3L74E

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 48
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l74E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l74E02
1SQVE 1SQBE 1UUVA 4NBBD 3EN1A 3L71E 4HM8A 4NBFD 2E76D 2BMRA 4OGQD 1VM9A 1O7HA 4HKVA 1WQLA 2CKFA 2YFIA 1BE3E 2XRXA 3FOUA 4P1CH 1Q90C 2B1XA 4QUPA 4EMJB 4QDFA 2GBWA 4HM2A 4HJLA 2IBZE 1VCKA 4NBDD 2GBXA 1SJGA 3H1IE 2HMNA 4D6TE 1VF5D 2Q3WA 2JZAA 3C0DA 3N0QA 1NTKE 1KB9E 5BOKA 4NB8D 2D2CD 2BMOA 2XSOA 1SQQE 3GB4A 5CXMA 1UUWA 1L0LE 2NVEA 3VMHD 3L72E 2ZYLA 1RFSA 2E75D 4PV1D 5KKZC 3H1HE 1ZRTE 3VCAA 2NUMA 2YFLA 4HM3A 3H1KE 2JO6A 5AEUA 2E4PA 1NTME 2DE5D 2NWFA 3GZXA 1P84E 1G8KB 2QJPC 4P1BH 1JM1A 2HMJA 2BMQA 4HM1A 4NBED 4QDFB 3DQYA 4HM5A 1BCCE 1SQXE 3GOBA 3TGUE 2A06E 3VMID 1NTZE 3D89A 2E74D 2XSHA 1PPJE 3GZYA 1O7GA 3VCPA 4NBHD 4NB9D 1G8JB 1ULIA 4H0LD 1O7WA 1L0NE 2ZT9D 4QDCA 3VMGD 3BCCE 5AEWA 3L73E 3GL2A 3GTSA 4H13D 3L75E 2B24A 4QURA 3GL0A 5KLIC 4QUQA 4HM4A 2QJYC 2DE7D 4HM6A 4U3FE 2HMLA 2BCCE 2FYNC 1FQTA 1NYKA 4NBCD 3CWBE 2YIUC 2NVFA 2HMOA 1ULJA 2E4QA 1NU1E 1SQPE 3EQQA 3H1JE 3H1LE 2QPZA 1KYOE 2YVJB 2DE6D 4HM0A 1EZVE 2NUKA 2XR8A 2FYUE 5HL4A 3GTEA 2YFJA 1NDOA 3CX5E 4QCKA 4QDDA 2HMMA 1O7MA 2I7FA 3AZCA 2QJKC 4AIVA 4NBGD 3L70E 2NVGA 4NBAD 1BGYE 3GCEA 1O7NA 3CXHE 4PD4E 4HM7A 4H44D 5KLVE 1EG9A 4AAYB 1O7PA 1RIEA 1PP9E 3GKEA 2HMKA 3L74E
chains in the Genus database with same CATH superfamily
1SQXG 4KJMA 4HH2A 4KHXA 1WQLA 4JPZB 1FDOA 5AVTB 3O6QB 5AW5B 4QUPA 4EMJB 4QDFA 2ZXXA 4RJTA 1VCKA 4MN4C 3HE4A 2AEFA 3CC7P 5AVVB 3AE6C 2Y9YA 2Q3WA 1M7LA 1NTKE 2ZVOB 3GB4A 2POHA 4Z1MH 1L0LE 2J5UA 3H1HE 1MUUA 1AV1A 1W2BO 5KJ7D 4UB8H 2PP6A 1EDIA 1BCCE 3L75G 1X22A 1BGYG 1L4AB 3CCLP 1KILA 2XV5A 1JCDA 3HUSA 1JTHB 1KILE 2MKVA 4H0LD 1Q81Q 2OTKE 5TISH 1PFIA 1H8AA 2BCCD 2E76C 1VQ8P 2P58A 1NTKG 4GOEA 1RH5B 2E43A 2QJKB 5B66E 1PGPA 1ZN5A 2YIUC 2NVFA 1G2CA 3II6A 4WVZA 4YXDC 2OYIB 2K1AA 5BU5A 4NPFX 2DE6D 2PAJA 4A7PA 2CPSA 1ZV8A 3T97B 5E79H 1VQ6P 1NKNA 1PGQA 1DIPA 5H2FE 1RF1A 4NBGD 2Q9IA 3G6EP 4H13B 4WBAA 3KQGA 1PP9E 1SQBJ 1SQXD 2E76D 1BE3D 2D2CC 1SQXJ 3RL0g 3AE4C 1IFPA 4PD4H 5CCHC 1MZ9A 5CCGC 1JMBA 4C7NB 3D70A 2Q1KA 2A06G 1SQQG 1YTZI 3PRJA 1XTCC 1YIJP 2E75B 2XU6A 2AEMA 1SQXK 2N1TD 1P84H 3ITKA 3OJAB 1NU1J 1R5SA 2E4PA 2P2UA 1NAYA 1FJPA 1JY3P 3NXSA 3P8MC 2ZYGA 3GZYA 1S3JA 2OTLP 2A45G 1NTZK 2BCCG 2JEEA 4CPGA 1VL2A 2DE7D 3AE2C 4D6TD 3PP5A 3R4YA 1NWQA 4GKGA 4JYCA 2P7JA 2WT7A 3WMM0 3USSA 4HM0A 3RK3C 5HL4A 1KFMA 3L71G 4AQRD 1AA0A 1RE4A 3AZCA 3HRNA 3CX5I 2JO1A 3IFMA 2C9LY 2A45I 4YXWH 1SQVK 1VDFA 2FBWC 2FYUG 3GHGC 1W2EA 2KS1A 4NBFD 2IPPA 1NAFA 3I55P 3FGAD 2WSFJ 5CCHA 3A0HE 1XTGB 2FYZA 1IJDB 1GDTA 2H89C 1FZFA 1GU4A 1UUWA 2KXPB 1NJIQ 2E5YA 1NGMB 5KKZC 1YITP 2YMKA 1FDIA 2FYUK 3H1KE 3M9QA 3RL0C 2K88A 1LTJA 4PV1C 1Z56A 1KYOI 1FE6A 3DQYA 1JEKA 2ZFCA 3L72D 1T3JA 2GUSA 2E74B 3L75D 3VMYA 2WZ7A 3B5NA 3OA7A 1JNMA 4QUQA 1JOCA 1HGZA 3FXEA 2FFDC 3AEDC 2N9BA 2C0WA 1M1JA 1USEA 1RY3A 2JP3A 4QCKA 4JF7A 1YHQP 2WMMA 5CJ0A 2Z4EA 1NTZG 1ZMEC 1FZGA 1MV8A 3U59A 1SQBE 1LTSC 1BGYD 1BGYJ 2FXPA 2CKFA 1LTBC 1Q90C 5CHXA 2GBWA 1IFIA 2GBXA 1NU1D 3V6IA 5AW3B 1FDMA 2XNDH 1PPJD 4BRYA 3V4WA 4K35A 5APXA 2D2CD 2BMOA 3TF5A 3M0DC 5CCGA 1LT9B 1VQ7P 3L72E 4UB6E 2B89A 1AVYA 2WT7B 2YFLA 4HM3A 5B5EH 3L74J 1A02F 2WPVB 3VP8A 4LC1A 1NTME 4O9BA 2W27A 1LWUA 1X0TA 1Q82Q 2W83C 1FC2C 3A0BE 4OVNF 4AYCA 1IK7A 2O3JA 3H6PA 2XSHA 1PPJE 3SWFA 1U7JA 1H0TA 1SQBD 1ULIA 1KILB 2IBZI 4I7ZB 3IR9A 5KTBA 2HPCA 3GTSA 3G3ZA 1ZP0C 4IFFA 1Y9BA 2ZJSE 3G9RA 3KZIH 1IO4A 4HM6A 3WUVA 2HG5D 2OYHC 1OZHA 1GL2D 2E4QA 2YKQA 2ZT9C 1EDJA 1LWUC 2OGUA 1VQLP 3CMEP 4BXLA 2UWJE 5AW2B 5CBNA 1AQ5A 1KMIZ 1RE3A 2YO2A 1OMIA 4NBAD 1O7NA 2NPSA 3L71D 4H44D 5M1BA 4EI2A 1VQ9P 1X79B 1M1KQ 3H1KJ 5AVZB 1LTGC 4GT1A 2WSEJ 3B71A 5APQA 3L71E 3Q2YA 3L70J 1J1EB 3L37A 1H89A 1D7MA 1H88A 4NBDD 3CPWO 3H1JJ 1SQPJ 3D6YA 3MD0A 1VQ4P 1U57A 4WY4C 4NB8D 2IZ0A 1Y47A 4DOJA 3PTZA 1NTMG 1SQPK 2WSCH 5C39A 4D6TJ 3VCAA 3MZWB 1NTKD 2GUVA 3AE5C 1P84I 1M1JC 2O01J 4P1BH 3CLQA 1ZOYC 3V2RA 4NPDA 3H32A 3MUDA 3WU2E 1J1EC 2XDJA 3VCPA 3A0BH 1S4XA 1KORA 1L0NK 2R5DA 3GL2A 4H13D 2J59M 4KT0J 2A45H 3TGUJ 1QVGO 1JM0A 1QEXA 5APVA 4JQ0D 1RF1C 3CCUP 2QJPB 3V4QA 3EQQA 2W6AA 5AW6B 3SFEC 1FZCB 2FYUE 1PZQA 2YXRB 1CI6A 4QDDA 2QJKC 2N9YB 2K37A 3HD7B 1EG9A 1GL2A 2O1KA 2QJYB 1N7SA 2E76B 1EZVG 3WU2H 1HUCA 2NZ2A 1J2JB 4WY4A 2RKLA 3MHVA 3Q1MA 3L35A 1OVRA 3G71P 3SWKA 2B87A 3B5ND 2WSFH 3H1LJ 1N7SC 3C0DA 1SQQE 2OYOA 2KYVA 2W6JH 3P8CE 5TISE 4IL6H 3EFFK 1GK6A 1NTMJ 4D6TG 3CX5H 1T3UA 3HE5B 3L70D 2IBZD 1R5LA 4DT0A 1KYOH 3TGUE 1SLQA 1LTJB 3Q5SA 2H8PD 3BCCD 1M57D 1K8AQ 1N73A 3NTNA 2Y9ZA 4GIFA 4N6JA 2V4HA 1FOSF 3ZDMA 2OQQA 1L0NJ 2L91A 3SWYA 1L0LG 3CI9A 3L73E 5AVQB 3AECC 2YNYA 1MFTA 3PHLA 3PLNA 2N1TA 2M0BA 1L0NG 3AE3C 2HMOA 3BVHA 3D71A 1VF5B 3H1JE 1NVOA 2G3AA 1OVUA 4DZOA 3OAKA 3P8CD 3BATA 1QGKB 1DEEG 1FS0E 1LTTC 3CXHH 1HTLC 1KYOD 1SQBK 2LKMA 4OH8B 3EN1A 2R32A 1IZNB 2NRGA 1U7MA 2P10A 1T2KC 4P1CH 1E79H 3H1HG 1N86A 3RK3B 4RO0A 5EFWB 3EFGA 1NHLA 1OX3A 2M3EA 5BU8B 1K04A 2H43A 1SFCD 4PV1D 3AEBC 5BVZA 1KILC 4LLHA 4U3FG 5AW7B 1SQXE 2IDBA 3IN6A 2E74D 1G8JB 1FZEA 3V2QA 1QL2A 5KLVJ 1LP1A 5CBOA 3H25A 3KHUA 3AE9C 2B24A 1KD1Q 1URQC 4WB4A 4R4MA 2AXTH 3MGNA 2JJLA 2KUBA 1VQKP 1SQPD 1JB0J 2RMZA 4R4LA 1YI2P 3FX0A 1BGYE 3AEGC 3CXHE 4PD4E 2OYIA 1Q2NA 2E42A 3HE5A 4RKUJ 1RIEA 4I1LA 3B4SA 1PL5A 2HODB 3A5TA 4IL6X 4OGQD 3CCEP 1BCCJ 4PD4I 3A7OA 3LIEA 2KNCA 3RK3D 1WT6A 1SQBG 1HBWA 3H1IE 1NU1K 3A0HH 3SSUA 1X9VA 3P32A 3LW5H 5L8RJ 4I7ZC 4L74A 1SVFA 1WRGA 3L71J 1ZRTE 2C9NY 2FYNB 1ZLLA 3GZXA 4BWNA 2LR2A 1S72P 2HMJA 2BMQA 1URQA 4JYBA 3TDKA 2A06E 1W5CE 1O7GA 1JCCA 3V2NA 1LTAC 3E1IA 2WPQA 1HJBA 4QDCA 1S2EA 3VMGD 5AEWA 5AVSB 3RK3E 1AQTA 4DCKA 1L0LD 1NO4A 2FYUJ 3BASA 2HMLA 3O6QA 2IFNA 1A02J 1RQUA 3HD7C 2K3RA 1KYOE 1BDDA 2HLOA 4I6MC 3CX5E 3TNUB 3QH9A 3SFDC 4H13C 2IBZG 1NTMD 1DD4A 1IFMA 1YQ3C 2J58A 3HD7A 1N7SB 1OVVA 1KTMA 3CCRP 1VM9A 1RE3C 2XRXA 2P1JA 1SQVJ 1NTZD 2BEQD 1S1CX 4HJLA 1KILD 1KN7A 1K05A 2M8RA 1SS1A 2OTJP 4D6TE 3N0QA 2Z5HA 1K9MQ 1Q86Q 2XSOA 3QWOC 3M0AA 2IYOA 1NU1G 5B5EE 4L75A 4NBED 4QDFB 3H1HJ 2KZIA 1UIXA 4B86A 4IFMA 2N1TC 3CC4P 2HODA 2PGDA 1RF1B 3HTKA 2ZT9D 1OW8A 1JY2O 1EZVD 2ZT9B 4ASVA 2FFDB 3VMZA 3KXDA 3CWBG 5KLIC 3WUUA 1GTWA 4U3FE 2KSJA 3M9BA 4NBCD 1CSBA 4XA4A 3RBZA 2FXOA 1OXZA 2VRSA 4C7NA 3B5NB 5KLVK 1J1DB 1KV4A 4OWFA 2KIKA 2K9JA 1NTMK 1SQPG 1NDOA 1EXJA 1KB9I 2OYHA 3HD7D 4EIJA 2CK3H 3AE1C 3CCVP 2IX7C 2HMKA 1UUVA 3L70G 4K3AA 1URQB 3CXHD 2ZVNB 2M5AA 1BE3E 1G2CB 3Q3DA 4N78D 3CCSP 3Q5RA 2IYPA 4RESB 2ZYAA 4Y99C 5AW0B 4HYTB 5BOKA 3L4FA 1IFNA 3WUTA 4TLFA 4HKZH 1N8RQ 2JO6A 4DJGA 4LGDE 4GDOA 3TNUA 1PPJG 1LT9A 1SQQD 2QA4P 3UIAA 2V7QH 2SPZA 1USDA 1ZR4A 2JWDA 2WQYC 1S9KD 1S5LE 1NYHA 3GHGA 3TGUG 4QURA 4OGQC 3NFQA 5APSA 2QM8A 2QSIA 5APWA 2WSCJ 1SQQK 1M8OB 4XE5B 3L73G 4GOFA 3H1HD 1EZVE 5APTA 1EDKA 2ZYDA 2I7FA 4I2LC 2Q3IA 1YJ9P 2R44A 4UB6H 1OFCX 1SFCB 1Q90D 3HE4B 1GZLA 1FZCC 3A3YB 2BASA 3CX5D 5B66H 2C0XA 1AJYA 2K9YA 1KB9H 2MJZA 3HTKB 1M56D 3H1IJ 2B9BA 2I1KA 3MP7B 4YPCA 2KNCB 2E74C 5KAFE 3PJSK 2BCCJ 2ZAEB 2KI7B 3CCJP 1RF0C 1HVVA 1NOHA 2NVEA 3L72J 2ZYLA 3S4RA 1L4AA 2NUMA 1PP9J 3HUSB 4M3LA 1R8EA 1P84E 2K9JB 2QJPC 4HM1A 1X8YA 4Y99B 4L76A 3TK1A 3ABVC 5KJ7C 4NBHD 2H88C 1L0NE 3RBXA 1ZRTD 2QVAA 3AEEC 2QJYC 2Y0DA 2IFMA 3L73J 2BEZF 2BCCE 1EXIA 3V5BA 2KLUA 1HGVA 3NMDA 3RL0B 4IFDK 2KP8A 3B5NC 3W67A 5AW8B 1IC2A 2G8YA 4PV1B 4BRYB 4ZKUA 5E79E 1P84D 2JR8A 5KLVE 1GW3A 4AAYB 2QIWA 3H1KD 3GKEA 2R3SA 5CMZA 1KQFB 2GM4A 3F5HA 4C46A 1CI6B 1LWUB 2KOGA 2B1XA 1NTZJ 2NPSC 4HM2A 2KZJA 1HWTC 1FBMA 2YMYA 1ZR2A 4NPEA 1J1DC 3RL0D 3GHGB 1Q7YQ 2XZRA 1BSHA 3EWKA 1KQGB 1AVOA 1RF0A 3VMHD 4W7ZA 1RFSA 4EOTA 2B87B 1NKZB 1IFJA 3W68A 2P67A 5AVRB 1JY2P 3H1LG 5AEUA 3TYYA 1M90Q 3KDPB 1VQOP 2HFED 3E1RA 2QRXA 3GMAA 1UIIA 2KLVA 2H7HA 1SQVD 5KLVG 1VF5C 4NB9D 1L4AD 4H44C 2FXMA 4IL6E 1HJ0A 2FKWB 2E75C 3D6ZA 5APYA 3TSIA 3GL0A 2B88A 1JUNA 1N73B 1HF9A 3S1KA 2FFDA 2PFXA 1YBKA 2YO3A 1LJ2A 1FZAA 3F89A 2D2CB 1H0TB 3A2AA 4EDFA 2W6BA 1BE3G 3GF3A 4PD4D 2KB7P 3C8VA 1FU1A 2OYHB 4QMAA 2HPCB 1L0ND 5CCHD 2ITAA 2JWAA 1SQVE 4OGQB 4N3YB 4NBBD 4WWIA 3S9OA 5H2FH 4ASWA 3RK2B 4ZKPA 1G1JA 1N2DC 2Z5IA 2OYIC 2M5AB 1KQSO 1L2PA 3EQ2A 3H32B 1SJGA 1OIPA 2YXQB 3H1ID 1MKMA 4GODA 3N4XA 1S5LH 1BDCA 3CD6P 3JCUH 3L73D 1KQLA 1OW6A 3H1JG 1KZUB 3H1LD 3M91A 2O01H 1ZXGA 1MFZA 3CCMP 1S5LX 3CWBJ 1NTZE 1JY3O 3GLMA 1ZW0A 2O1JA 3CL3D 4H44B 5KLVD 4UB8E 5AW4B 3CCQP 5KKZB 2DW3A 2Q3EA 2E5TA 1FOSE 1RQVA 3M06A 1KC8Q 1EDLA 2QEXP 4TT3H 4U3FD 1LTJC 2R3CA 4N78E 2Y0EA 2PRRA 2M3BA 4ZNCA 4HM4A 1T8ZA 1N73C 2FY8A 1N7LA 4HJGH 1NYKA 5AW9B 1T6AA 2LXBA 4H0LC 1GW4A 2NUKA 3U1CA 1OWAA 1RHZB 3C9IA 2JKVA 2O01N 1PP9G 2YKOA 2NVGA 1PIXA 4HM7A 3VYIA 1N7SD 3FXDA 3JC22 3L74E 2XKMA 4HM8A 1SFCA 5DJTB 2BMRA 5TJHA 4JBZA 3N7NA 3H1KG 3FOUA 2WSEH 2WPRA 4YTPC 4C7RA 1CW5A 3L74G 1QL1A 5APUA 3KZIE 1QX8A 1VF5D 3VN0A 1FAVA 1VQPP 2HR3A 1IFDA 5KJ7A 2E75D 1HH0A 4XFJA 1NTKJ 1GK4A 2AXCA 3H1JD 1PGOA 2DE5D 2N1TB 4WY4B 5CCGD 1G8KB 1GMJA 2WITA 1LT9C 4WY4D 1YQ4C 2KK7A 3M0DA 1JTHA 1NH4A 5GTIE 1DH3A 2Q7CA 3JSVC 1O7WA 1K73Q 1GD2E 1WMKA 1VQ5P 4AUWA 4HB1A 1G1IA 2LXCB 2JDIH 2V7QJ 1VQNP 2AXTE 3KYQA 1FQTA 1YJNP 1EC5A 3BCCG 2NPSB 3GF7A 3O8ZA 2Q6QA 3T97A 5AVUB 2XR8A 2NPSD 1DX7A 4U3FJ 3CWBD 5KAIH 2WTYA 1NTKK 3LIDA 2RH0A 1O7MA 1RE4C 4Y28J 5KAIE 2HYNA 3GCEA 1GL2C 1URQD 1FJKA 3IAOA 1BCCG 1SFCC 4HKVA 2WWWA 1KFNA 3CMAP 2KSEA 3IF4A 2WPSA 1L0LK 1DD3A 3LW5J 3JCUE 3L74D 4PJ0E 1VQMP 2ZXEB 3RGUA 2JZAA 1KB9E 1QLED 2QG4A 3VMXA 3VOPA 2FYUD 1KB9D 3C1LA 1SP4A 1L4AC 1PV3A 1YJWP 3KPEA 1JM1A 5K5GB 3AEAC 3GOBA 3CXHI 3HUSC 1LTIC 3VMAA 2CPBA 3K5BA 4EYYQ 1YYCA 5AVXB 4U7JA 1EQ7A 1JY2N 3MTUE 3BCCE 2Q5UA 3L75E 1BSNA 1FZCA 5GTHH 1L0LJ 3BRTB 3H1IG 2FYNC 1IK9A 3AEFC 4IOIH 3CWBE 1NU1E 3BRVB 1GL2B 1JY3N 3H1LE 3RK2C 4W7YA 3GTEA 3L72G 2YFJA 2RN0A 3FWLA 2HMMA 4L73A 1LP1B 3Q5PA 1VPCA 1LNQA 2QM7A 3VP9A 1OW7A 3AE7C 2KS1B 2I8DA 1PP9D 2R5BA 3G4SP 5AW1B 1AFOA 3AE8C 1BCCD 1DEBA 5CJ4A 1O7HA 3GW6A 2YFIA 1E5WA 4PJ0H 2A06D 3BCCJ 5KAFH 1S9KE 1JO5A 2WVRA 1JMMA 2IBZE 3L75J 1EZVI 2AEJA 1SQVG 2L5GB 2HMNA 1FZBA 2W8ZA 3OW2O 5CXMA 3MUDC 3CC2P 5AVYB 1Y8AA 2IZ1A 3U1AA 2NWFA 1TU3F 2XNXA 2Y0CA 2QE7H 3B8EB 5GTIH 5DJUB 3M9HA 4HM5A 2YKPA 3VMID 2W90A 3D89A 1PGJA 3P7KA 3L36A 2GA1A 3R2PA 3FWNA 1LGHB 4H0LB 4ZMDA 3MIWA 1GU5A 3GG2A 1BE3J 1T2KD 3RK2D 3VTPC 1M1JB 4W80A 1ULJA 5GTHE 3E7KA 2OARA 1SQPE 2QPZA 2YVJB 3I5CA 2I1JA 3TGUD 1SQQJ 1QVFO 5KLIB 2WSSH 4AIVA 3L70E 3I56P 5AVWB 1CZQA 1O7PA 3PH0A 3V2PA 1YTZT 2YIUB 1LT1A
chains in the Genus database with same CATH topology
1SQVE 1SQBE 1UUVA 4NBBD 3EN1A 3L71E 4HM8A 4NBFD 2E76D 2BMRA 4OGQD 1VM9A 1O7HA 4HKVA 1WQLA 2CKFA 2YFIA 1BE3E 2XRXA 3FOUA 4P1CH 1Q90C 2B1XA 4QUPA 4EMJB 4QDFA 2GBWA 4HM2A 4HJLA 2IBZE 1VCKA 4NBDD 2GBXA 1SJGA 3H1IE 2HMNA 4D6TE 1VF5D 2Q3WA 2JZAA 3C0DA 3N0QA 1NTKE 1KB9E 5BOKA 4NB8D 2D2CD 2BMOA 2XSOA 1SQQE 3GB4A 5CXMA 1UUWA 1L0LE 2NVEA 3VMHD 3L72E 2ZYLA 1RFSA 2E75D 4PV1D 5KKZC 3H1HE 1ZRTE 3VCAA 2NUMA 2YFLA 4HM3A 3H1KE 2JO6A 5AEUA 2E4PA 1NTME 2DE5D 2NWFA 3GZXA 1P84E 1G8KB 2QJPC 4P1BH 1JM1A 2HMJA 2BMQA 4HM1A 4NBED 4QDFB 3DQYA 4HM5A 1BCCE 1SQXE 3GOBA 3TGUE 2A06E 3VMID 1NTZE 3D89A 2E74D 2XSHA 1PPJE 3GZYA 1O7GA 3VCPA 4NBHD 4NB9D 1G8JB 1ULIA 4H0LD 1O7WA 1L0NE 2ZT9D 4QDCA 3VMGD 3BCCE 5AEWA 3L73E 3GL2A 3GTSA 4H13D 3L75E 2B24A 4QURA 3GL0A 5KLIC 4QUQA 4HM4A 2QJYC 2DE7D 4HM6A 4U3FE 2HMLA 2BCCE 2FYNC 1FQTA 1NYKA 4NBCD 3CWBE 2YIUC 2NVFA 2HMOA 1ULJA 2E4QA 1NU1E 1SQPE 3EQQA 3H1JE 3H1LE 2QPZA 1KYOE 2YVJB 2DE6D 4HM0A 1EZVE 2NUKA 2XR8A 2FYUE 5HL4A 3GTEA 2YFJA 1NDOA 3CX5E 4QCKA 4QDDA 2HMMA 1O7MA 2I7FA 3AZCA 2QJKC 4AIVA 4NBGD 3L70E 2NVGA 4NBAD 1BGYE 3GCEA 1O7NA 3CXHE 4PD4E 4HM7A 4H44D 5KLVE 1EG9A 4AAYB 1O7PA 1RIEA 1PP9E 3GKEA 2HMKA 3L74E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV E;  1SQB E;  1UUV A;  4NBB D;  3EN1 A;  3L71 E;  4HM8 A;  4NBF D;  2E76 D;  2BMR A;  4OGQ D;  1VM9 A;  1O7H A;  4HKV A;  1WQL A;  2CKF A;  2YFI A;  1BE3 E;  2XRX A;  3FOU A;  4P1C H;  1Q90 C;  2B1X A;  4QUP A;  4EMJ B;  4QDF A;  2GBW A;  4HM2 A;  4HJL A;  2IBZ E;  1VCK A;  4NBD D;  2GBX A;  1SJG A;  3H1I E;  2HMN A;  4D6T E;  1VF5 D;  2Q3W A;  2JZA A;  3C0D A;  3N0Q A;  1NTK E;  1KB9 E;  5BOK A;  4NB8 D;  2D2C D;  2BMO A;  2XSO A;  1SQQ E;  3GB4 A;  5CXM A;  1UUW A;  1L0L E;  2NVE A;  3VMH D;  3L72 E;  2ZYL A;  1RFS A;  2E75 D;  4PV1 D;  5KKZ C;  3H1H E;  1ZRT E;  3VCA A;  2NUM A;  2YFL A;  4HM3 A;  3H1K E;  2JO6 A;  5AEU A;  2E4P A;  1NTM E;  2DE5 D;  2NWF A;  3GZX A;  1P84 E;  1G8K B;  2QJP C;  4P1B H;  1JM1 A;  2HMJ A;  2BMQ A;  4HM1 A;  4NBE D;  4QDF B;  3DQY A;  4HM5 A;  1BCC E;  1SQX E;  3GOB A;  3TGU E;  2A06 E;  3VMI D;  1NTZ E;  3D89 A;  2E74 D;  2XSH A;  1PPJ E;  3GZY A;  1O7G A;  3VCP A;  4NBH D;  4NB9 D;  1G8J B;  1ULI A;  4H0L D;  1O7W A;  1L0N E;  2ZT9 D;  4QDC A;  3VMG D;  3BCC E;  5AEW A;  3L73 E;  3GL2 A;  3GTS A;  4H13 D;  3L75 E;  2B24 A;  4QUR A;  3GL0 A;  5KLI C;  4QUQ A;  4HM4 A;  2QJY C;  2DE7 D;  4HM6 A;  4U3F E;  2HML A;  2BCC E;  2FYN C;  1FQT A;  1NYK A;  4NBC D;  3CWB E;  2YIU C;  2NVF A;  2HMO A;  1ULJ A;  2E4Q A;  1NU1 E;  1SQP E;  3EQQ A;  3H1J E;  3H1L E;  2QPZ A;  1KYO E;  2YVJ B;  2DE6 D;  4HM0 A;  1EZV E;  2NUK A;  2XR8 A;  2FYU E;  5HL4 A;  3GTE A;  2YFJ A;  1NDO A;  3CX5 E;  4QCK A;  4QDD A;  2HMM A;  1O7M A;  2I7F A;  3AZC A;  2QJK C;  4AIV A;  4NBG D;  3L70 E;  2NVG A;  4NBA D;  1BGY E;  3GCE A;  1O7N A;  3CXH E;  4PD4 E;  4HM7 A;  4H44 D;  5KLV E;  1EG9 A;  4AAY B;  1O7P A;  1RIE A;  1PP9 E;  3GKE A;  2HMK A;  3L74 E; 
#chains in the Genus database with same CATH topology
 1SQX G;  4KJM A;  4HH2 A;  4KHX A;  1WQL A;  4JPZ B;  1FDO A;  5AVT B;  3O6Q B;  5AW5 B;  4QUP A;  4EMJ B;  4QDF A;  2ZXX A;  4RJT A;  1VCK A;  4MN4 C;  3HE4 A;  2AEF A;  3CC7 P;  5AVV B;  3AE6 C;  2Y9Y A;  2Q3W A;  1M7L A;  1NTK E;  2ZVO B;  3GB4 A;  2POH A;  4Z1M H;  1L0L E;  2J5U A;  3H1H E;  1MUU A;  1AV1 A;  1W2B O;  5KJ7 D;  4UB8 H;  2PP6 A;  1EDI A;  1BCC E;  3L75 G;  1X22 A;  1BGY G;  1L4A B;  3CCL P;  1KIL A;  2XV5 A;  1JCD A;  3HUS A;  1JTH B;  1KIL E;  2MKV A;  4H0L D;  1Q81 Q;  2OTK E;  5TIS H;  1PFI A;  1H8A A;  2BCC D;  2E76 C;  1VQ8 P;  2P58 A;  1NTK G;  4GOE A;  1RH5 B;  2E43 A;  2QJK B;  5B66 E;  1PGP A;  1ZN5 A;  2YIU C;  2NVF A;  1G2C A;  3II6 A;  4WVZ A;  4YXD C;  2OYI B;  2K1A A;  5BU5 A;  4NPF X;  2DE6 D;  2PAJ A;  4A7P A;  2CPS A;  1ZV8 A;  3T97 B;  5E79 H;  1VQ6 P;  1NKN A;  1PGQ A;  1DIP A;  5H2F E;  1RF1 A;  4NBG D;  2Q9I A;  3G6E P;  4H13 B;  4WBA A;  3KQG A;  1PP9 E;  1SQB J;  1SQX D;  2E76 D;  1BE3 D;  2D2C C;  1SQX J;  3RL0 g;  3AE4 C;  1IFP A;  4PD4 H;  5CCH C;  1MZ9 A;  5CCG C;  1JMB A;  4C7N B;  3D70 A;  2Q1K A;  2A06 G;  1SQQ G;  1YTZ I;  3PRJ A;  1XTC C;  1YIJ P;  2E75 B;  2XU6 A;  2AEM A;  1SQX K;  2N1T D;  1P84 H;  3ITK A;  3OJA B;  1NU1 J;  1R5S A;  2E4P A;  2P2U A;  1NAY A;  1FJP A;  1JY3 P;  3NXS A;  3P8M C;  2ZYG A;  3GZY A;  1S3J A;  2OTL P;  2A45 G;  1NTZ K;  2BCC G;  2JEE A;  4CPG A;  1VL2 A;  2DE7 D;  3AE2 C;  4D6T D;  3PP5 A;  3R4Y A;  1NWQ A;  4GKG A;  4JYC A;  2P7J A;  2WT7 A;  3WMM 0;  3USS A;  4HM0 A;  3RK3 C;  5HL4 A;  1KFM A;  3L71 G;  4AQR D;  1AA0 A;  1RE4 A;  3AZC A;  3HRN A;  3CX5 I;  2JO1 A;  3IFM A;  2C9L Y;  2A45 I;  4YXW H;  1SQV K;  1VDF A;  2FBW C;  2FYU G;  3GHG C;  1W2E A;  2KS1 A;  4NBF D;  2IPP A;  1NAF A;  3I55 P;  3FGA D;  2WSF J;  5CCH A;  3A0H E;  1XTG B;  2FYZ A;  1IJD B;  1GDT A;  2H89 C;  1FZF A;  1GU4 A;  1UUW A;  2KXP B;  1NJI Q;  2E5Y A;  1NGM B;  5KKZ C;  1YIT P;  2YMK A;  1FDI A;  2FYU K;  3H1K E;  3M9Q A;  3RL0 C;  2K88 A;  1LTJ A;  4PV1 C;  1Z56 A;  1KYO I;  1FE6 A;  3DQY A;  1JEK A;  2ZFC A;  3L72 D;  1T3J A;  2GUS A;  2E74 B;  3L75 D;  3VMY A;  2WZ7 A;  3B5N A;  3OA7 A;  1JNM A;  4QUQ A;  1JOC A;  1HGZ A;  3FXE A;  2FFD C;  3AED C;  2N9B A;  2C0W A;  1M1J A;  1USE A;  1RY3 A;  2JP3 A;  4QCK A;  4JF7 A;  1YHQ P;  2WMM A;  5CJ0 A;  2Z4E A;  1NTZ G;  1ZME C;  1FZG A;  1MV8 A;  3U59 A;  1SQB E;  1LTS C;  1BGY D;  1BGY J;  2FXP A;  2CKF A;  1LTB C;  1Q90 C;  5CHX A;  2GBW A;  1IFI A;  2GBX A;  1NU1 D;  3V6I A;  5AW3 B;  1FDM A;  2XND H;  1PPJ D;  4BRY A;  3V4W A;  4K35 A;  5APX A;  2D2C D;  2BMO A;  3TF5 A;  3M0D C;  5CCG A;  1LT9 B;  1VQ7 P;  3L72 E;  4UB6 E;  2B89 A;  1AVY A;  2WT7 B;  2YFL A;  4HM3 A;  5B5E H;  3L74 J;  1A02 F;  2WPV B;  3VP8 A;  4LC1 A;  1NTM E;  4O9B A;  2W27 A;  1LWU A;  1X0T A;  1Q82 Q;  2W83 C;  1FC2 C;  3A0B E;  4OVN F;  4AYC A;  1IK7 A;  2O3J A;  3H6P A;  2XSH A;  1PPJ E;  3SWF A;  1U7J A;  1H0T A;  1SQB D;  1ULI A;  1KIL B;  2IBZ I;  4I7Z B;  3IR9 A;  5KTB A;  2HPC A;  3GTS A;  3G3Z A;  1ZP0 C;  4IFF A;  1Y9B A;  2ZJS E;  3G9R A;  3KZI H;  1IO4 A;  4HM6 A;  3WUV A;  2HG5 D;  2OYH C;  1OZH A;  1GL2 D;  2E4Q A;  2YKQ A;  2ZT9 C;  1EDJ A;  1LWU C;  2OGU A;  1VQL P;  3CME P;  4BXL A;  2UWJ E;  5AW2 B;  5CBN A;  1AQ5 A;  1KMI Z;  1RE3 A;  2YO2 A;  1OMI A;  4NBA D;  1O7N A;  2NPS A;  3L71 D;  4H44 D;  5M1B A;  4EI2 A;  1VQ9 P;  1X79 B;  1M1K Q;  3H1K J;  5AVZ B;  1LTG C;  4GT1 A;  2WSE J;  3B71 A;  5APQ A;  3L71 E;  3Q2Y A;  3L70 J;  1J1E B;  3L37 A;  1H89 A;  1D7M A;  1H88 A;  4NBD D;  3CPW O;  3H1J J;  1SQP J;  3D6Y A;  3MD0 A;  1VQ4 P;  1U57 A;  4WY4 C;  4NB8 D;  2IZ0 A;  1Y47 A;  4DOJ A;  3PTZ A;  1NTM G;  1SQP K;  2WSC H;  5C39 A;  4D6T J;  3VCA A;  3MZW B;  1NTK D;  2GUV A;  3AE5 C;  1P84 I;  1M1J C;  2O01 J;  4P1B H;  3CLQ A;  1ZOY C;  3V2R A;  4NPD A;  3H32 A;  3MUD A;  3WU2 E;  1J1E C;  2XDJ A;  3VCP A;  3A0B H;  1S4X A;  1KOR A;  1L0N K;  2R5D A;  3GL2 A;  4H13 D;  2J59 M;  4KT0 J;  2A45 H;  3TGU J;  1QVG O;  1JM0 A;  1QEX A;  5APV A;  4JQ0 D;  1RF1 C;  3CCU P;  2QJP B;  3V4Q A;  3EQQ A;  2W6A A;  5AW6 B;  3SFE C;  1FZC B;  2FYU E;  1PZQ A;  2YXR B;  1CI6 A;  4QDD A;  2QJK C;  2N9Y B;  2K37 A;  3HD7 B;  1EG9 A;  1GL2 A;  2O1K A;  2QJY B;  1N7S A;  2E76 B;  1EZV G;  3WU2 H;  1HUC A;  2NZ2 A;  1J2J B;  4WY4 A;  2RKL A;  3MHV A;  3Q1M A;  3L35 A;  1OVR A;  3G71 P;  3SWK A;  2B87 A;  3B5N D;  2WSF H;  3H1L J;  1N7S C;  3C0D A;  1SQQ E;  2OYO A;  2KYV A;  2W6J H;  3P8C E;  5TIS E;  4IL6 H;  3EFF K;  1GK6 A;  1NTM J;  4D6T G;  3CX5 H;  1T3U A;  3HE5 B;  3L70 D;  2IBZ D;  1R5L A;  4DT0 A;  1KYO H;  3TGU E;  1SLQ A;  1LTJ B;  3Q5S A;  2H8P D;  3BCC D;  1M57 D;  1K8A Q;  1N73 A;  3NTN A;  2Y9Z A;  4GIF A;  4N6J A;  2V4H A;  1FOS F;  3ZDM A;  2OQQ A;  1L0N J;  2L91 A;  3SWY A;  1L0L G;  3CI9 A;  3L73 E;  5AVQ B;  3AEC C;  2YNY A;  1MFT A;  3PHL A;  3PLN A;  2N1T A;  2M0B A;  1L0N G;  3AE3 C;  2HMO A;  3BVH A;  3D71 A;  1VF5 B;  3H1J E;  1NVO A;  2G3A A;  1OVU A;  4DZO A;  3OAK A;  3P8C D;  3BAT A;  1QGK B;  1DEE G;  1FS0 E;  1LTT C;  3CXH H;  1HTL C;  1KYO D;  1SQB K;  2LKM A;  4OH8 B;  3EN1 A;  2R32 A;  1IZN B;  2NRG A;  1U7M A;  2P10 A;  1T2K C;  4P1C H;  1E79 H;  3H1H G;  1N86 A;  3RK3 B;  4RO0 A;  5EFW B;  3EFG A;  1NHL A;  1OX3 A;  2M3E A;  5BU8 B;  1K04 A;  2H43 A;  1SFC D;  4PV1 D;  3AEB C;  5BVZ A;  1KIL C;  4LLH A;  4U3F G;  5AW7 B;  1SQX E;  2IDB A;  3IN6 A;  2E74 D;  1G8J B;  1FZE A;  3V2Q A;  1QL2 A;  5KLV J;  1LP1 A;  5CBO A;  3H25 A;  3KHU A;  3AE9 C;  2B24 A;  1KD1 Q;  1URQ C;  4WB4 A;  4R4M A;  2AXT H;  3MGN A;  2JJL A;  2KUB A;  1VQK P;  1SQP D;  1JB0 J;  2RMZ A;  4R4L A;  1YI2 P;  3FX0 A;  1BGY E;  3AEG C;  3CXH E;  4PD4 E;  2OYI A;  1Q2N A;  2E42 A;  3HE5 A;  4RKU J;  1RIE A;  4I1L A;  3B4S A;  1PL5 A;  2HOD B;  3A5T A;  4IL6 X;  4OGQ D;  3CCE P;  1BCC J;  4PD4 I;  3A7O A;  3LIE A;  2KNC A;  3RK3 D;  1WT6 A;  1SQB G;  1HBW A;  3H1I E;  1NU1 K;  3A0H H;  3SSU A;  1X9V A;  3P32 A;  3LW5 H;  5L8R J;  4I7Z C;  4L74 A;  1SVF A;  1WRG A;  3L71 J;  1ZRT E;  2C9N Y;  2FYN B;  1ZLL A;  3GZX A;  4BWN A;  2LR2 A;  1S72 P;  2HMJ A;  2BMQ A;  1URQ A;  4JYB A;  3TDK A;  2A06 E;  1W5C E;  1O7G A;  1JCC A;  3V2N A;  1LTA C;  3E1I A;  2WPQ A;  1HJB A;  4QDC A;  1S2E A;  3VMG D;  5AEW A;  5AVS B;  3RK3 E;  1AQT A;  4DCK A;  1L0L D;  1NO4 A;  2FYU J;  3BAS A;  2HML A;  3O6Q A;  2IFN A;  1A02 J;  1RQU A;  3HD7 C;  2K3R A;  1KYO E;  1BDD A;  2HLO A;  4I6M C;  3CX5 E;  3TNU B;  3QH9 A;  3SFD C;  4H13 C;  2IBZ G;  1NTM D;  1DD4 A;  1IFM A;  1YQ3 C;  2J58 A;  3HD7 A;  1N7S B;  1OVV A;  1KTM A;  3CCR P;  1VM9 A;  1RE3 C;  2XRX A;  2P1J A;  1SQV J;  1NTZ D;  2BEQ D;  1S1C X;  4HJL A;  1KIL D;  1KN7 A;  1K05 A;  2M8R A;  1SS1 A;  2OTJ P;  4D6T E;  3N0Q A;  2Z5H A;  1K9M Q;  1Q86 Q;  2XSO A;  3QWO C;  3M0A A;  2IYO A;  1NU1 G;  5B5E E;  4L75 A;  4NBE D;  4QDF B;  3H1H J;  2KZI A;  1UIX A;  4B86 A;  4IFM A;  2N1T C;  3CC4 P;  2HOD A;  2PGD A;  1RF1 B;  3HTK A;  2ZT9 D;  1OW8 A;  1JY2 O;  1EZV D;  2ZT9 B;  4ASV A;  2FFD B;  3VMZ A;  3KXD A;  3CWB G;  5KLI C;  3WUU A;  1GTW A;  4U3F E;  2KSJ A;  3M9B A;  4NBC D;  1CSB A;  4XA4 A;  3RBZ A;  2FXO A;  1OXZ A;  2VRS A;  4C7N A;  3B5N B;  5KLV K;  1J1D B;  1KV4 A;  4OWF A;  2KIK A;  2K9J A;  1NTM K;  1SQP G;  1NDO A;  1EXJ A;  1KB9 I;  2OYH A;  3HD7 D;  4EIJ A;  2CK3 H;  3AE1 C;  3CCV P;  2IX7 C;  2HMK A;  1UUV A;  3L70 G;  4K3A A;  1URQ B;  3CXH D;  2ZVN B;  2M5A A;  1BE3 E;  1G2C B;  3Q3D A;  4N78 D;  3CCS P;  3Q5R A;  2IYP A;  4RES B;  2ZYA A;  4Y99 C;  5AW0 B;  4HYT B;  5BOK A;  3L4F A;  1IFN A;  3WUT A;  4TLF A;  4HKZ H;  1N8R Q;  2JO6 A;  4DJG A;  4LGD E;  4GDO A;  3TNU A;  1PPJ G;  1LT9 A;  1SQQ D;  2QA4 P;  3UIA A;  2V7Q H;  2SPZ A;  1USD A;  1ZR4 A;  2JWD A;  2WQY C;  1S9K D;  1S5L E;  1NYH A;  3GHG A;  3TGU G;  4QUR A;  4OGQ C;  3NFQ A;  5APS A;  2QM8 A;  2QSI A;  5APW A;  2WSC J;  1SQQ K;  1M8O B;  4XE5 B;  3L73 G;  4GOF A;  3H1H D;  1EZV E;  5APT A;  1EDK A;  2ZYD A;  2I7F A;  4I2L C;  2Q3I A;  1YJ9 P;  2R44 A;  4UB6 H;  1OFC X;  1SFC B;  1Q90 D;  3HE4 B;  1GZL A;  1FZC C;  3A3Y B;  2BAS A;  3CX5 D;  5B66 H;  2C0X A;  1AJY A;  2K9Y A;  1KB9 H;  2MJZ A;  3HTK B;  1M56 D;  3H1I J;  2B9B A;  2I1K A;  3MP7 B;  4YPC A;  2KNC B;  2E74 C;  5KAF E;  3PJS K;  2BCC J;  2ZAE B;  2KI7 B;  3CCJ P;  1RF0 C;  1HVV A;  1NOH A;  2NVE A;  3L72 J;  2ZYL A;  3S4R A;  1L4A A;  2NUM A;  1PP9 J;  3HUS B;  4M3L A;  1R8E A;  1P84 E;  2K9J B;  2QJP C;  4HM1 A;  1X8Y A;  4Y99 B;  4L76 A;  3TK1 A;  3ABV C;  5KJ7 C;  4NBH D;  2H88 C;  1L0N E;  3RBX A;  1ZRT D;  2QVA A;  3AEE C;  2QJY C;  2Y0D A;  2IFM A;  3L73 J;  2BEZ F;  2BCC E;  1EXI A;  3V5B A;  2KLU A;  1HGV A;  3NMD A;  3RL0 B;  4IFD K;  2KP8 A;  3B5N C;  3W67 A;  5AW8 B;  1IC2 A;  2G8Y A;  4PV1 B;  4BRY B;  4ZKU A;  5E79 E;  1P84 D;  2JR8 A;  5KLV E;  1GW3 A;  4AAY B;  2QIW A;  3H1K D;  3GKE A;  2R3S A;  5CMZ A;  1KQF B;  2GM4 A;  3F5H A;  4C46 A;  1CI6 B;  1LWU B;  2KOG A;  2B1X A;  1NTZ J;  2NPS C;  4HM2 A;  2KZJ A;  1HWT C;  1FBM A;  2YMY A;  1ZR2 A;  4NPE A;  1J1D C;  3RL0 D;  3GHG B;  1Q7Y Q;  2XZR A;  1BSH A;  3EWK A;  1KQG B;  1AVO A;  1RF0 A;  3VMH D;  4W7Z A;  1RFS A;  4EOT A;  2B87 B;  1NKZ B;  1IFJ A;  3W68 A;  2P67 A;  5AVR B;  1JY2 P;  3H1L G;  5AEU A;  3TYY A;  1M90 Q;  3KDP B;  1VQO P;  2HFE D;  3E1R A;  2QRX A;  3GMA A;  1UII A;  2KLV A;  2H7H A;  1SQV D;  5KLV G;  1VF5 C;  4NB9 D;  1L4A D;  4H44 C;  2FXM A;  4IL6 E;  1HJ0 A;  2FKW B;  2E75 C;  3D6Z A;  5APY A;  3TSI A;  3GL0 A;  2B88 A;  1JUN A;  1N73 B;  1HF9 A;  3S1K A;  2FFD A;  2PFX A;  1YBK A;  2YO3 A;  1LJ2 A;  1FZA A;  3F89 A;  2D2C B;  1H0T B;  3A2A A;  4EDF A;  2W6B A;  1BE3 G;  3GF3 A;  4PD4 D;  2KB7 P;  3C8V A;  1FU1 A;  2OYH B;  4QMA A;  2HPC B;  1L0N D;  5CCH D;  2ITA A;  2JWA A;  1SQV E;  4OGQ B;  4N3Y B;  4NBB D;  4WWI A;  3S9O A;  5H2F H;  4ASW A;  3RK2 B;  4ZKP A;  1G1J A;  1N2D C;  2Z5I A;  2OYI C;  2M5A B;  1KQS O;  1L2P A;  3EQ2 A;  3H32 B;  1SJG A;  1OIP A;  2YXQ B;  3H1I D;  1MKM A;  4GOD A;  3N4X A;  1S5L H;  1BDC A;  3CD6 P;  3JCU H;  3L73 D;  1KQL A;  1OW6 A;  3H1J G;  1KZU B;  3H1L D;  3M91 A;  2O01 H;  1ZXG A;  1MFZ A;  3CCM P;  1S5L X;  3CWB J;  1NTZ E;  1JY3 O;  3GLM A;  1ZW0 A;  2O1J A;  3CL3 D;  4H44 B;  5KLV D;  4UB8 E;  5AW4 B;  3CCQ P;  5KKZ B;  2DW3 A;  2Q3E A;  2E5T A;  1FOS E;  1RQV A;  3M06 A;  1KC8 Q;  1EDL A;  2QEX P;  4TT3 H;  4U3F D;  1LTJ C;  2R3C A;  4N78 E;  2Y0E A;  2PRR A;  2M3B A;  4ZNC A;  4HM4 A;  1T8Z A;  1N73 C;  2FY8 A;  1N7L A;  4HJG H;  1NYK A;  5AW9 B;  1T6A A;  2LXB A;  4H0L C;  1GW4 A;  2NUK A;  3U1C A;  1OWA A;  1RHZ B;  3C9I A;  2JKV A;  2O01 N;  1PP9 G;  2YKO A;  2NVG A;  1PIX A;  4HM7 A;  3VYI A;  1N7S D;  3FXD A;  3JC2 2;  3L74 E;  2XKM A;  4HM8 A;  1SFC A;  5DJT B;  2BMR A;  5TJH A;  4JBZ A;  3N7N A;  3H1K G;  3FOU A;  2WSE H;  2WPR A;  4YTP C;  4C7R A;  1CW5 A;  3L74 G;  1QL1 A;  5APU A;  3KZI E;  1QX8 A;  1VF5 D;  3VN0 A;  1FAV A;  1VQP P;  2HR3 A;  1IFD A;  5KJ7 A;  2E75 D;  1HH0 A;  4XFJ A;  1NTK J;  1GK4 A;  2AXC A;  3H1J D;  1PGO A;  2DE5 D;  2N1T B;  4WY4 B;  5CCG D;  1G8K B;  1GMJ A;  2WIT A;  1LT9 C;  4WY4 D;  1YQ4 C;  2KK7 A;  3M0D A;  1JTH A;  1NH4 A;  5GTI E;  1DH3 A;  2Q7C A;  3JSV C;  1O7W A;  1K73 Q;  1GD2 E;  1WMK A;  1VQ5 P;  4AUW A;  4HB1 A;  1G1I A;  2LXC B;  2JDI H;  2V7Q J;  1VQN P;  2AXT E;  3KYQ A;  1FQT A;  1YJN P;  1EC5 A;  3BCC G;  2NPS B;  3GF7 A;  3O8Z A;  2Q6Q A;  3T97 A;  5AVU B;  2XR8 A;  2NPS D;  1DX7 A;  4U3F J;  3CWB D;  5KAI H;  2WTY A;  1NTK K;  3LID A;  2RH0 A;  1O7M A;  1RE4 C;  4Y28 J;  5KAI E;  2HYN A;  3GCE A;  1GL2 C;  1URQ D;  1FJK A;  3IAO A;  1BCC G;  1SFC C;  4HKV A;  2WWW A;  1KFN A;  3CMA P;  2KSE A;  3IF4 A;  2WPS A;  1L0L K;  1DD3 A;  3LW5 J;  3JCU E;  3L74 D;  4PJ0 E;  1VQM P;  2ZXE B;  3RGU A;  2JZA A;  1KB9 E;  1QLE D;  2QG4 A;  3VMX A;  3VOP A;  2FYU D;  1KB9 D;  3C1L A;  1SP4 A;  1L4A C;  1PV3 A;  1YJW P;  3KPE A;  1JM1 A;  5K5G B;  3AEA C;  3GOB A;  3CXH I;  3HUS C;  1LTI C;  3VMA A;  2CPB A;  3K5B A;  4EYY Q;  1YYC A;  5AVX B;  4U7J A;  1EQ7 A;  1JY2 N;  3MTU E;  3BCC E;  2Q5U A;  3L75 E;  1BSN A;  1FZC A;  5GTH H;  1L0L J;  3BRT B;  3H1I G;  2FYN C;  1IK9 A;  3AEF C;  4IOI H;  3CWB E;  1NU1 E;  3BRV B;  1GL2 B;  1JY3 N;  3H1L E;  3RK2 C;  4W7Y A;  3GTE A;  3L72 G;  2YFJ A;  2RN0 A;  3FWL A;  2HMM A;  4L73 A;  1LP1 B;  3Q5P A;  1VPC A;  1LNQ A;  2QM7 A;  3VP9 A;  1OW7 A;  3AE7 C;  2KS1 B;  2I8D A;  1PP9 D;  2R5B A;  3G4S P;  5AW1 B;  1AFO A;  3AE8 C;  1BCC D;  1DEB A;  5CJ4 A;  1O7H A;  3GW6 A;  2YFI A;  1E5W A;  4PJ0 H;  2A06 D;  3BCC J;  5KAF H;  1S9K E;  1JO5 A;  2WVR A;  1JMM A;  2IBZ E;  3L75 J;  1EZV I;  2AEJ A;  1SQV G;  2L5G B;  2HMN A;  1FZB A;  2W8Z A;  3OW2 O;  5CXM A;  3MUD C;  3CC2 P;  5AVY B;  1Y8A A;  2IZ1 A;  3U1A A;  2NWF A;  1TU3 F;  2XNX A;  2Y0C A;  2QE7 H;  3B8E B;  5GTI H;  5DJU B;  3M9H A;  4HM5 A;  2YKP A;  3VMI D;  2W90 A;  3D89 A;  1PGJ A;  3P7K A;  3L36 A;  2GA1 A;  3R2P A;  3FWN A;  1LGH B;  4H0L B;  4ZMD A;  3MIW A;  1GU5 A;  3GG2 A;  1BE3 J;  1T2K D;  3RK2 D;  3VTP C;  1M1J B;  4W80 A;  1ULJ A;  5GTH E;  3E7K A;  2OAR A;  1SQP E;  2QPZ A;  2YVJ B;  3I5C A;  2I1J A;  3TGU D;  1SQQ J;  1QVF O;  5KLI B;  2WSS H;  4AIV A;  3L70 E;  3I56 P;  5AVW B;  1CZQ A;  1O7P A;  3PH0 A;  3V2P A;  1YTZ T;  2YIU B;  1LT1 A; 
#chains in the Genus database with same CATH homology
 1SQV E;  1SQB E;  1UUV A;  4NBB D;  3EN1 A;  3L71 E;  4HM8 A;  4NBF D;  2E76 D;  2BMR A;  4OGQ D;  1VM9 A;  1O7H A;  4HKV A;  1WQL A;  2CKF A;  2YFI A;  1BE3 E;  2XRX A;  3FOU A;  4P1C H;  1Q90 C;  2B1X A;  4QUP A;  4EMJ B;  4QDF A;  2GBW A;  4HM2 A;  4HJL A;  2IBZ E;  1VCK A;  4NBD D;  2GBX A;  1SJG A;  3H1I E;  2HMN A;  4D6T E;  1VF5 D;  2Q3W A;  2JZA A;  3C0D A;  3N0Q A;  1NTK E;  1KB9 E;  5BOK A;  4NB8 D;  2D2C D;  2BMO A;  2XSO A;  1SQQ E;  3GB4 A;  5CXM A;  1UUW A;  1L0L E;  2NVE A;  3VMH D;  3L72 E;  2ZYL A;  1RFS A;  2E75 D;  4PV1 D;  5KKZ C;  3H1H E;  1ZRT E;  3VCA A;  2NUM A;  2YFL A;  4HM3 A;  3H1K E;  2JO6 A;  5AEU A;  2E4P A;  1NTM E;  2DE5 D;  2NWF A;  3GZX A;  1P84 E;  1G8K B;  2QJP C;  4P1B H;  1JM1 A;  2HMJ A;  2BMQ A;  4HM1 A;  4NBE D;  4QDF B;  3DQY A;  4HM5 A;  1BCC E;  1SQX E;  3GOB A;  3TGU E;  2A06 E;  3VMI D;  1NTZ E;  3D89 A;  2E74 D;  2XSH A;  1PPJ E;  3GZY A;  1O7G A;  3VCP A;  4NBH D;  4NB9 D;  1G8J B;  1ULI A;  4H0L D;  1O7W A;  1L0N E;  2ZT9 D;  4QDC A;  3VMG D;  3BCC E;  5AEW A;  3L73 E;  3GL2 A;  3GTS A;  4H13 D;  3L75 E;  2B24 A;  4QUR A;  3GL0 A;  5KLI C;  4QUQ A;  4HM4 A;  2QJY C;  2DE7 D;  4HM6 A;  4U3F E;  2HML A;  2BCC E;  2FYN C;  1FQT A;  1NYK A;  4NBC D;  3CWB E;  2YIU C;  2NVF A;  2HMO A;  1ULJ A;  2E4Q A;  1NU1 E;  1SQP E;  3EQQ A;  3H1J E;  3H1L E;  2QPZ A;  1KYO E;  2YVJ B;  2DE6 D;  4HM0 A;  1EZV E;  2NUK A;  2XR8 A;  2FYU E;  5HL4 A;  3GTE A;  2YFJ A;  1NDO A;  3CX5 E;  4QCK A;  4QDD A;  2HMM A;  1O7M A;  2I7F A;  3AZC A;  2QJK C;  4AIV A;  4NBG D;  3L70 E;  2NVG A;  4NBA D;  1BGY E;  3GCE A;  1O7N A;  3CXH E;  4PD4 E;  4HM7 A;  4H44 D;  5KLV E;  1EG9 A;  4AAY B;  1O7P A;  1RIE A;  1PP9 E;  3GKE A;  2HMK A;  3L74 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...