3L74E

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 48
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l74E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l74E02
2HMKA 4HM0A 1VCKA 1VM9A 3H1LE 4NBED 1O7GA 3H1IE 3L73E 2QJKC 3FOUA 1NU1E 2IBZE 2YFLA 4HKVA 1KB9E 1WQLA 4AIVA 2YFJA 1KYOE 1RIEA 2E76D 1SQVE 2ZYLA 4QDFB 1O7MA 2I7FA 2QPZA 2BMRA 2HMNA 2B1XA 3L74E 1NYKA 1O7PA 3EN1A 4QDDA 4QUPA 1EG9A 1UUWA 2D2CD 4QUQA 1NTKE 5AEUA 1FQTA 2Q3WA 2HMLA 3GCEA 3GTEA 3EQQA 3CWBE 2E75D 2B24A 4PD4E 1ULIA 3H1KE 1SQXE 1EZVE 2NVFA 2QJYC 2HMMA 2FYNC 1O7NA 3H1JE 2YVJB 2NUKA 4HM1A 1O7WA 4NBGD 1G8JB 3GTSA 4HM6A 4QDCA 3BCCE 2XSHA 4NB8D 5CXMA 1BE3E 4NBHD 2E4QA 4NB9D 3DQYA 2BMQA 2QJPC 3N0QA 3VMHD 5BOKA 2HMJA 3GL2A 4OGQD 1JM1A 4P1CH 3L71E 2E4PA 2BMOA 1SQPE 4EMJB 1Q90C 1VF5D 1BCCE 3GZYA 4HM5A 4NBBD 4QCKA 3L72E 4D6TE 2GBWA 2NVEA 4HM3A 1ULJA 2ZT9D 1NDOA 1NTME 1G8KB 1SQQE 3GL0A 2NWFA 3D89A 3L75E 2HMOA 2GBXA 2JZAA 2YFIA 2FYUE 4NBDD 1UUVA 3VMID 2JO6A 5AEWA 4U3FE 1PP9E 1ZRTE 3H1HE 3GKEA 5KKZC 4H13D 1PPJE 2NVGA 1SJGA 4PV1D 2A06E 3L70E 1O7HA 1BGYE 2DE6D 4H0LD 4H44D 4NBAD 4NBCD 3VCPA 4HM7A 3AZCA 4P1BH 1L0LE 1NTZE 4HM8A 3C0DA 4QDFA 4QURA 5KLVE 2XSOA 4AAYB 3CXHE 5HL4A 1SQBE 2CKFA 4HM4A 4HJLA 3CX5E 2NUMA 1P84E 5KLIC 2XRXA 2BCCE 3VCAA 2YIUC 2XR8A 3GOBA 3GZXA 2DE5D 4HM2A 3VMGD 3TGUE 2E74D 1L0NE 3GB4A 2DE7D 1RFSA 4NBFD
chains in the Genus database with same CATH superfamily
5TISH 4TLFA 1Y9BA 2QJKC 3FOUA 1NU1E 5AVQB 3R2PA 1RF0C 3HE4A 1OIPA 1GL2C 4N78D 3I55P 1LGHB 1S9KD 3LIDA 1YJ9P 4JPZB 2B1XA 4L76A 4DT0A 2ITAA 3A5TA 2BCCD 2QVAA 3OJAB 1K8AQ 1FZGA 4IL6H 1U57A 4N3YB 2WMMA 1W2EA 1Q81Q 2YVJB 5APWA 1LT9A 1T2KD 1VQ7P 1XTGB 2KZIA 2WSCJ 5CXMA 1BE3E 1CI6B 3CXHD 2Q3IA 2HMJA 1S3JA 4H44B 2QIWA 3L74D 4N6JA 1K05A 1L0ND 1VQOP 1KTMA 4HM5A 2AEFA 2PP6A 2ZXEB 4Y99B 3GMAA 1JTHB 4H13D 1HF9A 1ZOYC 2A45H 4D6TG 1URQA 4NBCD 2YNYA 3BCCD 1FOSF 3HE5B 3KDPB 3RL0g 4QDFA 2YO3A 4IFDK 3H32B 2QG4A 1JM0A 1H8AA 2WSEJ 1USEA 2A06G 3WU2E 2DE7D 2WT7B 5AVXB 3AE3C 2KSEA 3VYIA 3H1KJ 2KOGA 3RL0B 1RIEA 3AE1C 2I7FA 1SFCD 1L0LK 1NTZK 3MTUE 1RH5B 2YXRB 1Q7YQ 2IDBA 4ASWA 1AQTA 1EG9A 3H25A 1JMMA 3KYQA 4ZMDA 5AVYB 1VQPP 1KQLA 3CPWO 4L74A 5L8RJ 3O6QB 4OH8B 2K9JB 3TGUG 3PP5A 1JOCA 3L73D 1NU1K 4NBGD 3KQGA 4K3AA 3H1HJ 1OWAA 3VMYA 2QJPC 3N0QA 2VRSA 3ZDMA 2XU6A 2R3CA 2BMOA 2K3RA 2H43A 5KLVJ 2GUSA 3M9HA 1VF5D 1BSHA 1SQQJ 4PJ0E 2NWFA 2Y0DA 2JZAA 3KZIH 3H1ID 1EDKA 3P8MC 4WY4D 2AEJA 2WVRA 1NO4A 1PGJA 4N78E 3MUDA 1S9KE 2QM8A 3II6A 1EXJA 2YKOA 2E75C 4UB8H 2O1JA 2PGDA 1VQLP 2CKFA 2BCCE 2YIUC 5KKZB 3G6EP 2XNDH 1USDA 4NBFD 3LW5J 1A02F 4NBED 5CCHA 5AVUB 3AEAC 4U3FD 1ZW0A 3H1JJ 1N2DC 3VP9A 2WPRA 1LTBC 5APSA 3H1LG 3L74E 3G3ZA 3HE5A 3C1LA 2QJKB 2IBZG 5C39A 3I5CA 2Q3WA 2R5BA 4I2LC 3CX5I 3C9IA 3HD7C 1GL2B 2SPZA 1LTSC 2NPSC 1IC2A 2M5AB 1VQ4P 3M9QA 1NTKG 3BCCE 2RH0A 4JBZA 1PL5A 1SQVD 2I1JA 3RGUA 2D2CC 1R5LA 1N7SC 1SQPJ 1Z56A 5APUA 1SQVG 1KILA 3D6ZA 3PLNA 2IPPA 2HMOA 1ZMEC 1HBWA 2E43A 2WPVB 1L4AC 4HB1A 1JY3P 2N1TA 1BCCG 1Y8AA 5AW8B 2DE6D 1IK9A 1KMIZ 1ZN5A 2IYOA 1U7MA 3Q2YA 1FOSE 5B66E 3VCAA 3S4RA 2O1KA 3TGUE 1T2KC 3HRNA 3L37A 3WUUA 4XFJA 3L73E 1SQXJ 2Z5IA 4NPDA 2YMYA 1QL2A 3V2QA 4LC1A 2W27A 2B9BA 5APVA 1YTZT 2HYNA 3GCEA 3WUTA 2KP8A 4H13C 1SQBG 2LR2A 2WPQA 2OYIC 3RK2D 5AW9B 2HG5D 1N73C 1ZR2A 3L75J 3GHGC 1BGYD 3T97B 2AEMA 1FAVA 1L0LD 1NTZD 1LTJC 3P8CD 1M90Q 3V5BA 3L70J 1K73Q 1QVGO 2K9YA 1T3JA 5AVSB 1Q2NA 3NFQA 1MFTA 2B87A 2QJPB 2POHA 1SS1A 1RF0A 3TK1A 4U3FE 1R8EA 1SFCC 2NZ2A 1BSNA 3AEBC 3V2NA 1GL2A 1RE4C 3V4WA 3M0DC 1RY3A 2O01N 3Q5PA 3WUVA 2P67A 3E1IA 1IJDB 1Q82Q 3LIEA 2E5TA 4HJLA 5AW1B 1LNQA 2OTKE 5B5EE 3IFMA 1O7GA 1HJBA 2CK3H 2E75B 2P10A 3AE2C 4BXLA 3D6YA 1BE3D 2YIUB 3RBXA 3TSIA 3EFFK 5EFWB 1VF5C 5TJHA 1SQVE 3MGNA 3CC2P 2OGUA 3L71J 4IFFA 4WY4C 1J2JB 2R44A 1EC5A 3EQQA 4YPCA 1M1JA 1EXIA 4UB6E 2PRRA 3N4XA 2HMMA 3S9OA 4HM6A 4NB8D 3A7OA 1KYOD 1VQNP 5KAIH 2OARA 4YXWH 3H1KG 1M56D 3HD7B 1MZ9A 2NPSB 3I56P 4P1CH 5APYA 3L72J 3CL3D 3EWKA 1LTIC 4O9BA 4PD4D 1FDIA 4LGDE 2D2CB 1PP9J 4EOTA 1VQ6P 1N7SB 1NOHA 3BRTB 1OXZA 2YMKA 3JCUH 2NRGA 3TYYA 5KTBA 2Q1KA 1PGQA 2G3AA 1EZVI 1KQSO 3B71A 3AE4C 2RN0A 4AAYB 5CJ0A 1SQBE 2WWWA 3BASA 4HM4A 2NUMA 3CC4P 1L4AB 1LJ2A 2C0WA 5KAFE 1AVOA 2N9BA 4W7ZA 3CX5H 4IOIH 2HODB 4JF7A 4IFMA 2WZ7A 2JWDA 3AECC 2Q5UA 2FYUD 2FYZA 3HD7D 3NXSA 5AVZB 1SQQG 4DCKA 3P8CE 4RO0A 2E76D 1OX3A 4ZNCA 1JEKA 2OYOA 2ZYLA 1KFMA 4QMAA 5APXA 2IX7C 2PFXA 2P7JA 1O7PA 3EN1A 1UUWA 2D2CD 4QUQA 1N7SD 2KLUA 2HMLA 1P84I 2Y0EA 4RJTA 3LW5H 1O7NA 4W7YA 5K5GB 3UIAA 1G8JB 1FZEA 3VP8A 1L4AD 4H13B 1AA0A 2ZFCA 3CCVP 1SQVK 2BMQA 2OYIB 3GL2A 1LP1B 3RK3D 1N73B 3HUSC 3H1JG 4C7RA 3GHGB 1HJ0A 1IFDA 3BVHA 1LTJB 3QWOC 4MN4C 2C0XA 1LWUC 1G2CA 2IZ0A 1NU1J 1KB9I 4R4LA 3FXDA 4R4MA 4QURA 2IYPA 3CCJP 2CPBA 2KUBA 3RK2C 1SFCB 1KZUB 3CXHH 1BDCA 1LTGC 2NPSA 1FZFA 5AW0B 4D6TD 4AYCA 1SQPG 3SSUA 1NJIQ 1PZQA 2WSFJ 3F89A 1ZRTD 2HFED 2YFLA 5KJ7D 4I1LA 1KYOE 1RF1A 2A45G 2A06D 1NWQA 2QPZA 3Q3DA 1G1IA 2JO1A 1SQBK 4Y28J 1WMKA 1GW3A 4KT0J 1VF5B 4PD4E 3GF3A 4W80A 2HODA 2KYVA 3AEFC 1R5SA 2L5GB 4WY4B 5E79H 2LKMA 3L35A 1SQXG 4BRYB 3TGUD 2DW3A 4QCKA 3TNUB 1NTMJ 1YITP 1G8KB 1SQQE 4XE5B 1NHLA 3PRJA 2FYUE 1S5LE 3USSA 1RHZB 2JO6A 2RKLA 2QEXP 2NVGA 1DX7A 2H89C 1JY2O 1CZQA 3B5NC 2WSSH 3VTPC 1N86A 4P1BH 3PH0A 3L75G 2E42A 3CI9A 4EDFA 5TISE 1LP1A 3L70G 3VMGD 1DIPA 5GTHH 4RKUJ 1DH3A 3GHGA 1YJWP 3G4SP 3R4YA 2L91A 1AV1A 1OW6A 3D70A 1KC8Q 3A0HH 2WPSA 1CI6A 4WBAA 3RK3E 1NAFA 4IL6E 2K1AA 2Z5HA 4H0LB 5AEUA 5AW5B 3D71A 1SVFA 1SFCA 5AW2B 1M8OB 3CCQP 1RQVA 2FYNC 3H1LD 3M0DA 1JTHA 2HLOA 3GTSA 2IBZD 3V2PA 1OVUA 3SWYA 1JY2N 3P32A 3U59A 2M0BA 3NTNA 1LT9C 1HVVA 3V6IA 1SQPE 3H32A 2Q7CA 2M3BA 3AE7C 4D6TE 1NTKD 2BCCJ 1JO5A 2KNCB 1D7MA 1OMIA 1J1EC 2FKWB 2KS1B 3CCLP 3Q1MA 2O01J 2E76C 1AJYA 2AXCA 3EQ2A 3L71G 2WT7A 3HUSB 1ZRTE 2YO2A 1GDTA 1WT6A 2A06E 4H0LD 5H2FH 4WVZA 5CCGD 3B4SA 4GKGA 4WY4A 3N7NA 1LWUB 4DJGA 4B86A 2H8PD 3L74J 1W5CE 1BCCD 1L0NJ 1OW7A 1P84H 3L72D 2XZRA 3GB4A 1EQ7A 2HMKA 1SQQK 4HM0A 1VCKA 2R5DA 2FYUK 1AVYA 3L72G 3TNUA 1UIIA 2R3SA 3O6QA 3RK2B 2K9JA 1IO4A 3RK3C 1VQKP 4IL6X 4HKVA 1WQLA 3HTKB 2YFJA 4OVNF 1PP9G 3GLMA 3BCCJ 2BMRA 4I7ZC 3AEDC 2QRXA 4YTPC 3CWBJ 3EFGA 4C46A 3CCSP 2FFDC 1ULIA 1QL1A 2HPCB 1RQUA 4GDOA 2UWJE 3VMAA 1KB9H 1DD4A 3A2AA 2B89A 1JCCA 2OQQA 5CMZA 3DQYA 1SQBD 5BOKA 3TDKA 2V7QJ 4OGQD 3MIWA 2ZXXA 2IFMA 2E4PA 3CXHI 4C7NB 2AXTH 3QH9A 3VMXA 2ZVOB 2QSIA 3KZIE 1OFCX 5KJ7C 3D89A 2YFIA 5M1BA 1YJNP 1CSBA 3L36A 4M3LA 3AE8C 3M06A 1JCDA 1IFJA 3L73J 4UB8E 4HM7A 1ZP0C 3F5HA 3SFEC 2XSOA 1KILE 1M1KQ 1HTLC 2PAJA 2E5YA 5KLIC 2XRXA 1SQPK 2I8DA 1PPJG 1QGKB 3B5NB 2E74D 4AQRD 2K37A 1VM9A 4JYBA 3H1LE 3CCMP 3H1IJ 2KNCA 3VMZA 2KS1A 2M5AA 2IBZE 4ASVA 4AIVA 3BRVB 3MP7B 3HUSA 3FGAD 3O8ZA 3JSVC 1NU1G 4BWNA 1NTKE 3NMDA 1FZAA 1LWUA 4LLHA 3CCRP 2R32A 1IFIA 2WSFH 2Y9ZA 4EIJA 4U3FJ 3HE4B 2E4QA 4YXDC 1T3UA 3B5ND 3HTKA 1VDFA 2FYNB 3SWKA 1BCCE 3L72E 4HM3A 2ZT9D 3ITKA 1NDOA 2GBXA 3AEEC 3H1KD 3M0AA 3W67A 1PP9E 1LT9B 2FXMA 4OWFA 2V4HA 2IFNA 1KILC 2KI7B 2KXPB 3KPEA 3GG2A 1J1EB 3E7KA 3CMEP 4KHXA 1A02J 1QEXA 2E76B 1FZCC 1CW5A 1EDIA 2N1TC 2DE5D 4HH2A 4ZKPA 4C7NA 1JUNA 4GIFA 3WU2H 1FZBA 1NTMG 3PHLA 3H1HD 1KB9E 3T97A 2LXCB 5APQA 5AVVB 1HGZA 1HWTC 2GM4A 2BEQD 1VQ5P 1E79H 4QDFB 3H1HG 5KLVD 2OYHC 3CCUP 1Q86Q 3CX5D 3RK3B 2AXTE 2MKVA 4EYYQ 1SQQD 2KB7P 1SP4A 5KLVG 1MUUA 5DJUB 2P58A 2Q6QA 1IZNB 4H0LC 1ZXGA 1RE3C 5CCGC 1GK4A 2FXPA 4I7ZB 4K35A 3U1CA 4QDCA 1X79B 3CLQA 1VPCA 3CD6P 1FJKA 2FFDB 3V2RA 1EDJA 1SLQA 2N9YB 1FS0E 1NTKK 2NVEA 1URQD 3FWLA 3PJSK 5AEWA 3AE9C 3P7KA 1VQMP 2JR8A 4DOJA 3H1JD 1KQGB 1BGYJ 3Q5RA 5AW4B 1L0LJ 1NTZJ 5HL4A 3AE6C 2YKQA 5AVRB 2XDJA 1KV4A 3GZXA 2FY8A 5CHXA 1RFSA 1QX8A 2P2UA 2O01H 1Q90D 4TT3H 4PV1C 1ZLLA 4OGQC 2BCCG 5KLIB 3PTZA 4CPGA 1EDLA 3OAKA 2ZYDA 1UIXA 1FU1A 1SQPD 1L2PA 2HMNA 3HD7A 4QDDA 1Y47A 1FJPA 1FQTA 3GTEA 3KHUA 1HUCA 3H1KE 1FC2C 4KJMA 1NH4A 2J59M 1XTCC 3L74G 1L0NG 4GOFA 1N7SA 5KAIE 1T6AA 1BE3J 1M1JC 5CBOA 1S72P 2E74C 1JMBA 4GOEA 1YBKA 3MZWB 2ZYAA 4EMJB 3SWFA 3IR9A 1FDMA 1L4AA 3IF4A 3BCCG 1GK6A 1NTME 3GL0A 3CWBD 1GMJA 2C9NY 1X8YA 1E5WA 3FXEA 3JCUE 1SQXD 2FXOA 3MD0A 3MHVA 3H1HE 3CWBG 3GKEA 1KFNA 1U7JA 2BASA 2W8ZA 2Y0CA 4H44D 3G9RA 2M8RA 2JEEA 5KLVE 2XKMA 4EI2A 2V7QH 3CX5E 5CCHD 2FFDA 1KILB 3VOPA 1FBMA 2OTJP 2ZJSE 2JJLA 5CJ4A 5B66H 5AW6B 3C8VA 1AQ5A 2XNXA 4JQ0D 5CBNA 4L75A 3L75D 1FZCB 1YYCA 3ABVC 1IFMA 2N1TB 1ZV8A 3K5BA 3L70D 1VQ8P 5BU8B 2ZT9C 1YHQP 2OYIA 1HGVA 1N73A 3L73G 4L73A 2WQYC 5KJ7A 1H88A 1DD3A 3IAOA 3CC7P 2W6JH 1LTJA 2OYHB 3RL0D 1KQFB 2KLVA 2FYUJ 3H1JE 3RBZA 2ZAEB 1N7LA 2I1KA 4XA4A 1OZHA 1KILD 4NBHD 3H1IG 3VMHD 1JY3O 1FE6A 1KYOI 1H0TB 1W2BO 3KXDA 4NBBD 2GUVA 2N1TD 1RE4A 1FDOA 5BU5A 3FWNA 3TF5A 2KZJA 1YQ3C 4NBDD 2LXBA 1EZVD 4Z1MH 4PD4I 1EZVG 3AEGC 1S2EA 1S5LX 4JYCA 3AZCA 2W83C 5GTIH 2Q9IA 2KSJA 3CXHE 2QA4P 1S4XA 3JC22 1GW4A 4U3FG 3L71D 4HJGH 2FBWC 3WMM0 4HM2A 4NPEA 1X0TA 1L0NE 1PV3A 2O3JA 1JY2P 2B87B 1NTMK 5B5EH 1MV8A 1YI2P 2H88C 2K88A 2GA1A 2JKVA 1QVFO 3GW6A 3G71P 2HR3A 4HYTB 1O7MA 2ZVNB 1URQC 1PGPA 5KLVK 1NGMB 2KK7A 1J1DC 4BRYA 1BDDA 3CMAP 4PV1B 1JY3N 1PGOA 4OGQB 5APTA 4I6MC 1P84D 4A7PA 1RF1C 3CWBE 3M91A 4D6TJ 1PP9D 1SQXE 1DEBA 2QJYC 2CPSA 2NUKA 4UB6H 4HM1A 5E79E 2XSHA 4GT1A 3OA7A 1FZCA 1X9VA 1M57D 4U7JA 1NYHA 5AVWB 1JM1A 1HH0A 1Q90C 2OTLP 5AVTB 2GBWA 1KD1Q 1GL2D 1M1JB 2ZYGA 3L75E 2E74B 1UUVA 1KB9D 1IK7A 2Q3EA 3VN0A 2JWAA 4PV1D 3L70E 2OYHA 3C0DA 1NKZB 1YTZI 5GTHE 2B88A 3A0BH 1H89A 2XR8A 3AE5C 3B8EB 2KIKA 1AFOA 3TGUJ 2WITA 1NVOA 1RE3A 3S1KA 5CCGA 3W68A 1H0TA 5KAFH 3A0HE 4RESB 1X22A 1NAYA 3H1IE 4NPFX 1GZLA 1ZR4A 2G8YA 1PPJD 1YQ4C 2A45I 4WWIA 1NYKA 3MUDC 1BGYG 3A3YB 1L0LG 1NTZG 1MKMA 3GF7A 2W90A 1L0NK 4H44C 1EZVE 2ZT9B 1WRGA 1KN7A 2NVFA 2RMZA 1O7WA 1NU1D 1G1JA 5CCHC 3CCEP 1PFIA 4Y99C 1K04A 5GTIE 1M7LA 5BVZA 1OVRA 2WSCH 3L71E 3BATA 1ULJA 2J58A 1DEEG 1SQXK 3VMID 2M3EA 2P1JA 1JB0J 5H2FE 4HKZH 3H1LJ 3SFDC 3IN6A 4WB4A 4HM8A 2XV5A 1OW8A 1LTTC 2IZ1A 1IFNA 2Z4EA 1P84E 1BE3G 3RL0C 2QE7H 1NTKJ 2WSEH 1IFPA 2BEZF 1JNMA 5DJTB 1G2CB 2HPCA 4AUWA 2QM7A 2W6BA 1SQVJ 1S1CX 3H6PA 1KYOH 2JDIH 3FX0A 1NKNA 3V4QA 4QUPA 1NTMD 1GU5A 2H7HA 2E75D 3L4FA 5AW3B 2B24A 1BCCJ 1URQB 1TU3F 4PD4H 1GU4A 1N8RQ 1J1DB 4GODA 1KORA 1YIJP 4DZOA 3OW2O 2WTYA 1RF1B 2MJZA 1OVVA 2YXQB 4NB9D 2JP3A 2IBZI 2QJYB 1PIXA 3Q5SA 2Y9YA 3A0BE 1K9MQ 3GZYA 4ZKUA 2YKPA 3B5NA 2W6AA 1QLED 3E1RA 2J5UA 1VL2A 5KKZC 2C9LY 1S5LH 1PPJE 1SJGA 1T8ZA 1LTAC 1O7HA 1BGYE 4NBAD 3VCPA 1VQ9P 2NPSD 1L0LE 1NTZE 1GTWA 2FYUG 1SQBJ 3GOBA 1GD2E 1MFZA 3M9BA 3U1AA 5AW7B 4PJ0H 1LT1A
chains in the Genus database with same CATH topology
2HMKA 4HM0A 1VCKA 1VM9A 3H1LE 4NBED 1O7GA 3H1IE 3L73E 2QJKC 3FOUA 1NU1E 2IBZE 2YFLA 4HKVA 1KB9E 1WQLA 4AIVA 2YFJA 1KYOE 1RIEA 2E76D 1SQVE 2ZYLA 4QDFB 1O7MA 2I7FA 2QPZA 2BMRA 2HMNA 2B1XA 3L74E 1NYKA 1O7PA 3EN1A 4QDDA 4QUPA 1EG9A 1UUWA 2D2CD 4QUQA 1NTKE 5AEUA 1FQTA 2Q3WA 2HMLA 3GCEA 3GTEA 3EQQA 3CWBE 2E75D 2B24A 4PD4E 1ULIA 3H1KE 1SQXE 1EZVE 2NVFA 2QJYC 2HMMA 2FYNC 1O7NA 3H1JE 2YVJB 2NUKA 4HM1A 1O7WA 4NBGD 1G8JB 3GTSA 4HM6A 4QDCA 3BCCE 2XSHA 4NB8D 5CXMA 1BE3E 4NBHD 2E4QA 4NB9D 3DQYA 2BMQA 2QJPC 3N0QA 3VMHD 5BOKA 2HMJA 3GL2A 4OGQD 1JM1A 4P1CH 3L71E 2E4PA 2BMOA 1SQPE 4EMJB 1Q90C 1VF5D 1BCCE 3GZYA 4HM5A 4NBBD 4QCKA 3L72E 4D6TE 2GBWA 2NVEA 4HM3A 1ULJA 2ZT9D 1NDOA 1NTME 1G8KB 1SQQE 3GL0A 2NWFA 3D89A 3L75E 2HMOA 2GBXA 2JZAA 2YFIA 2FYUE 4NBDD 1UUVA 3VMID 2JO6A 5AEWA 4U3FE 1PP9E 1ZRTE 3H1HE 3GKEA 5KKZC 4H13D 1PPJE 2NVGA 1SJGA 4PV1D 2A06E 3L70E 1O7HA 1BGYE 2DE6D 4H0LD 4H44D 4NBAD 4NBCD 3VCPA 4HM7A 3AZCA 4P1BH 1L0LE 1NTZE 4HM8A 3C0DA 4QDFA 4QURA 5KLVE 2XSOA 4AAYB 3CXHE 5HL4A 1SQBE 2CKFA 4HM4A 4HJLA 3CX5E 2NUMA 1P84E 5KLIC 2XRXA 2BCCE 3VCAA 2YIUC 2XR8A 3GOBA 3GZXA 2DE5D 4HM2A 3VMGD 3TGUE 2E74D 1L0NE 3GB4A 2DE7D 1RFSA 4NBFD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMK A;  4HM0 A;  1VCK A;  1VM9 A;  3H1L E;  4NBE D;  1O7G A;  3H1I E;  3L73 E;  2QJK C;  3FOU A;  1NU1 E;  2IBZ E;  2YFL A;  4HKV A;  1KB9 E;  1WQL A;  4AIV A;  2YFJ A;  1KYO E;  1RIE A;  2E76 D;  1SQV E;  2ZYL A;  4QDF B;  1O7M A;  2I7F A;  2QPZ A;  2BMR A;  2HMN A;  2B1X A;  3L74 E;  1NYK A;  1O7P A;  3EN1 A;  4QDD A;  4QUP A;  1EG9 A;  1UUW A;  2D2C D;  4QUQ A;  1NTK E;  5AEU A;  1FQT A;  2Q3W A;  2HML A;  3GCE A;  3GTE A;  3EQQ A;  3CWB E;  2E75 D;  2B24 A;  4PD4 E;  1ULI A;  3H1K E;  1SQX E;  1EZV E;  2NVF A;  2QJY C;  2HMM A;  2FYN C;  1O7N A;  3H1J E;  2YVJ B;  2NUK A;  4HM1 A;  1O7W A;  4NBG D;  1G8J B;  3GTS A;  4HM6 A;  4QDC A;  3BCC E;  2XSH A;  4NB8 D;  5CXM A;  1BE3 E;  4NBH D;  2E4Q A;  4NB9 D;  3DQY A;  2BMQ A;  2QJP C;  3N0Q A;  3VMH D;  5BOK A;  2HMJ A;  3GL2 A;  4OGQ D;  1JM1 A;  4P1C H;  3L71 E;  2E4P A;  2BMO A;  1SQP E;  4EMJ B;  1Q90 C;  1VF5 D;  1BCC E;  3GZY A;  4HM5 A;  4NBB D;  4QCK A;  3L72 E;  4D6T E;  2GBW A;  2NVE A;  4HM3 A;  1ULJ A;  2ZT9 D;  1NDO A;  1NTM E;  1G8K B;  1SQQ E;  3GL0 A;  2NWF A;  3D89 A;  3L75 E;  2HMO A;  2GBX A;  2JZA A;  2YFI A;  2FYU E;  4NBD D;  1UUV A;  3VMI D;  2JO6 A;  5AEW A;  4U3F E;  1PP9 E;  1ZRT E;  3H1H E;  3GKE A;  5KKZ C;  4H13 D;  1PPJ E;  2NVG A;  1SJG A;  4PV1 D;  2A06 E;  3L70 E;  1O7H A;  1BGY E;  2DE6 D;  4H0L D;  4H44 D;  4NBA D;  4NBC D;  3VCP A;  4HM7 A;  3AZC A;  4P1B H;  1L0L E;  1NTZ E;  4HM8 A;  3C0D A;  4QDF A;  4QUR A;  5KLV E;  2XSO A;  4AAY B;  3CXH E;  5HL4 A;  1SQB E;  2CKF A;  4HM4 A;  4HJL A;  3CX5 E;  2NUM A;  1P84 E;  5KLI C;  2XRX A;  2BCC E;  3VCA A;  2YIU C;  2XR8 A;  3GOB A;  3GZX A;  2DE5 D;  4HM2 A;  3VMG D;  3TGU E;  2E74 D;  1L0N E;  3GB4 A;  2DE7 D;  1RFS A;  4NBF D; 
#chains in the Genus database with same CATH topology
 5TIS H;  4TLF A;  1Y9B A;  2QJK C;  3FOU A;  1NU1 E;  5AVQ B;  3R2P A;  1RF0 C;  3HE4 A;  1OIP A;  1GL2 C;  4N78 D;  3I55 P;  1LGH B;  1S9K D;  3LID A;  1YJ9 P;  4JPZ B;  2B1X A;  4L76 A;  4DT0 A;  2ITA A;  3A5T A;  2BCC D;  2QVA A;  3OJA B;  1K8A Q;  1FZG A;  4IL6 H;  1U57 A;  4N3Y B;  2WMM A;  1W2E A;  1Q81 Q;  2YVJ B;  5APW A;  1LT9 A;  1T2K D;  1VQ7 P;  1XTG B;  2KZI A;  2WSC J;  5CXM A;  1BE3 E;  1CI6 B;  3CXH D;  2Q3I A;  2HMJ A;  1S3J A;  4H44 B;  2QIW A;  3L74 D;  4N6J A;  1K05 A;  1L0N D;  1VQO P;  1KTM A;  4HM5 A;  2AEF A;  2PP6 A;  2ZXE B;  4Y99 B;  3GMA A;  1JTH B;  4H13 D;  1HF9 A;  1ZOY C;  2A45 H;  4D6T G;  1URQ A;  4NBC D;  2YNY A;  3BCC D;  1FOS F;  3HE5 B;  3KDP B;  3RL0 g;  4QDF A;  2YO3 A;  4IFD K;  3H32 B;  2QG4 A;  1JM0 A;  1H8A A;  2WSE J;  1USE A;  2A06 G;  3WU2 E;  2DE7 D;  2WT7 B;  5AVX B;  3AE3 C;  2KSE A;  3VYI A;  3H1K J;  2KOG A;  3RL0 B;  1RIE A;  3AE1 C;  2I7F A;  1SFC D;  1L0L K;  1NTZ K;  3MTU E;  1RH5 B;  2YXR B;  1Q7Y Q;  2IDB A;  4ASW A;  1AQT A;  1EG9 A;  3H25 A;  1JMM A;  3KYQ A;  4ZMD A;  5AVY B;  1VQP P;  1KQL A;  3CPW O;  4L74 A;  5L8R J;  3O6Q B;  4OH8 B;  2K9J B;  3TGU G;  3PP5 A;  1JOC A;  3L73 D;  1NU1 K;  4NBG D;  3KQG A;  4K3A A;  3H1H J;  1OWA A;  3VMY A;  2QJP C;  3N0Q A;  2VRS A;  3ZDM A;  2XU6 A;  2R3C A;  2BMO A;  2K3R A;  2H43 A;  5KLV J;  2GUS A;  3M9H A;  1VF5 D;  1BSH A;  1SQQ J;  4PJ0 E;  2NWF A;  2Y0D A;  2JZA A;  3KZI H;  3H1I D;  1EDK A;  3P8M C;  4WY4 D;  2AEJ A;  2WVR A;  1NO4 A;  1PGJ A;  4N78 E;  3MUD A;  1S9K E;  2QM8 A;  3II6 A;  1EXJ A;  2YKO A;  2E75 C;  4UB8 H;  2O1J A;  2PGD A;  1VQL P;  2CKF A;  2BCC E;  2YIU C;  5KKZ B;  3G6E P;  2XND H;  1USD A;  4NBF D;  3LW5 J;  1A02 F;  4NBE D;  5CCH A;  5AVU B;  3AEA C;  4U3F D;  1ZW0 A;  3H1J J;  1N2D C;  3VP9 A;  2WPR A;  1LTB C;  5APS A;  3H1L G;  3L74 E;  3G3Z A;  3HE5 A;  3C1L A;  2QJK B;  2IBZ G;  5C39 A;  3I5C A;  2Q3W A;  2R5B A;  4I2L C;  3CX5 I;  3C9I A;  3HD7 C;  1GL2 B;  2SPZ A;  1LTS C;  2NPS C;  1IC2 A;  2M5A B;  1VQ4 P;  3M9Q A;  1NTK G;  3BCC E;  2RH0 A;  4JBZ A;  1PL5 A;  1SQV D;  2I1J A;  3RGU A;  2D2C C;  1R5L A;  1N7S C;  1SQP J;  1Z56 A;  5APU A;  1SQV G;  1KIL A;  3D6Z A;  3PLN A;  2IPP A;  2HMO A;  1ZME C;  1HBW A;  2E43 A;  2WPV B;  1L4A C;  4HB1 A;  1JY3 P;  2N1T A;  1BCC G;  1Y8A A;  5AW8 B;  2DE6 D;  1IK9 A;  1KMI Z;  1ZN5 A;  2IYO A;  1U7M A;  3Q2Y A;  1FOS E;  5B66 E;  3VCA A;  3S4R A;  2O1K A;  3TGU E;  1T2K C;  3HRN A;  3L37 A;  3WUU A;  4XFJ A;  3L73 E;  1SQX J;  2Z5I A;  4NPD A;  2YMY A;  1QL2 A;  3V2Q A;  4LC1 A;  2W27 A;  2B9B A;  5APV A;  1YTZ T;  2HYN A;  3GCE A;  3WUT A;  2KP8 A;  4H13 C;  1SQB G;  2LR2 A;  2WPQ A;  2OYI C;  3RK2 D;  5AW9 B;  2HG5 D;  1N73 C;  1ZR2 A;  3L75 J;  3GHG C;  1BGY D;  3T97 B;  2AEM A;  1FAV A;  1L0L D;  1NTZ D;  1LTJ C;  3P8C D;  1M90 Q;  3V5B A;  3L70 J;  1K73 Q;  1QVG O;  2K9Y A;  1T3J A;  5AVS B;  1Q2N A;  3NFQ A;  1MFT A;  2B87 A;  2QJP B;  2POH A;  1SS1 A;  1RF0 A;  3TK1 A;  4U3F E;  1R8E A;  1SFC C;  2NZ2 A;  1BSN A;  3AEB C;  3V2N A;  1GL2 A;  1RE4 C;  3V4W A;  3M0D C;  1RY3 A;  2O01 N;  3Q5P A;  3WUV A;  2P67 A;  3E1I A;  1IJD B;  1Q82 Q;  3LIE A;  2E5T A;  4HJL A;  5AW1 B;  1LNQ A;  2OTK E;  5B5E E;  3IFM A;  1O7G A;  1HJB A;  2CK3 H;  2E75 B;  2P10 A;  3AE2 C;  4BXL A;  3D6Y A;  1BE3 D;  2YIU B;  3RBX A;  3TSI A;  3EFF K;  5EFW B;  1VF5 C;  5TJH A;  1SQV E;  3MGN A;  3CC2 P;  2OGU A;  3L71 J;  4IFF A;  4WY4 C;  1J2J B;  2R44 A;  1EC5 A;  3EQQ A;  4YPC A;  1M1J A;  1EXI A;  4UB6 E;  2PRR A;  3N4X A;  2HMM A;  3S9O A;  4HM6 A;  4NB8 D;  3A7O A;  1KYO D;  1VQN P;  5KAI H;  2OAR A;  4YXW H;  3H1K G;  1M56 D;  3HD7 B;  1MZ9 A;  2NPS B;  3I56 P;  4P1C H;  5APY A;  3L72 J;  3CL3 D;  3EWK A;  1LTI C;  4O9B A;  4PD4 D;  1FDI A;  4LGD E;  2D2C B;  1PP9 J;  4EOT A;  1VQ6 P;  1N7S B;  1NOH A;  3BRT B;  1OXZ A;  2YMK A;  3JCU H;  2NRG A;  3TYY A;  5KTB A;  2Q1K A;  1PGQ A;  2G3A A;  1EZV I;  1KQS O;  3B71 A;  3AE4 C;  2RN0 A;  4AAY B;  5CJ0 A;  1SQB E;  2WWW A;  3BAS A;  4HM4 A;  2NUM A;  3CC4 P;  1L4A B;  1LJ2 A;  2C0W A;  5KAF E;  1AVO A;  2N9B A;  4W7Z A;  3CX5 H;  4IOI H;  2HOD B;  4JF7 A;  4IFM A;  2WZ7 A;  2JWD A;  3AEC C;  2Q5U A;  2FYU D;  2FYZ A;  3HD7 D;  3NXS A;  5AVZ B;  1SQQ G;  4DCK A;  3P8C E;  4RO0 A;  2E76 D;  1OX3 A;  4ZNC A;  1JEK A;  2OYO A;  2ZYL A;  1KFM A;  4QMA A;  5APX A;  2IX7 C;  2PFX A;  2P7J A;  1O7P A;  3EN1 A;  1UUW A;  2D2C D;  4QUQ A;  1N7S D;  2KLU A;  2HML A;  1P84 I;  2Y0E A;  4RJT A;  3LW5 H;  1O7N A;  4W7Y A;  5K5G B;  3UIA A;  1G8J B;  1FZE A;  3VP8 A;  1L4A D;  4H13 B;  1AA0 A;  2ZFC A;  3CCV P;  1SQV K;  2BMQ A;  2OYI B;  3GL2 A;  1LP1 B;  3RK3 D;  1N73 B;  3HUS C;  3H1J G;  4C7R A;  3GHG B;  1HJ0 A;  1IFD A;  3BVH A;  1LTJ B;  3QWO C;  4MN4 C;  2C0X A;  1LWU C;  1G2C A;  2IZ0 A;  1NU1 J;  1KB9 I;  4R4L A;  3FXD A;  4R4M A;  4QUR A;  2IYP A;  3CCJ P;  2CPB A;  2KUB A;  3RK2 C;  1SFC B;  1KZU B;  3CXH H;  1BDC A;  1LTG C;  2NPS A;  1FZF A;  5AW0 B;  4D6T D;  4AYC A;  1SQP G;  3SSU A;  1NJI Q;  1PZQ A;  2WSF J;  3F89 A;  1ZRT D;  2HFE D;  2YFL A;  5KJ7 D;  4I1L A;  1KYO E;  1RF1 A;  2A45 G;  2A06 D;  1NWQ A;  2QPZ A;  3Q3D A;  1G1I A;  2JO1 A;  1SQB K;  4Y28 J;  1WMK A;  1GW3 A;  4KT0 J;  1VF5 B;  4PD4 E;  3GF3 A;  4W80 A;  2HOD A;  2KYV A;  3AEF C;  1R5S A;  2L5G B;  4WY4 B;  5E79 H;  2LKM A;  3L35 A;  1SQX G;  4BRY B;  3TGU D;  2DW3 A;  4QCK A;  3TNU B;  1NTM J;  1YIT P;  1G8K B;  1SQQ E;  4XE5 B;  1NHL A;  3PRJ A;  2FYU E;  1S5L E;  3USS A;  1RHZ B;  2JO6 A;  2RKL A;  2QEX P;  2NVG A;  1DX7 A;  2H89 C;  1JY2 O;  1CZQ A;  3B5N C;  2WSS H;  3VTP C;  1N86 A;  4P1B H;  3PH0 A;  3L75 G;  2E42 A;  3CI9 A;  4EDF A;  5TIS E;  1LP1 A;  3L70 G;  3VMG D;  1DIP A;  5GTH H;  4RKU J;  1DH3 A;  3GHG A;  1YJW P;  3G4S P;  3R4Y A;  2L91 A;  1AV1 A;  1OW6 A;  3D70 A;  1KC8 Q;  3A0H H;  2WPS A;  1CI6 A;  4WBA A;  3RK3 E;  1NAF A;  4IL6 E;  2K1A A;  2Z5H A;  4H0L B;  5AEU A;  5AW5 B;  3D71 A;  1SVF A;  1SFC A;  5AW2 B;  1M8O B;  3CCQ P;  1RQV A;  2FYN C;  3H1L D;  3M0D A;  1JTH A;  2HLO A;  3GTS A;  2IBZ D;  3V2P A;  1OVU A;  3SWY A;  1JY2 N;  3P32 A;  3U59 A;  2M0B A;  3NTN A;  1LT9 C;  1HVV A;  3V6I A;  1SQP E;  3H32 A;  2Q7C A;  2M3B A;  3AE7 C;  4D6T E;  1NTK D;  2BCC J;  1JO5 A;  2KNC B;  1D7M A;  1OMI A;  1J1E C;  2FKW B;  2KS1 B;  3CCL P;  3Q1M A;  2O01 J;  2E76 C;  1AJY A;  2AXC A;  3EQ2 A;  3L71 G;  2WT7 A;  3HUS B;  1ZRT E;  2YO2 A;  1GDT A;  1WT6 A;  2A06 E;  4H0L D;  5H2F H;  4WVZ A;  5CCG D;  3B4S A;  4GKG A;  4WY4 A;  3N7N A;  1LWU B;  4DJG A;  4B86 A;  2H8P D;  3L74 J;  1W5C E;  1BCC D;  1L0N J;  1OW7 A;  1P84 H;  3L72 D;  2XZR A;  3GB4 A;  1EQ7 A;  2HMK A;  1SQQ K;  4HM0 A;  1VCK A;  2R5D A;  2FYU K;  1AVY A;  3L72 G;  3TNU A;  1UII A;  2R3S A;  3O6Q A;  3RK2 B;  2K9J A;  1IO4 A;  3RK3 C;  1VQK P;  4IL6 X;  4HKV A;  1WQL A;  3HTK B;  2YFJ A;  4OVN F;  1PP9 G;  3GLM A;  3BCC J;  2BMR A;  4I7Z C;  3AED C;  2QRX A;  4YTP C;  3CWB J;  3EFG A;  4C46 A;  3CCS P;  2FFD C;  1ULI A;  1QL1 A;  2HPC B;  1RQU A;  4GDO A;  2UWJ E;  3VMA A;  1KB9 H;  1DD4 A;  3A2A A;  2B89 A;  1JCC A;  2OQQ A;  5CMZ A;  3DQY A;  1SQB D;  5BOK A;  3TDK A;  2V7Q J;  4OGQ D;  3MIW A;  2ZXX A;  2IFM A;  2E4P A;  3CXH I;  4C7N B;  2AXT H;  3QH9 A;  3VMX A;  2ZVO B;  2QSI A;  3KZI E;  1OFC X;  5KJ7 C;  3D89 A;  2YFI A;  5M1B A;  1YJN P;  1CSB A;  3L36 A;  4M3L A;  3AE8 C;  3M06 A;  1JCD A;  1IFJ A;  3L73 J;  4UB8 E;  4HM7 A;  1ZP0 C;  3F5H A;  3SFE C;  2XSO A;  1KIL E;  1M1K Q;  1HTL C;  2PAJ A;  2E5Y A;  5KLI C;  2XRX A;  1SQP K;  2I8D A;  1PPJ G;  1QGK B;  3B5N B;  2E74 D;  4AQR D;  2K37 A;  1VM9 A;  4JYB A;  3H1L E;  3CCM P;  3H1I J;  2KNC A;  3VMZ A;  2KS1 A;  2M5A A;  2IBZ E;  4ASV A;  4AIV A;  3BRV B;  3MP7 B;  3HUS A;  3FGA D;  3O8Z A;  3JSV C;  1NU1 G;  4BWN A;  1NTK E;  3NMD A;  1FZA A;  1LWU A;  4LLH A;  3CCR P;  2R32 A;  1IFI A;  2WSF H;  2Y9Z A;  4EIJ A;  4U3F J;  3HE4 B;  2E4Q A;  4YXD C;  1T3U A;  3B5N D;  3HTK A;  1VDF A;  2FYN B;  3SWK A;  1BCC E;  3L72 E;  4HM3 A;  2ZT9 D;  3ITK A;  1NDO A;  2GBX A;  3AEE C;  3H1K D;  3M0A A;  3W67 A;  1PP9 E;  1LT9 B;  2FXM A;  4OWF A;  2V4H A;  2IFN A;  1KIL C;  2KI7 B;  2KXP B;  3KPE A;  3GG2 A;  1J1E B;  3E7K A;  3CME P;  4KHX A;  1A02 J;  1QEX A;  2E76 B;  1FZC C;  1CW5 A;  1EDI A;  2N1T C;  2DE5 D;  4HH2 A;  4ZKP A;  4C7N A;  1JUN A;  4GIF A;  3WU2 H;  1FZB A;  1NTM G;  3PHL A;  3H1H D;  1KB9 E;  3T97 A;  2LXC B;  5APQ A;  5AVV B;  1HGZ A;  1HWT C;  2GM4 A;  2BEQ D;  1VQ5 P;  1E79 H;  4QDF B;  3H1H G;  5KLV D;  2OYH C;  3CCU P;  1Q86 Q;  3CX5 D;  3RK3 B;  2AXT E;  2MKV A;  4EYY Q;  1SQQ D;  2KB7 P;  1SP4 A;  5KLV G;  1MUU A;  5DJU B;  2P58 A;  2Q6Q A;  1IZN B;  4H0L C;  1ZXG A;  1RE3 C;  5CCG C;  1GK4 A;  2FXP A;  4I7Z B;  4K35 A;  3U1C A;  4QDC A;  1X79 B;  3CLQ A;  1VPC A;  3CD6 P;  1FJK A;  2FFD B;  3V2R A;  1EDJ A;  1SLQ A;  2N9Y B;  1FS0 E;  1NTK K;  2NVE A;  1URQ D;  3FWL A;  3PJS K;  5AEW A;  3AE9 C;  3P7K A;  1VQM P;  2JR8 A;  4DOJ A;  3H1J D;  1KQG B;  1BGY J;  3Q5R A;  5AW4 B;  1L0L J;  1NTZ J;  5HL4 A;  3AE6 C;  2YKQ A;  5AVR B;  2XDJ A;  1KV4 A;  3GZX A;  2FY8 A;  5CHX A;  1RFS A;  1QX8 A;  2P2U A;  2O01 H;  1Q90 D;  4TT3 H;  4PV1 C;  1ZLL A;  4OGQ C;  2BCC G;  5KLI B;  3PTZ A;  4CPG A;  1EDL A;  3OAK A;  2ZYD A;  1UIX A;  1FU1 A;  1SQP D;  1L2P A;  2HMN A;  3HD7 A;  4QDD A;  1Y47 A;  1FJP A;  1FQT A;  3GTE A;  3KHU A;  1HUC A;  3H1K E;  1FC2 C;  4KJM A;  1NH4 A;  2J59 M;  1XTC C;  3L74 G;  1L0N G;  4GOF A;  1N7S A;  5KAI E;  1T6A A;  1BE3 J;  1M1J C;  5CBO A;  1S72 P;  2E74 C;  1JMB A;  4GOE A;  1YBK A;  3MZW B;  2ZYA A;  4EMJ B;  3SWF A;  3IR9 A;  1FDM A;  1L4A A;  3IF4 A;  3BCC G;  1GK6 A;  1NTM E;  3GL0 A;  3CWB D;  1GMJ A;  2C9N Y;  1X8Y A;  1E5W A;  3FXE A;  3JCU E;  1SQX D;  2FXO A;  3MD0 A;  3MHV A;  3H1H E;  3CWB G;  3GKE A;  1KFN A;  1U7J A;  2BAS A;  2W8Z A;  2Y0C A;  4H44 D;  3G9R A;  2M8R A;  2JEE A;  5KLV E;  2XKM A;  4EI2 A;  2V7Q H;  3CX5 E;  5CCH D;  2FFD A;  1KIL B;  3VOP A;  1FBM A;  2OTJ P;  2ZJS E;  2JJL A;  5CJ4 A;  5B66 H;  5AW6 B;  3C8V A;  1AQ5 A;  2XNX A;  4JQ0 D;  5CBN A;  4L75 A;  3L75 D;  1FZC B;  1YYC A;  3ABV C;  1IFM A;  2N1T B;  1ZV8 A;  3K5B A;  3L70 D;  1VQ8 P;  5BU8 B;  2ZT9 C;  1YHQ P;  2OYI A;  1HGV A;  1N73 A;  3L73 G;  4L73 A;  2WQY C;  5KJ7 A;  1H88 A;  1DD3 A;  3IAO A;  3CC7 P;  2W6J H;  1LTJ A;  2OYH B;  3RL0 D;  1KQF B;  2KLV A;  2FYU J;  3H1J E;  3RBZ A;  2ZAE B;  1N7L A;  2I1K A;  4XA4 A;  1OZH A;  1KIL D;  4NBH D;  3H1I G;  3VMH D;  1JY3 O;  1FE6 A;  1KYO I;  1H0T B;  1W2B O;  3KXD A;  4NBB D;  2GUV A;  2N1T D;  1RE4 A;  1FDO A;  5BU5 A;  3FWN A;  3TF5 A;  2KZJ A;  1YQ3 C;  4NBD D;  2LXB A;  1EZV D;  4Z1M H;  4PD4 I;  1EZV G;  3AEG C;  1S2E A;  1S5L X;  4JYC A;  3AZC A;  2W83 C;  5GTI H;  2Q9I A;  2KSJ A;  3CXH E;  2QA4 P;  1S4X A;  3JC2 2;  1GW4 A;  4U3F G;  3L71 D;  4HJG H;  2FBW C;  3WMM 0;  4HM2 A;  4NPE A;  1X0T A;  1L0N E;  1PV3 A;  2O3J A;  1JY2 P;  2B87 B;  1NTM K;  5B5E H;  1MV8 A;  1YI2 P;  2H88 C;  2K88 A;  2GA1 A;  2JKV A;  1QVF O;  3GW6 A;  3G71 P;  2HR3 A;  4HYT B;  1O7M A;  2ZVN B;  1URQ C;  1PGP A;  5KLV K;  1NGM B;  2KK7 A;  1J1D C;  4BRY A;  1BDD A;  3CMA P;  4PV1 B;  1JY3 N;  1PGO A;  4OGQ B;  5APT A;  4I6M C;  1P84 D;  4A7P A;  1RF1 C;  3CWB E;  3M91 A;  4D6T J;  1PP9 D;  1SQX E;  1DEB A;  2QJY C;  2CPS A;  2NUK A;  4UB6 H;  4HM1 A;  5E79 E;  2XSH A;  4GT1 A;  3OA7 A;  1FZC A;  1X9V A;  1M57 D;  4U7J A;  1NYH A;  5AVW B;  1JM1 A;  1HH0 A;  1Q90 C;  2OTL P;  5AVT B;  2GBW A;  1KD1 Q;  1GL2 D;  1M1J B;  2ZYG A;  3L75 E;  2E74 B;  1UUV A;  1KB9 D;  1IK7 A;  2Q3E A;  3VN0 A;  2JWA A;  4PV1 D;  3L70 E;  2OYH A;  3C0D A;  1NKZ B;  1YTZ I;  5GTH E;  2B88 A;  3A0B H;  1H89 A;  2XR8 A;  3AE5 C;  3B8E B;  2KIK A;  1AFO A;  3TGU J;  2WIT A;  1NVO A;  1RE3 A;  3S1K A;  5CCG A;  3W68 A;  1H0T A;  5KAF H;  3A0H E;  4RES B;  1X22 A;  1NAY A;  3H1I E;  4NPF X;  1GZL A;  1ZR4 A;  2G8Y A;  1PPJ D;  1YQ4 C;  2A45 I;  4WWI A;  1NYK A;  3MUD C;  1BGY G;  3A3Y B;  1L0L G;  1NTZ G;  1MKM A;  3GF7 A;  2W90 A;  1L0N K;  4H44 C;  1EZV E;  2ZT9 B;  1WRG A;  1KN7 A;  2NVF A;  2RMZ A;  1O7W A;  1NU1 D;  1G1J A;  5CCH C;  3CCE P;  1PFI A;  4Y99 C;  1K04 A;  5GTI E;  1M7L A;  5BVZ A;  1OVR A;  2WSC H;  3L71 E;  3BAT A;  1ULJ A;  2J58 A;  1DEE G;  1SQX K;  3VMI D;  2M3E A;  2P1J A;  1JB0 J;  5H2F E;  4HKZ H;  3H1L J;  3SFD C;  3IN6 A;  4WB4 A;  4HM8 A;  2XV5 A;  1OW8 A;  1LTT C;  2IZ1 A;  1IFN A;  2Z4E A;  1P84 E;  1BE3 G;  3RL0 C;  2QE7 H;  1NTK J;  2WSE H;  1IFP A;  2BEZ F;  1JNM A;  5DJT B;  1G2C B;  2HPC A;  4AUW A;  2QM7 A;  2W6B A;  1SQV J;  1S1C X;  3H6P A;  1KYO H;  2JDI H;  3FX0 A;  1NKN A;  3V4Q A;  4QUP A;  1NTM D;  1GU5 A;  2H7H A;  2E75 D;  3L4F A;  5AW3 B;  2B24 A;  1BCC J;  1URQ B;  1TU3 F;  4PD4 H;  1GU4 A;  1N8R Q;  1J1D B;  4GOD A;  1KOR A;  1YIJ P;  4DZO A;  3OW2 O;  2WTY A;  1RF1 B;  2MJZ A;  1OVV A;  2YXQ B;  4NB9 D;  2JP3 A;  2IBZ I;  2QJY B;  1PIX A;  3Q5S A;  2Y9Y A;  3A0B E;  1K9M Q;  3GZY A;  4ZKU A;  2YKP A;  3B5N A;  2W6A A;  1QLE D;  3E1R A;  2J5U A;  1VL2 A;  5KKZ C;  2C9L Y;  1S5L H;  1PPJ E;  1SJG A;  1T8Z A;  1LTA C;  1O7H A;  1BGY E;  4NBA D;  3VCP A;  1VQ9 P;  2NPS D;  1L0L E;  1NTZ E;  1GTW A;  2FYU G;  1SQB J;  3GOB A;  1GD2 E;  1MFZ A;  3M9B A;  3U1A A;  5AW7 B;  4PJ0 H;  1LT1 A; 
#chains in the Genus database with same CATH homology
 2HMK A;  4HM0 A;  1VCK A;  1VM9 A;  3H1L E;  4NBE D;  1O7G A;  3H1I E;  3L73 E;  2QJK C;  3FOU A;  1NU1 E;  2IBZ E;  2YFL A;  4HKV A;  1KB9 E;  1WQL A;  4AIV A;  2YFJ A;  1KYO E;  1RIE A;  2E76 D;  1SQV E;  2ZYL A;  4QDF B;  1O7M A;  2I7F A;  2QPZ A;  2BMR A;  2HMN A;  2B1X A;  3L74 E;  1NYK A;  1O7P A;  3EN1 A;  4QDD A;  4QUP A;  1EG9 A;  1UUW A;  2D2C D;  4QUQ A;  1NTK E;  5AEU A;  1FQT A;  2Q3W A;  2HML A;  3GCE A;  3GTE A;  3EQQ A;  3CWB E;  2E75 D;  2B24 A;  4PD4 E;  1ULI A;  3H1K E;  1SQX E;  1EZV E;  2NVF A;  2QJY C;  2HMM A;  2FYN C;  1O7N A;  3H1J E;  2YVJ B;  2NUK A;  4HM1 A;  1O7W A;  4NBG D;  1G8J B;  3GTS A;  4HM6 A;  4QDC A;  3BCC E;  2XSH A;  4NB8 D;  5CXM A;  1BE3 E;  4NBH D;  2E4Q A;  4NB9 D;  3DQY A;  2BMQ A;  2QJP C;  3N0Q A;  3VMH D;  5BOK A;  2HMJ A;  3GL2 A;  4OGQ D;  1JM1 A;  4P1C H;  3L71 E;  2E4P A;  2BMO A;  1SQP E;  4EMJ B;  1Q90 C;  1VF5 D;  1BCC E;  3GZY A;  4HM5 A;  4NBB D;  4QCK A;  3L72 E;  4D6T E;  2GBW A;  2NVE A;  4HM3 A;  1ULJ A;  2ZT9 D;  1NDO A;  1NTM E;  1G8K B;  1SQQ E;  3GL0 A;  2NWF A;  3D89 A;  3L75 E;  2HMO A;  2GBX A;  2JZA A;  2YFI A;  2FYU E;  4NBD D;  1UUV A;  3VMI D;  2JO6 A;  5AEW A;  4U3F E;  1PP9 E;  1ZRT E;  3H1H E;  3GKE A;  5KKZ C;  4H13 D;  1PPJ E;  2NVG A;  1SJG A;  4PV1 D;  2A06 E;  3L70 E;  1O7H A;  1BGY E;  2DE6 D;  4H0L D;  4H44 D;  4NBA D;  4NBC D;  3VCP A;  4HM7 A;  3AZC A;  4P1B H;  1L0L E;  1NTZ E;  4HM8 A;  3C0D A;  4QDF A;  4QUR A;  5KLV E;  2XSO A;  4AAY B;  3CXH E;  5HL4 A;  1SQB E;  2CKF A;  4HM4 A;  4HJL A;  3CX5 E;  2NUM A;  1P84 E;  5KLI C;  2XRX A;  2BCC E;  3VCA A;  2YIU C;  2XR8 A;  3GOB A;  3GZX A;  2DE5 D;  4HM2 A;  3VMG D;  3TGU E;  2E74 D;  1L0N E;  3GB4 A;  2DE7 D;  1RFS A;  4NBF D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...