA 4JQ0D 1RFSA 4WB4A 2XNXA 2XV5A 1DEBA 4WY4D 3H1HG 2HMLA 3RBZA 2PRRA 2W6BA 2WQYC 1NU1G 5AW5B 2CKFA 1JY2O 2C9LY 4NBGD 2E74D 3L73E 1IFIA 3GLMA 1S5LX 1ZR4A 4YXWH 3CCEP 2OYIA 3CCRP 5TJHA 1ULJA 2GUSA 1URQA 3HD7C 2QJKC 4NBDD 1HGVA 1SQQK 2Y9ZA 2CK3H 1NHLA 5AVWB 1JY2P 1SQQG 3H32A 2QM8A 3H1KG 1BE3D 2NZ2A 2PFXA 3W67A 2RH0A 1KILB 3GF3A 3CCMP 2M5AA 3G3ZA 3H1IJ 3RK2D 1L2PA 5AVZB 1Z56A 1URQB 2YXRB 1VQMP 4NBHD 4I7ZC 1JNMA 1LP1B 3AE6C 1H88A 2V7QH 1GDTA 4BXLA 4N78D
chains in the Genus database with same CATH topology
3L75E 3L72E 4H44D 4H0LD 4QDCA 5AEUA 1BGYE 2B1XA 3GZYA 4NB9D 1RIEA 2A06E 3GTEA 3CXHE 1G8KB 2BMRA 2NUMA 5CXMA 2E75D 1UUWA 3VMID 4HKVA 1VF5D 4NBBD 1PP9E 1O7MA 2I7FA 2NVFA 4D6TE 4PD4E 1VCKA 1SQQE 4NBFD 3VMGD 1L0LE 3GZXA 2HMKA 2E76D 4HM5A 4NBED 1JM1A 1WQLA 1P84E 1RFSA 3TGUE 4U3FE 3D89A 1SJGA 1BE3E 4AAYB 4NBAD 4HM4A 2B24A 3GCEA 3EN1A 1NTME 2YVJB 4H13D 1SQXE 5KLVE 3L74E 4QDFA 4P1BH 2YFJA 3BCCE 2QPZA 5AEWA 3DQYA 4HM0A 1KYOE 1O7HA 3H1LE 3GTSA 3CWBE 2HMLA 4QDDA 2GBXA 2QJPC 1L0NE 1Q90C 2BMQA 4HJLA 3GOBA 1SQVE 4QCKA 1NYKA 3H1JE 2DE5D 4AIVA 2CKFA 1FQTA 4NBGD 2E74D 3GL0A 3VCPA 2E4PA 2XSHA 3L73E 3GKEA 2QJYC 1ZRTE 1PPJE 1ULIA 5BOKA 1NDOA 5KLIC 1BCCE 2GBWA 2BCCE 4QURA 1ULJA 2HMMA 1G8JB 3GL2A 4NB8D 4HM6A 1O7WA 4HM1A 4HM7A 2E4QA 2QJKC 1KB9E 4NBDD 3EQQA 2FYNC 2NUKA 4PV1D 3C0DA 4HM2A 2NWFA 3VCAA 4OGQD 2XSOA 1EG9A 2Q3WA 2ZYLA 4QDFB 3GB4A 4QUPA 4HM3A 1UUVA 1O7NA 1SQBE 2YIUC 3FOUA 2XRXA 2XR8A 2HMJA 2JZAA 4NBCD 2NVGA 3AZCA 1EZVE 5HL4A 2YFLA 4P1CH 1NTKE 2ZT9D 1VM9A 4HM8A 1NTZE 3N0QA 2DE7D 2HMOA 3H1IE 3H1HE 2NVEA 4EMJB 2HMNA 1SQPE 1NU1E 2BMOA 3CX5E 2FYUE 2JO6A 2IBZE 4NBHD 5KKZC 3H1KE 1O7PA 3VMHD 2DE6D 3L70E 4QUQA 3L71E 1O7GA 2D2CD 2YFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 E;  3L72 E;  4H44 D;  4H0L D;  4QDC A;  5AEU A;  1BGY E;  2B1X A;  3GZY A;  4NB9 D;  1RIE A;  2A06 E;  3GTE A;  3CXH E;  1G8K B;  2BMR A;  2NUM A;  5CXM A;  2E75 D;  1UUW A;  3VMI D;  4HKV A;  1VF5 D;  4NBB D;  1PP9 E;  1O7M A;  2I7F A;  2NVF A;  4D6T E;  4PD4 E;  1VCK A;  1SQQ E;  4NBF D;  3VMG D;  1L0L E;  3GZX A;  2HMK A;  2E76 D;  4HM5 A;  4NBE D;  1JM1 A;  1WQL A;  1P84 E;  1RFS A;  3TGU E;  4U3F E;  3D89 A;  1SJG A;  1BE3 E;  4AAY B;  4NBA D;  4HM4 A;  2B24 A;  3GCE A;  3EN1 A;  1NTM E;  2YVJ B;  4H13 D;  1SQX E;  5KLV E;  3L74 E;  4QDF A;  4P1B H;  2YFJ A;  3BCC E;  2QPZ A;  5AEW A;  3DQY A;  4HM0 A;  1KYO E;  1O7H A;  3H1L E;  3GTS A;  3CWB E;  2HML A;  4QDD A;  2GBX A;  2QJP C;  1L0N E;  1Q90 C;  2BMQ A;  4HJL A;  3GOB A;  1SQV E;  4QCK A;  1NYK A;  3H1J E;  2DE5 D;  4AIV A;  2CKF A;  1FQT A;  4NBG D;  2E74 D;  3GL0 A;  3VCP A;  2E4P A;  2XSH A;  3L73 E;  3GKE A;  2QJY C;  1ZRT E;  1PPJ E;  1ULI A;  5BOK A;  1NDO A;  5KLI C;  1BCC E;  2GBW A;  2BCC E;  4QUR A;  1ULJ A;  2HMM A;  1G8J B;  3GL2 A;  4NB8 D;  4HM6 A;  1O7W A;  4HM1 A;  4HM7 A;  2E4Q A;  2QJK C;  1KB9 E;  4NBD D;  3EQQ A;  2FYN C;  2NUK A;  4PV1 D;  3C0D A;  4HM2 A;  2NWF A;  3VCA A;  4OGQ D;  2XSO A;  1EG9 A;  2Q3W A;  2ZYL A;  4QDF B;  3GB4 A;  4QUP A;  4HM3 A;  1UUV A;  1O7N A;  1SQB E;  2YIU C;  3FOU A;  2XRX A;  2XR8 A;  2HMJ A;  2JZA A;  4NBC D;  2NVG A;  3AZC A;  1EZV E;  5HL4 A;  2YFL A;  4P1C H;  1NTK E;  2ZT9 D;  1VM9 A;  4HM8 A;  1NTZ E;  3N0Q A;  2DE7 D;  2HMO A;  3H1I E;  3H1H E;  2NVE A;  4EMJ B;  2HMN A;  1SQP E;  1NU1 E;  2BMO A;  3CX5 E;  2FYU E;  2JO6 A;  2IBZ E;  4NBH D;  5KKZ C;  3H1K E;  1O7P A;  3VMH D;  2DE6 D;  3L70 E;  4QUQ A;  3L71 E;  1O7G A;  2D2C D;  2YFI A; 
#chains in the Genus database with same CATH topology
 2SPZ A;  3H32 B;  1L4A D;  2P2U A;  2OYH B;  3CCS P;  4PD4 H;  3TYY A;  1MFZ A;  1GK6 A;  4R4M A;  2YIU B;  1DH3 A;  1VF5 D;  3B5N D;  3LIE A;  4PD4 E;  1L0L E;  1SJG A;  3NTN A;  2WSF J;  1A02 J;  5CJ4 A;  3CCJ P;  1L0N J;  3O6Q A;  2QJP C;  5KKZ B;  2H89 C;  1NH4 A;  4L73 A;  4UB8 H;  4GOD A;  1Q7Y Q;  4AIV A;  1WRG A;  3Q5S A;  4UB8 E;  1J1D B;  2ZT9 C;  1JCD A;  3SWY A;  2RN0 A;  1JB0 J;  4HM6 A;  1HJB A;  3IR9 A;  1JY3 O;  3HD7 A;  2YMY A;  1L0L K;  3FX0 A;  1GW4 A;  4BWN A;  1L0L G;  2AXT H;  3TGU D;  1SFC B;  2KK7 A;  3L70 G;  4H0L C;  4H44 C;  1DD3 A;  2JWD A;  2AXT E;  3PJS K;  2IYO A;  3RGU A;  1X79 B;  1HF9 A;  1JY3 P;  1CZQ A;  1OW8 A;  2BAS A;  3H1J D;  2IFM A;  3N4X A;  5KJ7 A;  4DZO A;  4RO0 A;  4Y99 C;  2QJK B;  5GTH H;  1NTZ D;  3L72 E;  1HWT C;  1S9K D;  3CC4 P;  5GTH E;  4BRY A;  2Q6Q A;  2KSE A;  4D6T E;  3QWO C;  1EXJ A;  1RE3 C;  4EI2 A;  5KLV J;  4ZKP A;  1U57 A;  2YVJ B;  3DQY A;  2C0W A;  1JUN A;  3H1L E;  4QDD A;  2OQQ A;  2BMQ A;  2FFD B;  1PFI A;  3VOP A;  1FQT A;  2GUV A;  3V2P A;  1AA0 A;  3I5C A;  1SQX D;  1ULI A;  1IJD B;  1YIJ P;  3USS A;  3FWN A;  1XTG B;  4PV1 D;  1T3U A;  2KXP B;  3C8V A;  4HJG H;  3AE1 C;  2O01 N;  1KQG B;  4OWF A;  5CHX A;  2E75 C;  1NTK E;  3H1H J;  1FZA A;  3AE3 C;  2IPP A;  3TSI A;  1NU1 J;  1Y9B A;  2KUB A;  1U7J A;  2J59 M;  3PH0 A;  1RY3 A;  4AQR D;  4HH2 A;  2Y0D A;  2Q7C A;  1MUU A;  1L4A A;  5AW4 B;  2NUM A;  1QGK B;  4H44 B;  4H0L B;  1SQQ J;  2WSC J;  3VMG D;  3H1K J;  2E76 D;  3M9H A;  1EZV D;  3D89 A;  3E1I A;  1LWU C;  4AAY B;  1NTK K;  2R3C A;  4OH8 B;  3CCV P;  3P7K A;  2IZ1 A;  3L74 E;  1RE3 A;  3G6E P;  3L37 A;  1AQ5 A;  4Y99 B;  5AVT B;  1T8Z A;  3L36 A;  2ZXX A;  2W8Z A;  3OA7 A;  1MKM A;  1JY3 N;  1ZRT E;  1S5L H;  1JM0 A;  2WIT A;  5KLI C;  2I1K A;  5KTB A;  3I55 P;  2OTK E;  3MTU E;  3EQQ A;  1NOH A;  2NUK A;  2KIK A;  2QJY B;  3V2Q A;  3W68 A;  5CMZ A;  1FZB A;  1KIL D;  3N7N A;  1Q90 D;  2D2C C;  3AE5 C;  1RE4 A;  2PGD A;  1VL2 A;  1Y47 A;  1URQ D;  3L74 G;  5AVR B;  3WMM 0;  1SQP E;  1N7S C;  1SQB K;  3M0A A;  2KYV A;  2VRS A;  5AW2 B;  1QVF O;  1HBW A;  3EWK A;  2M0B A;  3PHL A;  2KS1 A;  2V7Q J;  3GZY A;  1RIE A;  4O9B A;  5CCG C;  1HJ0 A;  3R2P A;  3G71 P;  2ITA A;  4JF7 A;  5AVQ B;  1L0L J;  3GZX A;  2I8D A;  4HM5 A;  1JTH A;  3L70 J;  2E75 B;  3L75 D;  1BE3 E;  4HM4 A;  1LWU A;  2QPZ A;  1K73 Q;  1SQP K;  1IK9 A;  2E5T A;  3CC2 P;  2YMK A;  4ZKU A;  1VQ5 P;  1KOR A;  1SQP G;  1QVG O;  2H43 A;  2NRG A;  3LID A;  2XSH A;  2IBZ I;  2ZYA A;  4EYY Q;  1CW5 A;  2YO3 A;  2KI7 B;  3FGA D;  4KHX A;  5L8R J;  4QUR A;  2A06 D;  4N78 E;  2KB7 P;  3TF5 A;  3B4S A;  4RKU J;  2NWF A;  4W80 A;  1HUC A;  2O1J A;  2YO2 A;  1LWU B;  1ZLL A;  3GF7 A;  3PTZ A;  4N3Y B;  5K5G B;  2FYN B;  2NVG A;  3R4Y A;  4IL6 X;  4JYC A;  3AE7 C;  2Q9I A;  3F89 A;  2JDI H;  1YQ3 C;  1K04 A;  1KMI Z;  2K1A A;  3HD7 D;  1YJW P;  1AJY A;  2OYH C;  4TLF A;  3E7K A;  3TNU A;  3H1I D;  2WPV B;  1NTM G;  4NB9 D;  3OW2 O;  5APV A;  1OW7 A;  5CXM A;  1RHZ B;  1RH5 B;  2P1J A;  2K9Y A;  3P8M C;  1PP9 E;  3A7O A;  3KYQ A;  4EIJ A;  2WSE J;  3TGU E;  1JEK A;  2WSS H;  2QA4 P;  1N7S B;  3AEG C;  3CWB E;  2GBX A;  2QM7 A;  1ZME C;  2CPS A;  1SQV E;  4QCK A;  1NYK A;  3H1J E;  3AED C;  2QIW A;  1PV3 A;  3L71 D;  1JCC A;  1PPJ E;  1IC2 A;  4KJM A;  4DT0 A;  2E5Y A;  1L0N D;  1SFC C;  1OVR A;  2FXP A;  3KXD A;  1YJN P;  5BVZ A;  2KLU A;  1PP9 G;  2JP3 A;  1R5L A;  2Z4E A;  3VMY A;  3V2N A;  1KIL A;  1YJ9 P;  3H6P A;  3TGU G;  4Z1M H;  2LXB A;  5AW9 B;  2JZA A;  1OMI A;  1YTZ I;  1KB9 D;  2ZT9 D;  3CWB G;  3T97 A;  3BRV B;  1SQV K;  5CCH C;  1ZN5 A;  5CJ0 A;  1LP1 A;  3C9I A;  1SQV G;  1RF0 C;  2YNY A;  1PGP A;  1FZC C;  1IO4 A;  1PIX A;  1PPJ G;  2OYH A;  3G4S P;  4H44 D;  4H0L D;  1BGY E;  2PAJ A;  2M3B A;  2KP8 A;  4XFJ A;  4TT3 H;  2AEF A;  3M0D C;  3T97 B;  1OXZ A;  3M06 A;  1AV1 A;  3L73 G;  2FFD C;  1LTA C;  1WT6 A;  4U3F E;  2W90 A;  1IFD A;  3L74 J;  1K9M Q;  4I2L C;  2XND H;  1BDC A;  1USE A;  2YKO A;  3GOB A;  3QH9 A;  3G9R A;  1LNQ A;  3CD6 P;  3BAT A;  3MP7 B;  5APS A;  2GA1 A;  3IF4 A;  5KLV D;  1EDJ A;  1DX7 A;  1BCC E;  4GT1 A;  1G8J B;  1BGY G;  4NPE A;  4LLH A;  1GD2 E;  3MHV A;  3KQG A;  3HE4 A;  1SFC A;  2YKP A;  3M9Q A;  4QUP A;  4HM3 A;  1YYC A;  2B89 A;  3IN6 A;  4U3F G;  2FBW C;  1GK4 A;  5APX A;  3M91 A;  3AZC A;  1EZV E;  3WU2 H;  5DJT B;  3RK3 C;  2B87 B;  3F5H A;  3A2A A;  1SQP J;  1BSH A;  5TIS H;  3WU2 E;  3BVH A;  1NKN A;  3JCU H;  2A45 H;  2IX7 C;  5TIS E;  3HE4 B;  1G1I A;  1RF0 A;  3CL3 D;  3JCU E;  1BCC G;  3H1H D;  2XKM A;  5AEU A;  1J2J B;  2AEM A;  4RES B;  3AE9 C;  1NU1 D;  1YIT P;  3CX5 D;  4L75 A;  4LC1 A;  4DJG A;  2E75 D;  2K37 A;  1R5S A;  3SFD C;  1FJP A;  1VCK A;  2LKM A;  2KSJ A;  2Q1K A;  2K88 A;  1QLE D;  1OZH A;  3NMD A;  4HB1 A;  1EZV G;  2FFD A;  2KLV A;  3MGN A;  3GTS A;  1FZC B;  2O1K A;  2P7J A;  2R32 A;  2WPS A;  1M56 D;  1SQQ D;  3NXS A;  3H1K D;  1AVO A;  2BEZ F;  3U1C A;  2ZFC A;  2KZJ A;  3GW6 A;  1UIX A;  2QJY C;  4OGQ B;  3V4Q A;  2A45 G;  2W6J H;  1H0T A;  1NTM J;  2HMM A;  2KOG A;  4MN4 C;  1M90 Q;  4NB8 D;  1EZV I;  4HM7 A;  1JY2 N;  4OVN F;  3Q5R A;  2Q3W A;  4QMA A;  3HUS C;  2BCC J;  4IL6 H;  1S2E A;  3L72 G;  5HL4 A;  2A45 I;  4YXD C;  1YI2 P;  2NPS B;  2HG5 D;  4IL6 E;  1H0T B;  2QE7 H;  1LTJ C;  3FXE A;  1SP4 A;  3P8C E;  4D6T G;  2O01 J;  2WZ7 A;  4WVZ A;  3GHG C;  2D2C D;  2YFI A;  1CI6 B;  2QG4 A;  1EDI A;  4PJ0 H;  2R5D A;  2A06 E;  3H1L G;  1NGM B;  2HFE D;  1BDD A;  3AE8 C;  5APT A;  1PP9 J;  3B71 A;  2B88 A;  3D6Y A;  4WWI A;  2OTL P;  3SSU A;  1N7S D;  3JSV C;  3TGU J;  1M1J C;  2ZVO B;  3RK3 B;  3AEE C;  1FBM A;  1FDI A;  2E74 B;  1VQ9 P;  3CWB J;  3BCC E;  1OVU A;  1SQV J;  4PD4 D;  1FOS E;  1L0L D;  2FYU D;  5APQ A;  2ZVN B;  3HE5 B;  5CCG D;  1FC2 C;  3L70 D;  4IFM A;  4ASW A;  2H7H A;  1LT9 C;  2J5U A;  2KZI A;  3CXH D;  1NTK G;  1O7W A;  1AFO A;  1GU5 A;  2FYN C;  1IZN B;  2Q3E A;  2V4H A;  1P84 D;  1S3J A;  1G1J A;  1LTT C;  2J58 A;  3L73 J;  1SQB E;  1QL1 A;  2OGU A;  5EFW B;  2XU6 A;  1MZ9 A;  3BCC G;  1PL5 A;  2NVE A;  1S5L E;  4EOT A;  3OAK A;  2JO6 A;  2IBZ E;  1O7P A;  3L71 E;  1VF5 B;  3B5N B;  3RL0 C;  1KD1 Q;  3RBX A;  3GHG A;  1AVY A;  1BGY J;  3CC7 P;  3FXD A;  2QVA A;  2DW3 A;  1FS0 E;  1UUW A;  3HUS B;  5AW6 B;  1SQB G;  1JM1 A;  4U3F J;  2R44 A;  3EN1 A;  1RQU A;  4XA4 A;  2FYZ A;  4P1B H;  2G8Y A;  1LTJ B;  4AUW A;  3V5B A;  4KT0 J;  3GHG B;  1NO4 A;  2IBZ G;  3TDK A;  3VCP A;  2MJZ A;  1T2K C;  3L71 G;  2BEQ D;  2N9B A;  2YXQ B;  1BCC J;  3VTP C;  5APW A;  3GL2 A;  1LT9 A;  1FOS F;  5E79 H;  3VCA A;  4HM2 A;  1M1J B;  2XSO A;  2N1T B;  5E79 E;  1O7N A;  1N73 B;  2QSI A;  4JPZ B;  4A7P A;  2Q5U A;  5APY A;  1YBK A;  1M8O B;  3V4W A;  1SFC D;  1UII A;  3GG2 A;  3CLQ A;  1LT9 B;  1GL2 C;  2P10 A;  4L76 A;  5AVU B;  4H13 C;  1USD A;  1BE3 G;  1IFJ A;  5AW0 B;  3AEA C;  2R5B A;  1OFC X;  1ZV8 A;  2GM4 A;  3VMX A;  5CCH D;  1SVF A;  1VPC A;  1FZE A;  2HMK A;  3CME P;  2OYI C;  1N7S A;  1QX8 A;  1PGJ A;  4GDO A;  4NBE D;  3CCL P;  2Z5H A;  2JWA A;  1A02 F;  1W2B O;  3L72 J;  2B24 A;  4ASV A;  5AEW A;  1QEX A;  1VQL P;  1Y8A A;  2K9J B;  2Y0E A;  1FU1 A;  1KFM A;  4GKG A;  3RL0 B;  4D6T J;  1N7L A;  1LTI C;  5CCG A;  3L35 A;  3GKE A;  5KLV K;  2LR2 A;  3S4R A;  3CX5 H;  3KHU A;  4UB6 H;  3H1L J;  1N8R Q;  3II6 A;  1PGO A;  2PP6 A;  1E79 H;  1ZRT D;  2Y9Y A;  2E43 A;  4WBA A;  3VMZ A;  1GZL A;  1VQO P;  2WT7 B;  3C1L A;  2HMJ A;  4NBC D;  4HM8 A;  1NTZ E;  2WSC H;  3OJA B;  4L74 A;  5BU8 B;  3SFE C;  3BAS A;  1S9K E;  2R3S A;  1OIP A;  4EDF A;  2H8P D;  4AYC A;  2HYN A;  3H1K E;  1GL2 A;  3D71 A;  4K35 A;  2E76 B;  3ITK A;  4NPD A;  1NTK J;  1NU1 K;  3MZW B;  1SQP D;  2POH A;  3GTE A;  2OYO A;  3PP5 A;  3RK3 D;  3VMI D;  4HKV A;  4NBB D;  1IFM A;  3H1J G;  1SS1 A;  2AEJ A;  4DCK A;  3ABV C;  3L4F A;  2AXC A;  1WQL A;  1NTZ K;  1SQX E;  3BCC J;  4IFF A;  1NTZ G;  1GL2 B;  4YTP C;  4OGQ C;  5AVS B;  4H13 B;  3K5B A;  4YPC A;  3CX5 I;  1FAV A;  1X8Y A;  2W83 C;  2WMM A;  5APU A;  1KFN A;  2E4P A;  1NDO A;  2GBW A;  1YQ4 C;  3IAO A;  1K8A Q;  3LW5 H;  5KJ7 C;  2OYI B;  2WPQ A;  3HRN A;  3VYI A;  3D70 A;  1SQB J;  2NPS C;  1DD4 A;  1ZOY C;  1KZU B;  2B87 A;  1SQX K;  1NTM D;  2L5G B;  2JKV A;  3WUV A;  1KC8 Q;  2O3J A;  1SQX G;  1KYO D;  2YFL A;  4P1C H;  1EC5 A;  2HMO A;  1R8E A;  1EQ7 A;  1MV8 A;  2FKW B;  2M5A B;  5AW8 B;  3CCU P;  1LT1 A;  2C0X A;  2FYU E;  4N6J A;  4XE5 B;  3L71 J;  2DE6 D;  5KAI H;  3L70 E;  3NFQ A;  2BCC D;  3MIW A;  1O7G A;  2RMZ A;  3EFF K;  3CXH H;  4WY4 C;  1N2D C;  4QDC A;  1LGH B;  5KAI E;  1FE6 A;  2OAR A;  4JYB A;  2RKL A;  3CXH E;  4K3A A;  1KN7 A;  2ZYG A;  2E74 C;  1P84 H;  2QRX A;  2ZAE B;  5CCH A;  2I1J A;  3AE4 C;  1P84 E;  1ZXG A;  1M1K Q;  1FZC A;  4NBA D;  4R4L A;  2IZ0 A;  3CI9 A;  3M9B A;  2YFJ A;  1O7H A;  1PP9 D;  4Y28 J;  3CCQ P;  2FYU K;  4HJL A;  2DE5 D;  2FYU G;  2P67 A;  3O6Q B;  3AEF C;  1KIL E;  4U7J A;  1JMM A;  1IFN A;  1BE3 J;  3M0D A;  5BOK A;  3RK2 C;  2W27 A;  1TU3 F;  3CWB D;  2N1T D;  1SQV D;  1X0T A;  1Q82 Q;  1DIP A;  1U7M A;  3A5T A;  1ZW0 A;  1PPJ D;  1JOC A;  4PD4 I;  1UUV A;  3HD7 B;  2HPC A;  5B66 H;  3FOU A;  3HTK A;  1L4A C;  2NPS A;  1OX3 A;  1Q81 Q;  1HVV A;  5H2F H;  5B66 E;  1VM9 A;  1VF5 C;  3B5N C;  3O8Z A;  3VP8 A;  2WSE H;  3CXH I;  5H2F E;  1W2E A;  2K3R A;  1QL2 A;  3L73 D;  1M7L A;  1CI6 A;  1NWQ A;  5AW3 B;  1OWA A;  3V6I A;  1FZG A;  2XZR A;  4W7Z A;  2OTJ P;  4HKZ H;  5GTI H;  2IFN A;  3KPE A;  1MFT A;  1P84 I;  3L75 E;  2P58 A;  2JR8 A;  2CPB A;  2ZXE B;  2HPC B;  1NYH A;  4WY4 A;  3HTK B;  5GTI E;  1KTM A;  2E42 A;  4I7Z B;  3VP9 A;  1H8A A;  3Q1M A;  1ZR2 A;  2NVF A;  3U1A A;  1BGY D;  4BRY B;  3B8E B;  1GMJ A;  1J1E C;  2ZJS E;  3HE5 A;  2W6A A;  3PLN A;  3RL0 D;  1NJI Q;  3VN0 A;  1RE4 C;  4PJ0 E;  4WY4 B;  1S4X A;  1PGQ A;  4HYT B;  5CBO A;  4U3F D;  1IK7 A;  3GL0 A;  2QJP B;  2WVR A;  3L75 G;  2N1T C;  3CPW O;  1M57 D;  2E4Q A;  1N73 C;  1NVO A;  1T3J A;  1OW6 A;  3EQ2 A;  3H1J J;  3S1K A;  2ZT9 B;  1LTB C;  2ZYL A;  3MD0 A;  1H89 A;  3KZI H;  1E5W A;  1BCC D;  2XR8 A;  4M3L A;  3KZI E;  1PZQ A;  1T2K D;  1NTZ J;  3UIA A;  4B86 A;  5DJU B;  4DOJ A;  1KQL A;  2A06 G;  3H1I E;  1FDM A;  4EMJ B;  5AVY B;  3SWK A;  2FY8 A;  3BRT B;  3B5N A;  1VQP P;  4C7R A;  2Y0C A;  1S72 P;  3RK2 B;  3VMH D;  2WPR A;  2ZYD A;  4QUQ A;  4W7Y A;  1RQV A;  1RF1 C;  1VQN P;  2M3E A;  3HUS A;  2B1X A;  4GOE A;  1AQT A;  1L4A B;  3VMA A;  5B5E H;  4CPG A;  1O7M A;  2N9Y B;  4NBF D;  2XDJ A;  1D7M A;  5AVV B;  2WSF H;  1GL2 D;  1LTJ A;  2WWW A;  5B5E E;  1VQ8 P;  3TK1 A;  1FZF A;  4C46 A;  4RJT A;  1VQK P;  1SQX J;  3GCE A;  2LXC B;  3FWL A;  2UWJ E;  4H13 D;  4PV1 C;  4QDF A;  3E1R A;  3H1I G;  1L0N E;  1GW3 A;  2C9N Y;  4GIF A;  1G2C A;  3AE2 C;  2HR3 A;  3L72 D;  1KB9 H;  1N86 A;  3KDP B;  1JMB A;  1M1J A;  1DEE G;  2N1T A;  3PRJ A;  1KB9 E;  3U59 A;  1XTC C;  3LW5 J;  4D6T D;  1N73 A;  1EG9 A;  3RL0 g;  4QDF B;  3RK3 E;  1KQS O;  1NAF A;  3GB4 A;  1J1E B;  3MUD C;  1YHQ P;  5CBN A;  1G2C B;  3GMA A;  5AW7 B;  3H1L D;  1OVV A;  2MKV A;  1L0N K;  2DE7 D;  1VQ7 P;  2HLO A;  1VDF A;  2M8R A;  1L0N G;  2E76 C;  1VQ4 P;  2FYU J;  1LTG C;  5C39 A;  2JO1 A;  3ZDM A;  2QEX P;  1LTS C;  5AVX B;  3H25 A;  1EDL A;  1K05 A;  3EFG A;  1RF1 A;  1Q2N A;  2B9B A;  2YKQ A;  3P8C D;  3CMA P;  4I1L A;  1S1C X;  2KS1 B;  1BSN A;  1X22 A;  1HTL C;  2FXO A;  5M1B A;  2Q3I A;  2JEE A;  1KYO H;  1NTK D;  2K9J A;  3I56 P;  1NTM E;  1JTH B;  5KLV E;  1EXI A;  5AW1 B;  3Q3D A;  4HM0 A;  1KYO E;  2IDB A;  3JC2 2;  1KIL C;  1Q90 C;  1Q86 Q;  4ZNC A;  1KB9 I;  3D6Z A;  1RF1 B;  2H88 C;  3V2R A;  1T6A A;  2IYP A;  2JJL A;  1NAY A;  4GOF A;  4LGD E;  1URQ C;  3WUU A;  1X9V A;  3BCC D;  2BCC E;  2G3A A;  5KAF H;  2FXM A;  4IFD K;  4HM1 A;  1SLQ A;  2O01 H;  5KAF E;  4ZMD A;  3C0D A;  1CSB A;  4OGQ D;  2WT7 A;  5KLI B;  1GU4 A;  3P32 A;  2HOD A;  2KNC A;  4PV1 B;  2YIU C;  1NKZ B;  3A3Y B;  3S9O A;  1NTM K;  2XRX A;  1JO5 A;  3MUD A;  3L74 D;  2L91 A;  4C7N A;  5KLV G;  1WMK A;  3N0Q A;  5BU5 A;  3SWF A;  4I6M C;  3H1H E;  3A0H H;  2D2C B;  1KQF B;  1W5C E;  2HMN A;  1NU1 E;  2BMO A;  3CX5 E;  1SQB D;  1IFP A;  3A0H E;  4IOI H;  4UB6 E;  5KJ7 D;  5KKZ C;  1FJK A;  1LJ2 A;  1EDK A;  3Q5P A;  3AEC C;  2NPS D;  3L75 J;  1KV4 A;  2BCC G;  1HH0 A;  3WUT A;  1J1D C;  2HOD B;  2KNC B;  1ZP0 C;  3AEB C;  4NPF X;  2WTY A;  3A0B H;  3TNU B;  1G8K B;  2BMR A;  1YTZ T;  1KYO I;  3Q2Y A;  1VQ6 P;  2IBZ D;  1GTW A;  4C7N B;  1HGZ A;  1FDO A;  2I7F A;  1SQQ E;  3A0B E;  4JBZ A;  2Z5I A;  3IFM A;  4JQ0 D;  1RFS A;  4WB4 A;  2XNX A;  2XV5 A;  1DEB A;  4WY4 D;  3H1H G;  2HML A;  3RBZ A;  2PRR A;  2W6B A;  2WQY C;  1NU1 G;  5AW5 B;  2CKF A;  1JY2 O;  2C9L Y;  4NBG D;  2E74 D;  3L73 E;  1IFI A;  3GLM A;  1S5L X;  1ZR4 A;  4YXW H;  3CCE P;  2OYI A;  3CCR P;  5TJH A;  1ULJ A;  2GUS A;  1URQ A;  3HD7 C;  2QJK C;  4NBD D;  1HGV A;  1SQQ K;  2Y9Z A;  2CK3 H;  1NHL A;  5AVW B;  1JY2 P;  1SQQ G;  3H32 A;  2QM8 A;  3H1K G;  1BE3 D;  2NZ2 A;  2PFX A;  3W67 A;  2RH0 A;  1KIL B;  3GF3 A;  3CCM P;  2M5A A;  3G3Z A;  3H1I J;  3RK2 D;  1L2P A;  5AVZ B;  1Z56 A;  1URQ B;  2YXR B;  1VQM P;  4NBH D;  4I7Z C;  1JNM A;  1LP1 B;  3AE6 C;  1H88 A;  2V7Q H;  1GDT A;  4BXL A;  4N78 D; 
#chains in the Genus database with same CATH homology
 3L75 E;  3L72 E;  4H44 D;  4H0L D;  4QDC A;  5AEU A;  1BGY E;  2B1X A;  3GZY A;  4NB9 D;  1RIE A;  2A06 E;  3GTE A;  3CXH E;  1G8K B;  2BMR A;  2NUM A;  5CXM A;  2E75 D;  1UUW A;  3VMI D;  4HKV A;  1VF5 D;  4NBB D;  1PP9 E;  1O7M A;  2I7F A;  2NVF A;  4D6T E;  4PD4 E;  1VCK A;  1SQQ E;  4NBF D;  3VMG D;  1L0L E;  3GZX A;  2HMK A;  2E76 D;  4HM5 A;  4NBE D;  1JM1 A;  1WQL A;  1P84 E;  1RFS A;  3TGU E;  4U3F E;  3D89 A;  1SJG A;  1BE3 E;  4AAY B;  4NBA D;  4HM4 A;  2B24 A;  3GCE A;  3EN1 A;  1NTM E;  2YVJ B;  4H13 D;  1SQX E;  5KLV E;  3L74 E;  4QDF A;  4P1B H;  2YFJ A;  3BCC E;  2QPZ A;  5AEW A;  3DQY A;  4HM0 A;  1KYO E;  1O7H A;  3H1L E;  3GTS A;  3CWB E;  2HML A;  4QDD A;  2GBX A;  2QJP C;  1L0N E;  1Q90 C;  2BMQ A;  4HJL A;  3GOB A;  1SQV E;  4QCK A;  1NYK A;  3H1J E;  2DE5 D;  4AIV A;  2CKF A;  1FQT A;  4NBG D;  2E74 D;  3GL0 A;  3VCP A;  2E4P A;  2XSH A;  3L73 E;  3GKE A;  2QJY C;  1ZRT E;  1PPJ E;  1ULI A;  5BOK A;  1NDO A;  5KLI C;  1BCC E;  2GBW A;  2BCC E;  4QUR A;  1ULJ A;  2HMM A;  1G8J B;  3GL2 A;  4NB8 D;  4HM6 A;  1O7W A;  4HM1 A;  4HM7 A;  2E4Q A;  2QJK C;  1KB9 E;  4NBD D;  3EQQ A;  2FYN C;  2NUK A;  4PV1 D;  3C0D A;  4HM2 A;  2NWF A;  3VCA A;  4OGQ D;  2XSO A;  1EG9 A;  2Q3W A;  2ZYL A;  4QDF B;  3GB4 A;  4QUP A;  4HM3 A;  1UUV A;  1O7N A;  1SQB E;  2YIU C;  3FOU A;  2XRX A;  2XR8 A;  2HMJ A;  2JZA A;  4NBC D;  2NVG A;  3AZC A;  1EZV E;  5HL4 A;  2YFL A;  4P1C H;  1NTK E;  2ZT9 D;  1VM9 A;  4HM8 A;  1NTZ E;  3N0Q A;  2DE7 D;  2HMO A;  3H1I E;  3H1H E;  2NVE A;  4EMJ B;  2HMN A;  1SQP E;  1NU1 E;  2BMO A;  3CX5 E;  2FYU E;  2JO6 A;  2IBZ E;  4NBH D;  5KKZ C;  3H1K E;  1O7P A;  3VMH D;  2DE6 D;  3L70 E;  4QUQ A;  3L71 E;  1O7G A;  2D2C D;  2YFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...