1SQPE

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 38
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqpE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqpE02
2IBZE 1ZRTE 5BOKA 5KLIC 1SQXE 2E74D 2NWFA 3VCPA 1VF5D 1SQQE 5CXMA 1VM9A 1G8JB 1WQLA 3H1KE 2ZT9D 1O7WA 4PV1D 1O7PA 1UUVA 4D6TE 1BE3E 2YFIA 3BCCE 1SJGA 2ZYLA 1NTME 3EN1A 4QDFB 3N0QA 2GBWA 1O7HA 2E4PA 3GL2A 1EZVE 3GTEA 4NBFD 3TGUE 1NYKA 3GZYA 2E76D 1KYOE 1PP9E 1KB9E 2CKFA 1P84E 1L0NE 4NBED 2DE6D 1RFSA 5HL4A 4U3FE 3H1IE 2I7FA 3GOBA 5AEWA 1UUWA 4NBHD 4HM0A 3GCEA 3H1LE 2NUKA 3L74E 2HMNA 1NTZE 2XRXA 2HMOA 4QUPA 3CWBE 2HMLA 2YVJB 4NB9D 1SQBE 2NVGA 3FOUA 2GBXA 3L72E 4NBAD 4HJLA 4HM6A 2NVFA 4HM7A 4NBDD 2E4QA 1NU1E 4NBCD 2DE7D 1NTKE 4HM1A 1JM1A 1Q90C 4PD4E 2XSOA 3D89A 4HM3A 3VMHD 2B24A 2JZAA 2JO6A 4NBBD 2XR8A 4NB8D 3EQQA 4QUQA 4AAYB 2NVEA 3CXHE 2E75D 4NBGD 4HM5A 4P1CH 1BCCE 2BMOA 3CX5E 2YIUC 2FYUE 2A06E 3VCAA 4HM4A 3VMGD 2NUMA 5AEUA 3GZXA 2HMJA 3GTSA 1BGYE 1SQPE 1RIEA 4H0LD 4HM8A 2D2CD 2BCCE 1ULIA 2YFJA 1PPJE 2HMMA 5KLVE 1O7GA 4OGQD 4HM2A 4QCKA 1O7MA 4QDFA 1L0LE 3H1HE 4EMJB 1NDOA 3GB4A 2QJYC 2B1XA 3GKEA 2BMQA 2XSHA 2FYNC 2BMRA 1ULJA 2QPZA 2HMKA 4H44D 4QDDA 1FQTA 5KKZC 2QJKC 3L71E 3L75E 1O7NA 1SQVE 3C0DA 3AZCA 4P1BH 3DQYA 2YFLA 4QDCA 4HKVA 1EG9A 3H1JE 3L70E 2QJPC 1VCKA 4H13D 4AIVA 3L73E 2Q3WA 4QURA 3VMID 3GL0A 2DE5D 1G8KB
chains in the Genus database with same CATH superfamily
1KN7A 2NPSC 1MKMA 1G8JB 1N2DC 3S9OA 3CCRP 4KT0J 1NTME 1ZRTD 2N1TC 3H1HJ 3AE2C 1L2PA 4ZMDA 3EQ2A 1LJ2A 3O6QB 5AW1B 1SFCA 1SQBD 2V4HA 1NTZK 1GL2A 1UIIA 4UB8E 4U3FE 4NBHD 3M91A 3G6EP 2IX7C 3U59A 2H7HA 3II6A 4U7JA 1DX7A 2GBXA 5CMZA 3G3ZA 1W2EA 4PJ0E 3TDKA 1NYHA 2BCCG 2PGDA 1PPJG 1AQ5A 4DJGA 3CCEP 2K3RA 1NH4A 1Z56A 4HM5A 4P1CH 3VCAA 2N9BA 4PD4D 3H25A 2JKVA 2QA4P 4H0LB 1ULIA 1Q2NA 3SSUA 1R8EA 3H1IJ 1NWQA 3SWKA 5CJ4A 3GB4A 4AQRD 2BMQA 2BMRA 3RBZA 3VOPA 3CCVP 5C39A 2YKPA 2QJKC 2W6JH 2KS1B 3L75E 3C0DA 1YTZT 4H13D 1CI6A 5AVTB 4QURA 4I6MC 1S5LE 5KLIB 3AE4C 3USSA 2I1JA 1KV4A 2LXBA 3E1RA 1JTHB 1QL1A 3H1JD 1DEEG 2P2UA 1IK9A 1KFNA 3MZWB 3A5TA 2OYOA 4PV1D 4C7RA 1ZW0A 5KAFE 3TNUA 3D6ZA 3H1ID 2IPPA 3TGUE 2YMKA 4HJGH 2P7JA 1GDTA 3ITKA 4I2LC 2YIUB 2SPZA 3I55P 3NXSA 3CXHH 3CX5H 3JSVC 3L74E 4YTPC 2HPCA 2HMNA 2IYOA 2W90A 4WY4A 4N3YB 4NBAD 2K9JA 2ZAEB 4A7PA 1H0TA 3I56P 2E76B 2XZRA 2IYPA 3CPWO 1GW4A 2Q3EA 4RESB 2YKQA 1LTTC 1OZHA 1ZLLA 1ZR4A 1VQ8P 2P10A 1BCCE 2YXRB 5AEUA 2HMJA 1EC5A 1AQTA 1GK6A 4OGQD 1G2CA 5BVZA 5GTIH 1SQPD 3GKEA 1ZMEC 1NKZB 2WSEH 2OYHB 2YFLA 4EDFA 3HD7C 1FJPA 5AVUB 2YMYA 1KMIZ 1H8AA 2Z5IA 2Q1KA 2ZVNB 1T8ZA 3K5BA 2BCCJ 4EYYQ 2B87A 4MN4C 1BE3E 1LP1B 1QL2A 3L37A 3GZYA 1PP9E 3CL3D 1YQ4C 2R32A 2OTKE 5AEWA 3L70J 3ZDMA 2NUKA 3FWLA 5AVSB 4NPFX 4XA4A 3RK3E 1YBKA 1SQQJ 3L72G 1LGHB 2Q5UA 2FYNB 1RE4C 2LKMA 1SQPK 3CXHE 3CX5E 4DOJA 3L75G 1R5LA 4GOEA 3AEDC 1GL2D 1S4XA 5AW9B 5KLVE 5AVQB 1O7GA 4QCKA 2W27A 5L8RJ 1CW5A 1Q7YQ 1JY3P 2B1XA 2QM7A 2WT7A 3GF7A 2QPZA 4H44D 3FXEA 1KZUB 4QDCA 1S5LX 1JCDA 5AW7B 3P32A 2M3EA 1KTMA 3WUVA 3TGUG 3L73G 2GUSA 4YXWH 5BOKA 5GTIE 1M1JB 1VQNP 1SQXG 5AW4B 3RK2C 2W83C 1SJGA 3A0HH 5APQA 1LT1A 2E4PA 1U7MA 3GL2A 3GG2A 1RF1A 3A7OA 1S72P 2CKFA 4D6TD 1LTGC 1J1DC 3WUUA 3AE7C 3CXHI 3V2QA 3GOBA 1EZVD 1EDIA 3BRTB 1JCCA 2YVJB 1BCCG 3H1LG 2ZT9C 1GTWA 5AW5B 1LNQA 2N1TA 1KQLA 4NBCD 4CPGA 5KTBA 4NPDA 4IOIH 1NTMJ 3EQQA 2C0WA 1J1EB 1IFIA 1SFCB 2A45I 2M0BA 3V2RA 1GL2B 1YJNP 4U3FJ 2KLUA 4HYTB 4LC1A 5TISH 3PHLA 4WY4D 2FYUK 3H1HG 2J5UA 1ZN5A 5AW8B 2B88A 4H44B 1LTBC 5KAIH 4DT0A 3PJSK 1IJDB 2HLOA 2D2CB 1KB9H 3L71D 1SQVD 5CBNA 1M1KQ 1PP9G 2IBZE 3JC22 2MJZA 2Q3IA 2NRGA 5CCGD 5CXMA 5H2FH 3TSIA 4GT1A 3CD6P 1RHZB 1RE3C 3KZIH 1RQVA 3VMYA 3Q1MA 1HTLC 1S9KE 3OAKA 1L0NE 3L75J 1Y47A 3N4XA 2OGUA 2E74B 1G1IA 1CI6B 2XRXA 2HMOA 1HGZA 2L91A 5APUA 3A0HE 4HM6A 1NU1E 2Q6QA 5CCHC 2HFED 5CJ0A 3AEGC 5KLVG 2CPSA 1PGPA 1U7JA 3L72D 2W6AA 3TNUB 4C46A 2FFDB 2J58A 2PFXA 1RY3A 4YPCA 3TGUJ 2FYUE 1OVVA 3GZXA 1KILC 3GTSA 2WSFH 1BGYE 1X9VA 4ASVA 2KB7P 2A45G 1HH0A 2OTJP 2M5AA 3HUSC 4GODA 4QDFA 3L74J 2HPCB 3VMXA 1SQVK 4WY4B 1FZCC 1AVOA 1L4AC 2K9JB 4QDDA 3ABVC 1H0TB 3O8ZA 2ZXEB 2JR8A 4QMAA 1YYCA 2AEJA 3GL0A 5TISE 1BCCJ 1ZV8A 5KLIC 1VF5D 2KK7A 3B5NC 3H1KE 1KILD 3L73D 3V6IA 2QG4A 4L74A 3FX0A 4HB1A 3U1CA 5KAIE 1OW7A 4O9BA 1YIJP 1SQXD 1M8OB 2E75C 1G2CB 2E5TA 3KXDA 1HJBA 3GTEA 3HD7A 4XE5B 1KB9E 1P84I 1L4AD 1USDA 2V7QH 3H32A 1ZR2A 3C9IA 1IC2A 1JY3N 1K73Q 3V2PA 5B5EE 5DJUB 4L76A 3B8EB 3SFEC 5H2FE 3GCEA 1KYOD 2W8ZA 1RH5B 3QWOC 2NVGA 2KNCA 1EXJA 3KZIE 1PIXA 1URQC 3E1IA 4NBDD 3A0BH 3B5ND 1GW3A 3H1LD 1QGKB 1NTKE 1DEBA 2PAJA 2B87B 3NTNA 1S3JA 1BE3J 2WITA 2E76C 5KJ7C 4NB8D 1OVRA 4EIJA 4AAYB 2AXTH 2E75D 1RQUA 1PP9J 2VRSA 1LWUC 2P58A 5E79H 3MTUE 1BDCA 1U57A 3P7KA 4IFMA 2NPSD 1L0LE 4EMJB 2G3AA 2YKOA 2N1TD 1RE4A 4AUWA 1URQD 1OX3A 3RK3C 3H1HD 3GHGC 1QVFO 4K35A 1FDIA 3SWYA 2OYHC 5AVXB 2JP3A 1SQXK 3M0DC 4AIVA 3L70G 3Q2YA 4N78D 1G8KB 4LGDE 1VF5B 1SQQG 1JEKA 1PFIA 5APVA 1UUVA 5KLVJ 3BCCE 3VN0A 4KHXA 4NBFD 1NYKA 1VL2A 3CCMP 2WT7B 1MFTA 2O1JA 4PD4H 1N7SB 1Y8AA 1SQBK 3A2AA 1JY2N 2ZYDA 3HE5A 1FZBA 3P8MC 1NTZE 3CWBE 3P8CD 3Q5PA 1ZXGA 4RO0A 2Y0EA 2WSEJ 1EQ7A 1JOCA 1IFDA 1TU3F 3LW5J 2JO6A 3IN6A 3PH0A 2QE7H 3RL0C 1QVGO 4BXLA 3V5BA 2A06E 3Q5RA 3MUDC 1RF1B 2E43A 1WRGA 3A0BE 1O7MA 4JBZA 1NVOA 1NO4A 1DH3A 3AEEC 2G8YA 3L36A 1T6AA 2O01H 3HRNA 2JEEA 2GA1A 2AXTE 3H1KG 5KKZC 3HE4B 1LT9C 1KD1Q 4HKVA 2QJPC 5E79E 5CCGA 1SP4A 5AVYB 2KXPB 1YJ9P 4OWFA 2QRXA 1ZRTE 4KJMA 1G1JA 4RJTA 1VM9A 2JWDA 3RBXA 3EFGA 1O7WA 1JB0J 1ZOYC 1IFNA 3BVHA 2L5GB 5AW6B 1NTMG 2H8PD 1KQSO 1OW8A 4H13B 2K9YA 1NTKG 2DE6D 2PRRA 1YQ3C 5APYA 4U3FG 4QUPA 1R5SA 4PV1B 2O1KA 1RE3A 1LTJC 4UB6H 2K88A 4PD4E 4RKUJ 1PGOA 2QJKB 4NBBD 3Q3DA 3D6YA 1J2JB 3MHVA 3HD7D 1ZP0C 1NAFA 1OMIA 3VMGD 1HVVA 1JNMA 1L0NJ 4W7YA 1QX8A 2WQYC 1HF9A 1OWAA 2KP8A 5CCHA 1X22A 3QH9A 3VMZA 1CSBA 2BCCD 1PPJD 2RH0A 3M0AA 1NU1J 3GLMA 3AZCA 4JYBA 2GUVA 3H1JE 3BCCG 3CCJP 2QEXP 3LIEA 1KILA 3V4QA 2Q3WA 3RL0g 1PZQA 3PRJA 2KIKA 3SWFA 4WVZA 4OGQB 3OA7A 2OQQA 2YNYA 3HUSA 2FYUJ 3HTKA 3L70D 1DD3A 1K9MQ 1FZCA 1BGYJ 2BEZF 1S9KD 1VQ5P 1L4AA 3U1AA 2M5AB 3WMM0 1NTZG 1MFZA 3CWBG 4QDFB 2WPSA 2GBWA 1SQQD 3TYYA 1LTAC 1FU1A 1RFSA 5HL4A 1T2KC 3B5NA 4HM0A 4Y28J 2WPVB 2E74C 1DIPA 4BRYB 1P84D 3L74G 2A06G 1HBWA 1FOSF 1YHQP 1Q81Q 3H1KJ 1N73C 3IFMA 4IL6H 2XR8A 3FWNA 3VMAA 3CX5I 3EWKA 2NPSA 3HD7B 3CMAP 2FFDC 1M7LA 3W68A 3H32B 1SQPE 1KC8Q 2HMMA 1T2KD 4UB6E 1Q86Q 1URQA 4HM2A 5M1BA 1A02F 2POHA 1NDOA 2QJYC 3RK2D 2KNCB 2R5BA 3KYQA 4Z1MH 1YTZI 1NTKJ 1EDKA 1VCKA 1LWUA 3H1KD 4HH2A 2QIWA 3VMID 2C9NY 1X8YA 3NMDA 2NZ2A 1NGMB 3C8VA 4K3AA 3CCUP 1LTIC 2ZT9D 4DCKA 4W7ZA 4GDOA 2OYIC 1KORA 3CC7P 2IDBA 3EN1A 3S4RA 1L0LJ 1VQ9P 2M3BA 1BE3G 3GHGA 1O7HA 1AJYA 3WUTA 1SLQA 2MKVA 2J59M 3M0DA 2R3SA 4WBAA 1NTMD 1PGQA 2WZ7A 2AEMA 1OW6A 2WSCJ 1NTKD 2NVFA 4U3FD 4Y99B 1LP1A 2QVAA 1HGVA 5AW2B 1JM1A 2M8RA 2OARA 4TT3H 2KUBA 3CCQP 3BCCJ 4WB4A 2JZAA 1YITP 2O3JA 2LXCB 1M56D 1H88A 2NUMA 1S2EA 1RIEA 4ZKPA 3H1JG 1KQGB 2DW3A 1K04A 3HE5B 1IFMA 1FDMA 1NTZJ 5K5GB 3CWBJ 1Q82Q 1E5WA 1M57D 4YXDC 2B9BA 1LTSC 3PTZA 2B89A 4PJ0H 2KYVA 3CC2P 5AW0B 1MUUA 1FZFA 3M9BA 1J1DB 3L75D 2IBZI 4H0LC 1OIPA 3MP7B 1HJ0A 5BU8B 1NTMK 1A02J 2FXPA 3AEFC 3AEAC 3R4YA 4D6TE 5CCHD 3L35A 1LT9A 3UIAA 2Y9ZA 1EZVE 4ZKUA 4GOFA 4C7NA 4N6JA 2P1JA 2RMZA 2HODA 1N7SC 3TGUD 3M9QA 2HMLA 4OH8B 1SQPG 4I7ZB 3L74D 4HM1A 1SVFA 2XSOA 3D89A 4HM3A 2B24A 3D70A 1YJWP 2YIUC 1MV8A 2W6BA 2GM4A 1RF1C 1BCCD 2Y9YA 1LTJA 2BEQD 3V2NA 1VQLP 3FXDA 1IFJA 2UWJE 3M06A 1ULJA 1GZLA 3AE6C 2JDIH 1FQTA 1HWTC 1MZ9A 3L71E 1SQVE 5AVVB 1EZVI 3KDPB 2OTLP 1KYOH 3BASA 2XDJA 3CCLP 1FC2C 2IZ0A 2FXMA 5CHXA 2IBZG 5B66H 1WQLA 2AEFA 2FYZA 2IFMA 3IF4A 2YFIA 3A3YB 2HR3A 3D71A 3W67A 1KB9I 5KJ7D 2E76D 1OVUA 2E5YA 4H13C 2KZJA 1BE3D 1VDFA 2E42A 3AECC 1L0NG 2Z5HA 3H1JJ 1KILB 5APTA 1PP9D 1RF0C 3TK1A 4NB9D 2JJLA 2FKWB 3L72E 3HUSB 4PV1C 3HTKB 1FZCB 2AXCA 1NU1G 2O01J 1X79B 2Z4EA 1L4AB 3RK3D 2CK3H 1FOSE 1UIXA 2R3CA 3T97A 1HUCA 4NBGD 1JY2O 5BU5A 2BMOA 2IZ1A 1IFPA 2XNXA 1Y9BA 2FYUG 3KPEA 1EDLA 4HM8A 3WU2H 2O01N 1BGYG 1AVYA 3CXHD 4IL6X 3B5NB 3CX5D 1N73A 1PGJA 3VP8A 3C1LA 2FYNC 3BRVB 3NFQA 5KLVD 3PLNA 1QEXA 2E75B 3VP9A 4D6TG 1JO5A 2FFDA 3MGNA 4GIFA 3VYIA 1KILE 3L73E 1FE6A 1EZVG 3S1KA 1BDDA 2NPSB 1N8RQ 1SQXE 4OGQC 2HG5D 5DJTB 1SQPJ 5GTHH 2N1TB 1FZEA 3AE9C 1URQB 2ZYLA 1K8AQ 1WMKA 3EFFK 4L73A 3AE8C 3F5HA 2KLVA 1KYOE 3RL0D 3KQGA 2I7FA 2KSJA 5B66E 1PV3A 1LWUB 1M90Q 4HKZH 3H1LE 1M1JC 2I8DA 1SQBE 2WPQA 3IAOA 2XU6A 2OYIA 2A45H 3IR9A 5TJHA 2WSSH 1EDJA 2Y0DA 1K05A 1VQOP 1Q90C 4GKGA 3RK3B 1D7MA 3GHGB 2NVEA 3CC4P 3LW5H 5AVWB 4HM4A 3L71G 5KLVK 1SQVG 2YXQB 1DD4A 3MIWA 1FZAA 2N9YB 3H1HE 1E79H 1VQPP 3AE1C 1L0LG 1CZQA 1WT6A 1T3UA 3O6QA 2HMKA 3M9HA 2KOGA 1AA0A 4N78E 4M3LA 1JMMA 4ASWA 1VQ4P 1Q90D 3WU2E 1J1EC 1KYOI 1SFCC 1GL2C 3E7KA 2NWFA 2RN0A 4EI2A 3AEBC 1GK4A 1O7PA 2IBZD 1N7LA 3N0QA 4H44C 2R44A 2JO1A 3P8CE 1BSHA 1T3JA 1SS1A 2Q7CA 4JPZB 3RL0B 2D2CC 3H1IE 1NOHA 2I1KA 5AVRB 5GTHE 2C0XA 1NJIQ 1SFCD 2XKMA 1L0ND 2LR2A 5EFWB 1BSNA 4HM7A 2E4QA 1FBMA 2KS1A 2WTYA 2DE7D 4PD4I 4Y99C 1NAYA 5KKZB 4D6TJ 2R5DA 1LT9B 2QM8A 1NU1D 1N7SA 4W80A 2QJPB 3B4SA 1JTHA 4C7NB 2D2CD 2HODB 2ZXXA 3I5CA 3CMEP 2WVRA 2C9LY 2FBWC 2FYUD 5APSA 2ZJSE 1BGYD 4OVNF 2WPRA 1QLED 4WWIA 2XNDH 4EOTA 1OFCX 3N7NA 3CCSP 1W5CE 3F89A 3AE5C 2KI7B 2DE5D 1P84H 4I1LA 1JUNA 2XV5A 3MD0A 2E74D 3VCPA 1H89A 4TLFA 4WY4C 2ZYGA 2Y0CA 5KJ7A 2IFNA 2ZVOB 1YI2P 1XTGB 1LTJB 1SQBG 1L0NK 2YO3A 3HE4A 2HYNA 3L4FA 3GW6A 1SQQK 4DZOA 3CLQA 3L71J 2FXOA 1SQVJ 4NBED 1AV1A 3OW2O 3LIDA 1UUWA 3V4WA 1S1CX 1NU1K 1KB9D 4IFFA 1FS0E 5CCGC 1PL5A 1FAVA 4HJLA 2RKLA 4L75A 2OYHA 3OJAB 1N86A 2YO2A 3BATA 4AYCA 4I7ZC 1X0TA 3Q5SA 1JY2P 3JCUH 3H6PA 2WSFJ 4IFDK 2K1AA 1RF0A 2KSEA 4ZNCA 1XTCC 3AE3C 4NPEA 2BCCE 1VQMP 1FZGA 1PPJE 2KZIA 1FDOA 1GD2E 4JYCA 3TF5A 1AFOA 5B5EH 3G71P 2WMMA 3GMAA 3L72J 3GF3A 4R4MA 1L0LD 5CBOA 4P1BH 1EG9A 3L70E 2JWAA 4R4LA 3R2PA 1FJKA 3T97B 2ITAA 4UB8H 1SQQE 4XFJA 5AVZB 1NKNA 3RK2B 3B71A 2BASA 4IL6E 3H1IG 1GU4A 2ZFCA 2Q9IA 1N73B 3MUDA 2V7QJ 3CI9A 1VPCA 2H89C 1P84E 3BCCD 1VQ6P 5APXA 1USEA 1IO4A 1GMJA 1VQKP 2WWWA 2ZT9B 3L73J 1VF5C 3KHUA 1OXZA 1NTKK 2WSCH 3FOUA 4BWNA 1IZNB 2P67A 2CPBA 3PP5A 1SQXJ 1NHLA 2K37A 2QJYB 5AW3B 1NTZD 3CWBD 2PP6A 4JF7A 2H88C 3VMHD 1KFMA 1W2BO 4QUQA 2H43A 1EXIA 2FY8A 1M1JA 2QSIA 1L0LK 4H0LD 4LLHA 2YFJA 3SFDC 4BRYA 1S5LH 3VTPC 2A06D 1VQ7P 3H1LJ 4JQ0D 4B86A 1SQBJ 5APWA 2OYIB 1JMBA 2XSHA 1IK7A 1JY3O 3FGAD 3JCUE 3G4SP 1O7NA 3DQYA 3RGUA 5KAFH 1KQFB 2ZYAA 3G9RA 1N7SD 1GU5A 1JM0A
chains in the Genus database with same CATH topology
2IBZE 1ZRTE 5BOKA 5KLIC 1SQXE 2E74D 2NWFA 3VCPA 1VF5D 1SQQE 5CXMA 1VM9A 1G8JB 1WQLA 3H1KE 2ZT9D 1O7WA 4PV1D 1O7PA 1UUVA 4D6TE 1BE3E 2YFIA 3BCCE 1SJGA 2ZYLA 1NTME 3EN1A 4QDFB 3N0QA 2GBWA 1O7HA 2E4PA 3GL2A 1EZVE 3GTEA 4NBFD 3TGUE 1NYKA 3GZYA 2E76D 1KYOE 1PP9E 1KB9E 2CKFA 1P84E 1L0NE 4NBED 2DE6D 1RFSA 5HL4A 4U3FE 3H1IE 2I7FA 3GOBA 5AEWA 1UUWA 4NBHD 4HM0A 3GCEA 3H1LE 2NUKA 3L74E 2HMNA 1NTZE 2XRXA 2HMOA 4QUPA 3CWBE 2HMLA 2YVJB 4NB9D 1SQBE 2NVGA 3FOUA 2GBXA 3L72E 4NBAD 4HJLA 4HM6A 2NVFA 4HM7A 4NBDD 2E4QA 1NU1E 4NBCD 2DE7D 1NTKE 4HM1A 1JM1A 1Q90C 4PD4E 2XSOA 3D89A 4HM3A 3VMHD 2B24A 2JZAA 2JO6A 4NBBD 2XR8A 4NB8D 3EQQA 4QUQA 4AAYB 2NVEA 3CXHE 2E75D 4NBGD 4HM5A 4P1CH 1BCCE 2BMOA 3CX5E 2YIUC 2FYUE 2A06E 3VCAA 4HM4A 3VMGD 2NUMA 5AEUA 3GZXA 2HMJA 3GTSA 1BGYE 1SQPE 1RIEA 4H0LD 4HM8A 2D2CD 2BCCE 1ULIA 2YFJA 1PPJE 2HMMA 5KLVE 1O7GA 4OGQD 4HM2A 4QCKA 1O7MA 4QDFA 1L0LE 3H1HE 4EMJB 1NDOA 3GB4A 2QJYC 2B1XA 3GKEA 2BMQA 2XSHA 2FYNC 2BMRA 1ULJA 2QPZA 2HMKA 4H44D 4QDDA 1FQTA 5KKZC 2QJKC 3L71E 3L75E 1O7NA 1SQVE 3C0DA 3AZCA 4P1BH 3DQYA 2YFLA 4QDCA 4HKVA 1EG9A 3H1JE 3L70E 2QJPC 1VCKA 4H13D 4AIVA 3L73E 2Q3WA 4QURA 3VMID 3GL0A 2DE5D 1G8KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBZ E;  1ZRT E;  5BOK A;  5KLI C;  1SQX E;  2E74 D;  2NWF A;  3VCP A;  1VF5 D;  1SQQ E;  5CXM A;  1VM9 A;  1G8J B;  1WQL A;  3H1K E;  2ZT9 D;  1O7W A;  4PV1 D;  1O7P A;  1UUV A;  4D6T E;  1BE3 E;  2YFI A;  3BCC E;  1SJG A;  2ZYL A;  1NTM E;  3EN1 A;  4QDF B;  3N0Q A;  2GBW A;  1O7H A;  2E4P A;  3GL2 A;  1EZV E;  3GTE A;  4NBF D;  3TGU E;  1NYK A;  3GZY A;  2E76 D;  1KYO E;  1PP9 E;  1KB9 E;  2CKF A;  1P84 E;  1L0N E;  4NBE D;  2DE6 D;  1RFS A;  5HL4 A;  4U3F E;  3H1I E;  2I7F A;  3GOB A;  5AEW A;  1UUW A;  4NBH D;  4HM0 A;  3GCE A;  3H1L E;  2NUK A;  3L74 E;  2HMN A;  1NTZ E;  2XRX A;  2HMO A;  4QUP A;  3CWB E;  2HML A;  2YVJ B;  4NB9 D;  1SQB E;  2NVG A;  3FOU A;  2GBX A;  3L72 E;  4NBA D;  4HJL A;  4HM6 A;  2NVF A;  4HM7 A;  4NBD D;  2E4Q A;  1NU1 E;  4NBC D;  2DE7 D;  1NTK E;  4HM1 A;  1JM1 A;  1Q90 C;  4PD4 E;  2XSO A;  3D89 A;  4HM3 A;  3VMH D;  2B24 A;  2JZA A;  2JO6 A;  4NBB D;  2XR8 A;  4NB8 D;  3EQQ A;  4QUQ A;  4AAY B;  2NVE A;  3CXH E;  2E75 D;  4NBG D;  4HM5 A;  4P1C H;  1BCC E;  2BMO A;  3CX5 E;  2YIU C;  2FYU E;  2A06 E;  3VCA A;  4HM4 A;  3VMG D;  2NUM A;  5AEU A;  3GZX A;  2HMJ A;  3GTS A;  1BGY E;  1SQP E;  1RIE A;  4H0L D;  4HM8 A;  2D2C D;  2BCC E;  1ULI A;  2YFJ A;  1PPJ E;  2HMM A;  5KLV E;  1O7G A;  4OGQ D;  4HM2 A;  4QCK A;  1O7M A;  4QDF A;  1L0L E;  3H1H E;  4EMJ B;  1NDO A;  3GB4 A;  2QJY C;  2B1X A;  3GKE A;  2BMQ A;  2XSH A;  2FYN C;  2BMR A;  1ULJ A;  2QPZ A;  2HMK A;  4H44 D;  4QDD A;  1FQT A;  5KKZ C;  2QJK C;  3L71 E;  3L75 E;  1O7N A;  1SQV E;  3C0D A;  3AZC A;  4P1B H;  3DQY A;  2YFL A;  4QDC A;  4HKV A;  1EG9 A;  3H1J E;  3L70 E;  2QJP C;  1VCK A;  4H13 D;  4AIV A;  3L73 E;  2Q3W A;  4QUR A;  3VMI D;  3GL0 A;  2DE5 D;  1G8K B; 
#chains in the Genus database with same CATH topology
 1KN7 A;  2NPS C;  1MKM A;  1G8J B;  1N2D C;  3S9O A;  3CCR P;  4KT0 J;  1NTM E;  1ZRT D;  2N1T C;  3H1H J;  3AE2 C;  1L2P A;  4ZMD A;  3EQ2 A;  1LJ2 A;  3O6Q B;  5AW1 B;  1SFC A;  1SQB D;  2V4H A;  1NTZ K;  1GL2 A;  1UII A;  4UB8 E;  4U3F E;  4NBH D;  3M91 A;  3G6E P;  2IX7 C;  3U59 A;  2H7H A;  3II6 A;  4U7J A;  1DX7 A;  2GBX A;  5CMZ A;  3G3Z A;  1W2E A;  4PJ0 E;  3TDK A;  1NYH A;  2BCC G;  2PGD A;  1PPJ G;  1AQ5 A;  4DJG A;  3CCE P;  2K3R A;  1NH4 A;  1Z56 A;  4HM5 A;  4P1C H;  3VCA A;  2N9B A;  4PD4 D;  3H25 A;  2JKV A;  2QA4 P;  4H0L B;  1ULI A;  1Q2N A;  3SSU A;  1R8E A;  3H1I J;  1NWQ A;  3SWK A;  5CJ4 A;  3GB4 A;  4AQR D;  2BMQ A;  2BMR A;  3RBZ A;  3VOP A;  3CCV P;  5C39 A;  2YKP A;  2QJK C;  2W6J H;  2KS1 B;  3L75 E;  3C0D A;  1YTZ T;  4H13 D;  1CI6 A;  5AVT B;  4QUR A;  4I6M C;  1S5L E;  5KLI B;  3AE4 C;  3USS A;  2I1J A;  1KV4 A;  2LXB A;  3E1R A;  1JTH B;  1QL1 A;  3H1J D;  1DEE G;  2P2U A;  1IK9 A;  1KFN A;  3MZW B;  3A5T A;  2OYO A;  4PV1 D;  4C7R A;  1ZW0 A;  5KAF E;  3TNU A;  3D6Z A;  3H1I D;  2IPP A;  3TGU E;  2YMK A;  4HJG H;  2P7J A;  1GDT A;  3ITK A;  4I2L C;  2YIU B;  2SPZ A;  3I55 P;  3NXS A;  3CXH H;  3CX5 H;  3JSV C;  3L74 E;  4YTP C;  2HPC A;  2HMN A;  2IYO A;  2W90 A;  4WY4 A;  4N3Y B;  4NBA D;  2K9J A;  2ZAE B;  4A7P A;  1H0T A;  3I56 P;  2E76 B;  2XZR A;  2IYP A;  3CPW O;  1GW4 A;  2Q3E A;  4RES B;  2YKQ A;  1LTT C;  1OZH A;  1ZLL A;  1ZR4 A;  1VQ8 P;  2P10 A;  1BCC E;  2YXR B;  5AEU A;  2HMJ A;  1EC5 A;  1AQT A;  1GK6 A;  4OGQ D;  1G2C A;  5BVZ A;  5GTI H;  1SQP D;  3GKE A;  1ZME C;  1NKZ B;  2WSE H;  2OYH B;  2YFL A;  4EDF A;  3HD7 C;  1FJP A;  5AVU B;  2YMY A;  1KMI Z;  1H8A A;  2Z5I A;  2Q1K A;  2ZVN B;  1T8Z A;  3K5B A;  2BCC J;  4EYY Q;  2B87 A;  4MN4 C;  1BE3 E;  1LP1 B;  1QL2 A;  3L37 A;  3GZY A;  1PP9 E;  3CL3 D;  1YQ4 C;  2R32 A;  2OTK E;  5AEW A;  3L70 J;  3ZDM A;  2NUK A;  3FWL A;  5AVS B;  4NPF X;  4XA4 A;  3RK3 E;  1YBK A;  1SQQ J;  3L72 G;  1LGH B;  2Q5U A;  2FYN B;  1RE4 C;  2LKM A;  1SQP K;  3CXH E;  3CX5 E;  4DOJ A;  3L75 G;  1R5L A;  4GOE A;  3AED C;  1GL2 D;  1S4X A;  5AW9 B;  5KLV E;  5AVQ B;  1O7G A;  4QCK A;  2W27 A;  5L8R J;  1CW5 A;  1Q7Y Q;  1JY3 P;  2B1X A;  2QM7 A;  2WT7 A;  3GF7 A;  2QPZ A;  4H44 D;  3FXE A;  1KZU B;  4QDC A;  1S5L X;  1JCD A;  5AW7 B;  3P32 A;  2M3E A;  1KTM A;  3WUV A;  3TGU G;  3L73 G;  2GUS A;  4YXW H;  5BOK A;  5GTI E;  1M1J B;  1VQN P;  1SQX G;  5AW4 B;  3RK2 C;  2W83 C;  1SJG A;  3A0H H;  5APQ A;  1LT1 A;  2E4P A;  1U7M A;  3GL2 A;  3GG2 A;  1RF1 A;  3A7O A;  1S72 P;  2CKF A;  4D6T D;  1LTG C;  1J1D C;  3WUU A;  3AE7 C;  3CXH I;  3V2Q A;  3GOB A;  1EZV D;  1EDI A;  3BRT B;  1JCC A;  2YVJ B;  1BCC G;  3H1L G;  2ZT9 C;  1GTW A;  5AW5 B;  1LNQ A;  2N1T A;  1KQL A;  4NBC D;  4CPG A;  5KTB A;  4NPD A;  4IOI H;  1NTM J;  3EQQ A;  2C0W A;  1J1E B;  1IFI A;  1SFC B;  2A45 I;  2M0B A;  3V2R A;  1GL2 B;  1YJN P;  4U3F J;  2KLU A;  4HYT B;  4LC1 A;  5TIS H;  3PHL A;  4WY4 D;  2FYU K;  3H1H G;  2J5U A;  1ZN5 A;  5AW8 B;  2B88 A;  4H44 B;  1LTB C;  5KAI H;  4DT0 A;  3PJS K;  1IJD B;  2HLO A;  2D2C B;  1KB9 H;  3L71 D;  1SQV D;  5CBN A;  1M1K Q;  1PP9 G;  2IBZ E;  3JC2 2;  2MJZ A;  2Q3I A;  2NRG A;  5CCG D;  5CXM A;  5H2F H;  3TSI A;  4GT1 A;  3CD6 P;  1RHZ B;  1RE3 C;  3KZI H;  1RQV A;  3VMY A;  3Q1M A;  1HTL C;  1S9K E;  3OAK A;  1L0N E;  3L75 J;  1Y47 A;  3N4X A;  2OGU A;  2E74 B;  1G1I A;  1CI6 B;  2XRX A;  2HMO A;  1HGZ A;  2L91 A;  5APU A;  3A0H E;  4HM6 A;  1NU1 E;  2Q6Q A;  5CCH C;  2HFE D;  5CJ0 A;  3AEG C;  5KLV G;  2CPS A;  1PGP A;  1U7J A;  3L72 D;  2W6A A;  3TNU B;  4C46 A;  2FFD B;  2J58 A;  2PFX A;  1RY3 A;  4YPC A;  3TGU J;  2FYU E;  1OVV A;  3GZX A;  1KIL C;  3GTS A;  2WSF H;  1BGY E;  1X9V A;  4ASV A;  2KB7 P;  2A45 G;  1HH0 A;  2OTJ P;  2M5A A;  3HUS C;  4GOD A;  4QDF A;  3L74 J;  2HPC B;  3VMX A;  1SQV K;  4WY4 B;  1FZC C;  1AVO A;  1L4A C;  2K9J B;  4QDD A;  3ABV C;  1H0T B;  3O8Z A;  2ZXE B;  2JR8 A;  4QMA A;  1YYC A;  2AEJ A;  3GL0 A;  5TIS E;  1BCC J;  1ZV8 A;  5KLI C;  1VF5 D;  2KK7 A;  3B5N C;  3H1K E;  1KIL D;  3L73 D;  3V6I A;  2QG4 A;  4L74 A;  3FX0 A;  4HB1 A;  3U1C A;  5KAI E;  1OW7 A;  4O9B A;  1YIJ P;  1SQX D;  1M8O B;  2E75 C;  1G2C B;  2E5T A;  3KXD A;  1HJB A;  3GTE A;  3HD7 A;  4XE5 B;  1KB9 E;  1P84 I;  1L4A D;  1USD A;  2V7Q H;  3H32 A;  1ZR2 A;  3C9I A;  1IC2 A;  1JY3 N;  1K73 Q;  3V2P A;  5B5E E;  5DJU B;  4L76 A;  3B8E B;  3SFE C;  5H2F E;  3GCE A;  1KYO D;  2W8Z A;  1RH5 B;  3QWO C;  2NVG A;  2KNC A;  1EXJ A;  3KZI E;  1PIX A;  1URQ C;  3E1I A;  4NBD D;  3A0B H;  3B5N D;  1GW3 A;  3H1L D;  1QGK B;  1NTK E;  1DEB A;  2PAJ A;  2B87 B;  3NTN A;  1S3J A;  1BE3 J;  2WIT A;  2E76 C;  5KJ7 C;  4NB8 D;  1OVR A;  4EIJ A;  4AAY B;  2AXT H;  2E75 D;  1RQU A;  1PP9 J;  2VRS A;  1LWU C;  2P58 A;  5E79 H;  3MTU E;  1BDC A;  1U57 A;  3P7K A;  4IFM A;  2NPS D;  1L0L E;  4EMJ B;  2G3A A;  2YKO A;  2N1T D;  1RE4 A;  4AUW A;  1URQ D;  1OX3 A;  3RK3 C;  3H1H D;  3GHG C;  1QVF O;  4K35 A;  1FDI A;  3SWY A;  2OYH C;  5AVX B;  2JP3 A;  1SQX K;  3M0D C;  4AIV A;  3L70 G;  3Q2Y A;  4N78 D;  1G8K B;  4LGD E;  1VF5 B;  1SQQ G;  1JEK A;  1PFI A;  5APV A;  1UUV A;  5KLV J;  3BCC E;  3VN0 A;  4KHX A;  4NBF D;  1NYK A;  1VL2 A;  3CCM P;  2WT7 B;  1MFT A;  2O1J A;  4PD4 H;  1N7S B;  1Y8A A;  1SQB K;  3A2A A;  1JY2 N;  2ZYD A;  3HE5 A;  1FZB A;  3P8M C;  1NTZ E;  3CWB E;  3P8C D;  3Q5P A;  1ZXG A;  4RO0 A;  2Y0E A;  2WSE J;  1EQ7 A;  1JOC A;  1IFD A;  1TU3 F;  3LW5 J;  2JO6 A;  3IN6 A;  3PH0 A;  2QE7 H;  3RL0 C;  1QVG O;  4BXL A;  3V5B A;  2A06 E;  3Q5R A;  3MUD C;  1RF1 B;  2E43 A;  1WRG A;  3A0B E;  1O7M A;  4JBZ A;  1NVO A;  1NO4 A;  1DH3 A;  3AEE C;  2G8Y A;  3L36 A;  1T6A A;  2O01 H;  3HRN A;  2JEE A;  2GA1 A;  2AXT E;  3H1K G;  5KKZ C;  3HE4 B;  1LT9 C;  1KD1 Q;  4HKV A;  2QJP C;  5E79 E;  5CCG A;  1SP4 A;  5AVY B;  2KXP B;  1YJ9 P;  4OWF A;  2QRX A;  1ZRT E;  4KJM A;  1G1J A;  4RJT A;  1VM9 A;  2JWD A;  3RBX A;  3EFG A;  1O7W A;  1JB0 J;  1ZOY C;  1IFN A;  3BVH A;  2L5G B;  5AW6 B;  1NTM G;  2H8P D;  1KQS O;  1OW8 A;  4H13 B;  2K9Y A;  1NTK G;  2DE6 D;  2PRR A;  1YQ3 C;  5APY A;  4U3F G;  4QUP A;  1R5S A;  4PV1 B;  2O1K A;  1RE3 A;  1LTJ C;  4UB6 H;  2K88 A;  4PD4 E;  4RKU J;  1PGO A;  2QJK B;  4NBB D;  3Q3D A;  3D6Y A;  1J2J B;  3MHV A;  3HD7 D;  1ZP0 C;  1NAF A;  1OMI A;  3VMG D;  1HVV A;  1JNM A;  1L0N J;  4W7Y A;  1QX8 A;  2WQY C;  1HF9 A;  1OWA A;  2KP8 A;  5CCH A;  1X22 A;  3QH9 A;  3VMZ A;  1CSB A;  2BCC D;  1PPJ D;  2RH0 A;  3M0A A;  1NU1 J;  3GLM A;  3AZC A;  4JYB A;  2GUV A;  3H1J E;  3BCC G;  3CCJ P;  2QEX P;  3LIE A;  1KIL A;  3V4Q A;  2Q3W A;  3RL0 g;  1PZQ A;  3PRJ A;  2KIK A;  3SWF A;  4WVZ A;  4OGQ B;  3OA7 A;  2OQQ A;  2YNY A;  3HUS A;  2FYU J;  3HTK A;  3L70 D;  1DD3 A;  1K9M Q;  1FZC A;  1BGY J;  2BEZ F;  1S9K D;  1VQ5 P;  1L4A A;  3U1A A;  2M5A B;  3WMM 0;  1NTZ G;  1MFZ A;  3CWB G;  4QDF B;  2WPS A;  2GBW A;  1SQQ D;  3TYY A;  1LTA C;  1FU1 A;  1RFS A;  5HL4 A;  1T2K C;  3B5N A;  4HM0 A;  4Y28 J;  2WPV B;  2E74 C;  1DIP A;  4BRY B;  1P84 D;  3L74 G;  2A06 G;  1HBW A;  1FOS F;  1YHQ P;  1Q81 Q;  3H1K J;  1N73 C;  3IFM A;  4IL6 H;  2XR8 A;  3FWN A;  3VMA A;  3CX5 I;  3EWK A;  2NPS A;  3HD7 B;  3CMA P;  2FFD C;  1M7L A;  3W68 A;  3H32 B;  1SQP E;  1KC8 Q;  2HMM A;  1T2K D;  4UB6 E;  1Q86 Q;  1URQ A;  4HM2 A;  5M1B A;  1A02 F;  2POH A;  1NDO A;  2QJY C;  3RK2 D;  2KNC B;  2R5B A;  3KYQ A;  4Z1M H;  1YTZ I;  1NTK J;  1EDK A;  1VCK A;  1LWU A;  3H1K D;  4HH2 A;  2QIW A;  3VMI D;  2C9N Y;  1X8Y A;  3NMD A;  2NZ2 A;  1NGM B;  3C8V A;  4K3A A;  3CCU P;  1LTI C;  2ZT9 D;  4DCK A;  4W7Z A;  4GDO A;  2OYI C;  1KOR A;  3CC7 P;  2IDB A;  3EN1 A;  3S4R A;  1L0L J;  1VQ9 P;  2M3B A;  1BE3 G;  3GHG A;  1O7H A;  1AJY A;  3WUT A;  1SLQ A;  2MKV A;  2J59 M;  3M0D A;  2R3S A;  4WBA A;  1NTM D;  1PGQ A;  2WZ7 A;  2AEM A;  1OW6 A;  2WSC J;  1NTK D;  2NVF A;  4U3F D;  4Y99 B;  1LP1 A;  2QVA A;  1HGV A;  5AW2 B;  1JM1 A;  2M8R A;  2OAR A;  4TT3 H;  2KUB A;  3CCQ P;  3BCC J;  4WB4 A;  2JZA A;  1YIT P;  2O3J A;  2LXC B;  1M56 D;  1H88 A;  2NUM A;  1S2E A;  1RIE A;  4ZKP A;  3H1J G;  1KQG B;  2DW3 A;  1K04 A;  3HE5 B;  1IFM A;  1FDM A;  1NTZ J;  5K5G B;  3CWB J;  1Q82 Q;  1E5W A;  1M57 D;  4YXD C;  2B9B A;  1LTS C;  3PTZ A;  2B89 A;  4PJ0 H;  2KYV A;  3CC2 P;  5AW0 B;  1MUU A;  1FZF A;  3M9B A;  1J1D B;  3L75 D;  2IBZ I;  4H0L C;  1OIP A;  3MP7 B;  1HJ0 A;  5BU8 B;  1NTM K;  1A02 J;  2FXP A;  3AEF C;  3AEA C;  3R4Y A;  4D6T E;  5CCH D;  3L35 A;  1LT9 A;  3UIA A;  2Y9Z A;  1EZV E;  4ZKU A;  4GOF A;  4C7N A;  4N6J A;  2P1J A;  2RMZ A;  2HOD A;  1N7S C;  3TGU D;  3M9Q A;  2HML A;  4OH8 B;  1SQP G;  4I7Z B;  3L74 D;  4HM1 A;  1SVF A;  2XSO A;  3D89 A;  4HM3 A;  2B24 A;  3D70 A;  1YJW P;  2YIU C;  1MV8 A;  2W6B A;  2GM4 A;  1RF1 C;  1BCC D;  2Y9Y A;  1LTJ A;  2BEQ D;  3V2N A;  1VQL P;  3FXD A;  1IFJ A;  2UWJ E;  3M06 A;  1ULJ A;  1GZL A;  3AE6 C;  2JDI H;  1FQT A;  1HWT C;  1MZ9 A;  3L71 E;  1SQV E;  5AVV B;  1EZV I;  3KDP B;  2OTL P;  1KYO H;  3BAS A;  2XDJ A;  3CCL P;  1FC2 C;  2IZ0 A;  2FXM A;  5CHX A;  2IBZ G;  5B66 H;  1WQL A;  2AEF A;  2FYZ A;  2IFM A;  3IF4 A;  2YFI A;  3A3Y B;  2HR3 A;  3D71 A;  3W67 A;  1KB9 I;  5KJ7 D;  2E76 D;  1OVU A;  2E5Y A;  4H13 C;  2KZJ A;  1BE3 D;  1VDF A;  2E42 A;  3AEC C;  1L0N G;  2Z5H A;  3H1J J;  1KIL B;  5APT A;  1PP9 D;  1RF0 C;  3TK1 A;  4NB9 D;  2JJL A;  2FKW B;  3L72 E;  3HUS B;  4PV1 C;  3HTK B;  1FZC B;  2AXC A;  1NU1 G;  2O01 J;  1X79 B;  2Z4E A;  1L4A B;  3RK3 D;  2CK3 H;  1FOS E;  1UIX A;  2R3C A;  3T97 A;  1HUC A;  4NBG D;  1JY2 O;  5BU5 A;  2BMO A;  2IZ1 A;  1IFP A;  2XNX A;  1Y9B A;  2FYU G;  3KPE A;  1EDL A;  4HM8 A;  3WU2 H;  2O01 N;  1BGY G;  1AVY A;  3CXH D;  4IL6 X;  3B5N B;  3CX5 D;  1N73 A;  1PGJ A;  3VP8 A;  3C1L A;  2FYN C;  3BRV B;  3NFQ A;  5KLV D;  3PLN A;  1QEX A;  2E75 B;  3VP9 A;  4D6T G;  1JO5 A;  2FFD A;  3MGN A;  4GIF A;  3VYI A;  1KIL E;  3L73 E;  1FE6 A;  1EZV G;  3S1K A;  1BDD A;  2NPS B;  1N8R Q;  1SQX E;  4OGQ C;  2HG5 D;  5DJT B;  1SQP J;  5GTH H;  2N1T B;  1FZE A;  3AE9 C;  1URQ B;  2ZYL A;  1K8A Q;  1WMK A;  3EFF K;  4L73 A;  3AE8 C;  3F5H A;  2KLV A;  1KYO E;  3RL0 D;  3KQG A;  2I7F A;  2KSJ A;  5B66 E;  1PV3 A;  1LWU B;  1M90 Q;  4HKZ H;  3H1L E;  1M1J C;  2I8D A;  1SQB E;  2WPQ A;  3IAO A;  2XU6 A;  2OYI A;  2A45 H;  3IR9 A;  5TJH A;  2WSS H;  1EDJ A;  2Y0D A;  1K05 A;  1VQO P;  1Q90 C;  4GKG A;  3RK3 B;  1D7M A;  3GHG B;  2NVE A;  3CC4 P;  3LW5 H;  5AVW B;  4HM4 A;  3L71 G;  5KLV K;  1SQV G;  2YXQ B;  1DD4 A;  3MIW A;  1FZA A;  2N9Y B;  3H1H E;  1E79 H;  1VQP P;  3AE1 C;  1L0L G;  1CZQ A;  1WT6 A;  1T3U A;  3O6Q A;  2HMK A;  3M9H A;  2KOG A;  1AA0 A;  4N78 E;  4M3L A;  1JMM A;  4ASW A;  1VQ4 P;  1Q90 D;  3WU2 E;  1J1E C;  1KYO I;  1SFC C;  1GL2 C;  3E7K A;  2NWF A;  2RN0 A;  4EI2 A;  3AEB C;  1GK4 A;  1O7P A;  2IBZ D;  1N7L A;  3N0Q A;  4H44 C;  2R44 A;  2JO1 A;  3P8C E;  1BSH A;  1T3J A;  1SS1 A;  2Q7C A;  4JPZ B;  3RL0 B;  2D2C C;  3H1I E;  1NOH A;  2I1K A;  5AVR B;  5GTH E;  2C0X A;  1NJI Q;  1SFC D;  2XKM A;  1L0N D;  2LR2 A;  5EFW B;  1BSN A;  4HM7 A;  2E4Q A;  1FBM A;  2KS1 A;  2WTY A;  2DE7 D;  4PD4 I;  4Y99 C;  1NAY A;  5KKZ B;  4D6T J;  2R5D A;  1LT9 B;  2QM8 A;  1NU1 D;  1N7S A;  4W80 A;  2QJP B;  3B4S A;  1JTH A;  4C7N B;  2D2C D;  2HOD B;  2ZXX A;  3I5C A;  3CME P;  2WVR A;  2C9L Y;  2FBW C;  2FYU D;  5APS A;  2ZJS E;  1BGY D;  4OVN F;  2WPR A;  1QLE D;  4WWI A;  2XND H;  4EOT A;  1OFC X;  3N7N A;  3CCS P;  1W5C E;  3F89 A;  3AE5 C;  2KI7 B;  2DE5 D;  1P84 H;  4I1L A;  1JUN A;  2XV5 A;  3MD0 A;  2E74 D;  3VCP A;  1H89 A;  4TLF A;  4WY4 C;  2ZYG A;  2Y0C A;  5KJ7 A;  2IFN A;  2ZVO B;  1YI2 P;  1XTG B;  1LTJ B;  1SQB G;  1L0N K;  2YO3 A;  3HE4 A;  2HYN A;  3L4F A;  3GW6 A;  1SQQ K;  4DZO A;  3CLQ A;  3L71 J;  2FXO A;  1SQV J;  4NBE D;  1AV1 A;  3OW2 O;  3LID A;  1UUW A;  3V4W A;  1S1C X;  1NU1 K;  1KB9 D;  4IFF A;  1FS0 E;  5CCG C;  1PL5 A;  1FAV A;  4HJL A;  2RKL A;  4L75 A;  2OYH A;  3OJA B;  1N86 A;  2YO2 A;  3BAT A;  4AYC A;  4I7Z C;  1X0T A;  3Q5S A;  1JY2 P;  3JCU H;  3H6P A;  2WSF J;  4IFD K;  2K1A A;  1RF0 A;  2KSE A;  4ZNC A;  1XTC C;  3AE3 C;  4NPE A;  2BCC E;  1VQM P;  1FZG A;  1PPJ E;  2KZI A;  1FDO A;  1GD2 E;  4JYC A;  3TF5 A;  1AFO A;  5B5E H;  3G71 P;  2WMM A;  3GMA A;  3L72 J;  3GF3 A;  4R4M A;  1L0L D;  5CBO A;  4P1B H;  1EG9 A;  3L70 E;  2JWA A;  4R4L A;  3R2P A;  1FJK A;  3T97 B;  2ITA A;  4UB8 H;  1SQQ E;  4XFJ A;  5AVZ B;  1NKN A;  3RK2 B;  3B71 A;  2BAS A;  4IL6 E;  3H1I G;  1GU4 A;  2ZFC A;  2Q9I A;  1N73 B;  3MUD A;  2V7Q J;  3CI9 A;  1VPC A;  2H89 C;  1P84 E;  3BCC D;  1VQ6 P;  5APX A;  1USE A;  1IO4 A;  1GMJ A;  1VQK P;  2WWW A;  2ZT9 B;  3L73 J;  1VF5 C;  3KHU A;  1OXZ A;  1NTK K;  2WSC H;  3FOU A;  4BWN A;  1IZN B;  2P67 A;  2CPB A;  3PP5 A;  1SQX J;  1NHL A;  2K37 A;  2QJY B;  5AW3 B;  1NTZ D;  3CWB D;  2PP6 A;  4JF7 A;  2H88 C;  3VMH D;  1KFM A;  1W2B O;  4QUQ A;  2H43 A;  1EXI A;  2FY8 A;  1M1J A;  2QSI A;  1L0L K;  4H0L D;  4LLH A;  2YFJ A;  3SFD C;  4BRY A;  1S5L H;  3VTP C;  2A06 D;  1VQ7 P;  3H1L J;  4JQ0 D;  4B86 A;  1SQB J;  5APW A;  2OYI B;  1JMB A;  2XSH A;  1IK7 A;  1JY3 O;  3FGA D;  3JCU E;  3G4S P;  1O7N A;  3DQY A;  3RGU A;  5KAF H;  1KQF B;  2ZYA A;  3G9R A;  1N7S D;  1GU5 A;  1JM0 A; 
#chains in the Genus database with same CATH homology
 2IBZ E;  1ZRT E;  5BOK A;  5KLI C;  1SQX E;  2E74 D;  2NWF A;  3VCP A;  1VF5 D;  1SQQ E;  5CXM A;  1VM9 A;  1G8J B;  1WQL A;  3H1K E;  2ZT9 D;  1O7W A;  4PV1 D;  1O7P A;  1UUV A;  4D6T E;  1BE3 E;  2YFI A;  3BCC E;  1SJG A;  2ZYL A;  1NTM E;  3EN1 A;  4QDF B;  3N0Q A;  2GBW A;  1O7H A;  2E4P A;  3GL2 A;  1EZV E;  3GTE A;  4NBF D;  3TGU E;  1NYK A;  3GZY A;  2E76 D;  1KYO E;  1PP9 E;  1KB9 E;  2CKF A;  1P84 E;  1L0N E;  4NBE D;  2DE6 D;  1RFS A;  5HL4 A;  4U3F E;  3H1I E;  2I7F A;  3GOB A;  5AEW A;  1UUW A;  4NBH D;  4HM0 A;  3GCE A;  3H1L E;  2NUK A;  3L74 E;  2HMN A;  1NTZ E;  2XRX A;  2HMO A;  4QUP A;  3CWB E;  2HML A;  2YVJ B;  4NB9 D;  1SQB E;  2NVG A;  3FOU A;  2GBX A;  3L72 E;  4NBA D;  4HJL A;  4HM6 A;  2NVF A;  4HM7 A;  4NBD D;  2E4Q A;  1NU1 E;  4NBC D;  2DE7 D;  1NTK E;  4HM1 A;  1JM1 A;  1Q90 C;  4PD4 E;  2XSO A;  3D89 A;  4HM3 A;  3VMH D;  2B24 A;  2JZA A;  2JO6 A;  4NBB D;  2XR8 A;  4NB8 D;  3EQQ A;  4QUQ A;  4AAY B;  2NVE A;  3CXH E;  2E75 D;  4NBG D;  4HM5 A;  4P1C H;  1BCC E;  2BMO A;  3CX5 E;  2YIU C;  2FYU E;  2A06 E;  3VCA A;  4HM4 A;  3VMG D;  2NUM A;  5AEU A;  3GZX A;  2HMJ A;  3GTS A;  1BGY E;  1SQP E;  1RIE A;  4H0L D;  4HM8 A;  2D2C D;  2BCC E;  1ULI A;  2YFJ A;  1PPJ E;  2HMM A;  5KLV E;  1O7G A;  4OGQ D;  4HM2 A;  4QCK A;  1O7M A;  4QDF A;  1L0L E;  3H1H E;  4EMJ B;  1NDO A;  3GB4 A;  2QJY C;  2B1X A;  3GKE A;  2BMQ A;  2XSH A;  2FYN C;  2BMR A;  1ULJ A;  2QPZ A;  2HMK A;  4H44 D;  4QDD A;  1FQT A;  5KKZ C;  2QJK C;  3L71 E;  3L75 E;  1O7N A;  1SQV E;  3C0D A;  3AZC A;  4P1B H;  3DQY A;  2YFL A;  4QDC A;  4HKV A;  1EG9 A;  3H1J E;  3L70 E;  2QJP C;  1VCK A;  4H13 D;  4AIV A;  3L73 E;  2Q3W A;  4QUR A;  3VMI D;  3GL0 A;  2DE5 D;  1G8K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...