3L74E

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 48
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l74E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l74E02
4HM2A 1NTZE 2ZYLA 1WQLA 2E74D 2CKFA 3VMGD 1RFSA 4D6TE 2E4PA 3DQYA 2BMOA 3GL0A 2NVGA 3D89A 4PV1D 2DE5D 1JM1A 4HM5A 2NUMA 4HJLA 1RIEA 4P1CH 4H44D 2IBZE 1Q90C 1KYOE 3GKEA 3H1KE 3GZYA 2DE6D 3CXHE 1PPJE 2XRXA 4OGQD 4QDFA 2HMOA 3EQQA 3GB4A 4QDDA 4EMJB 2GBWA 1NTME 2BCCE 1VCKA 4HM8A 4QURA 4HM3A 1NTKE 2FYUE 2E76D 4HM7A 3GL2A 2YIUC 3CX5E 1NU1E 1O7WA 4AAYB 4HM0A 3EN1A 2XSHA 1NDOA 1L0NE 1O7NA 1UUVA 3VCPA 5KKZC 4PD4E 2QJKC 4H13D 2A06E 1FQTA 5CXMA 1SQXE 2E75D 3H1JE 2YFIA 4AIVA 3GTSA 3L72E 2B1XA 4NBED 2HMMA 1ULIA 2XSOA 4HM1A 2BMRA 4NB8D 5BOKA 1O7HA 4QCKA 1SJGA 3H1HE 2HMNA 2QJPC 2DE7D 1KB9E 1ZRTE 3GTEA 3VMHD 3H1LE 4HKVA 4NBFD 2E4QA 1SQVE 4HM4A 2QPZA 3CWBE 1SQQE 1ULJA 3GOBA 1O7MA 5AEWA 3GCEA 4QDCA 2Q3WA 1BE3E 3N0QA 2NVFA 4NBGD 1L0LE 2HMJA 5KLIC 1BCCE 3TGUE 1P84E 2HMLA 1NYKA 1SQPE 3L70E 1G8KB 1VF5D 5AEUA 4H0LD 2JO6A 1O7PA 2FYNC 2NUKA 1UUWA 2GBXA 1EZVE 4NBHD 1BGYE 3AZCA 3FOUA 1EG9A 1PP9E 2YFJA 4QDFB 3H1IE 2BMQA 1G8JB 4NB9D 4NBCD 4HM6A 2I7FA 2D2CD 2XR8A 3BCCE 3C0DA 2B24A 4NBBD 2JZAA 5HL4A 4QUQA 1SQBE 1VM9A 2YVJB 2ZT9D 3L74E 3VCAA 2HMKA 3GZXA 4NBDD 1O7GA 3L71E 5KLVE 2QJYC 3L73E 2NWFA 4NBAD 4QUPA 2NVEA 4U3FE 3VMID 2YFLA 4P1BH 3L75E
chains in the Genus database with same CATH superfamily
4YTPC 1VQ7P 1SQBJ 1WQLA 1L0LD 2CKFA 1Q82Q 1RFSA 3II6A 1OWAA 3V6IA 5B5EE 1VQ4P 5APSA 2QM7A 3BCCJ 2PP6A 3TF5A 2Y0CA 1ZP0C 2N9BA 4HKZH 1N8RQ 2FYUJ 4MN4C 1IK9A 4AAYB 1NU1E 2QRXA 4HB1A 1FDIA 2WPRA 3MTUE 1JMBA 3MP7B 1H0TA 1LTBC 2LXBA 5CJ0A 1N7SB 1R5SA 3CWBJ 1VQ5P 1L2PA 1KMIZ 3OJAB 1PZQA 1QVGO 1IO4A 1IZNB 1SQVE 1SFCB 1URQA 2QPZA 4HM4A 1AVOA 2K9YA 2SPZA 4QDCA 4L74A 1RY3A 4NBGD 2HMJA 3SSUA 2KNCB 3TGUE 1YQ3C 1EDLA 2KNCA 1SS1A 1FBMA 2KB7P 2I8DA 2QEXP 1VQLP 1SQPJ 5APVA 1BSNA 3AZCA 1KQGB 3V4QA 1SVFA 3BASA 3RL0g 3CCLP 1AQTA 1URQC 4R4LA 1L0LJ 3P8MC 3GZXA 3CPWO 1JMMA 2W6BA 2YFLA 3AEEC 1X22A 3HTKB 3HTKA 3B4SA 3OAKA 3L71J 4B86A 3RK2D 1T3JA 4NPEA 2DE5D 2M5AB 3CWBD 1KN7A 2XRXA 1SQXG 1DD4A 3I5CA 2WSFH 4HM3A 4PV1C 1KQSO 2OYIC 1N86A 1PP9D 2XSHA 1NDOA 3RGUA 5M1BA 1YTZT 2QJKC 1CZQA 2A45I 4WBAA 1SQXD 1X79B 3GTSA 3L74D 2D2CB 2JDIH 3VN0A 3FX0A 1K9MQ 1HVVA 4ASVA 1IFPA 1X0TA 2DW3A 1GDTA 2G8YA 4JBZA 2O1KA 2AEMA 3AEGC 2PGDA 5CBNA 1PGJA 2FYUK 1HH0A 2OGUA 1Y9BA 2ITAA 1EXJA 1LTSC 1NWQA 3T97A 2OARA 3T97B 2QJYB 3HUSA 3GMAA 4N6JA 1CSBA 1JNMA 3H32B 2YXRB 5APWA 1NKNA 1FU1A 2KXPB 3A5TA 3GLMA 1NGMB 1SQVG 2A45G 3H6PA 4Z1MH 2E76C 1NTZJ 1LTAC 1FZEA 2NRGA 5KTBA 1LP1A 1PGOA 2M3BA 3HUSC 2E4PA 3GL0A 2NVGA 4UB6H 3D89A 2FFDC 4HM5A 2Q9IA 5AW9B 4P1CH 4H44D 3P8CD 2Q3IA 1SFCA 1DIPA 2M3EA 2FBWC 2WT7A 1NTKJ 1KILA 3MUDC 3CX5E 5KAFE 2R44A 4WWIA 4HJGH 4AYCA 2HYNA 2KSJA 2L5GB 1YJNP 3D6YA 3U1CA 2OTKE 1RE4C 3ITKA 4DZOA 3Q3DA 4HM1A 5KLVD 1WRGA 1KQLA 1KC8Q 4H13C 2HMNA 3M9HA 2O1JA 1SQQD 2YXQB 3H1HJ 1JOCA 4JYCA 1H0TB 2E4QA 3V4WA 4ASWA 3GCEA 1J2JB 2OQQA 1FOSE 2W83C 3H1HG 4YPCA 1SQPE 5AW1B 4PJ0E 3M9QA 2JO1A 5AVRB 3K5BA 3GHGB 1PGQA 4NB9D 2POHA 4NBCD 3VP8A 2JZAA 1L4AD 3L37A 1E5WA 3M0DC 2BEQD 2WTYA 5GTIE 2FXOA 4HM2A 1IFMA 1YIJP 5E79E 2E74D 1RF0C 1AVYA 1T3UA 3GHGC 3DQYA 2R5BA 1AJYA 1PPJG 3H1KG 1LT9C 3IFMA 1Q86Q 4GOEA 1JY3P 5AVUB 2A06G 1G1IA 5KLVG 1SQBG 1HGZA 2E76D 3B5NA 3BRVB 3GL2A 3LW5H 1O7WA 1M90Q 2CPBA 2N1TB 4H13D 1RQVA 2A06E 3Q1MA 2AXCA 2C9LY 3G71P 3HD7A 3S1KA 4EDFA 2I1KA 1KB9E 1ZMEC 3VMHD 3CXHD 4M3LA 1W2EA 3L70D 2Z4EA 1FOSF 3VTPC 2W90A 4IFFA 1YYCA 2HPCA 1JY2O 3H1LG 1EZVE 3VYIA 2JWAA 1EG9A 2RN0A 2XDJA 3CCJP 1NTMK 5CCHD 4W80A 1RE3C 3C8VA 2R5DA 1YITP 2YVJB 3TNUA 5CMZA 2QJYC 3R4YA 1KTMA 3NMDA 4IFMA 5CCGD 1OX3A 3CX5H 3JCUH 1YJWP 1CI6B 1S1CX 4OWFA 2HFED 2R32A 4H44B 2VRSA 3VMAA 3KXDA 5L8RJ 2BMOA 4IL6E 1JM1A 1W5CE 3H1KE 2ZYDA 4N78E 1JO5A 1J1DC 2J59M 1FC2C 1NTMD 4QURA 1GTWA 4O9BA 1NTMJ 2K37A 4KT0J 1FQTA 4XE5B 3H1JE 4AIVA 1HJ0A 3WUUA 2XSOA 1T6AA 3CLQA 4QCKA 1YI2P 3IF4A 2V7QJ 1KORA 1SLQA 4JPZB 2K3RA 3GTEA 5AVYB 4C46A 4WY4A 1UIXA 2O01N 1EDIA 1SQQG 4LC1A 4N3YB 3GOBA 5KAIE 1NTZD 2E5TA 5AVZB 2N1TD 5KLIC 1BCCE 1JUNA 1PPJD 2KP8A 2O01J 1NAFA 1LJ2A 2E76B 3B5ND 2E5YA 1QLED 4OGQC 3FOUA 1PP9E 4PJ0H 3RK2C 5KLVK 3C0DA 2FY8A 4HH2A 1E79H 2B24A 1IFNA 1FZCA 2N1TA 4A7PA 2W6AA 5APTA 4GOFA 3CC2P 2ZFCA 1QVFO 1LT1A 4OH8B 3C1LA 4NBAD 2KS1B 3CCSP 2KS1A 3V2NA 1N7SD 2OYIA 1T2KD 2ZYLA 1FAVA 2WSEH 1WT6A 1MZ9A 2AXTH 2QIWA 3RK2B 2Y9YA 1UIIA 3AE3C 1YQ4C 4BRYB 1FZCC 1GZLA 1GU4A 1SQVD 3EQQA 2CK3H 1NTME 3S9OA 5DJTB 2G3AA 4I1LA 1L0NK 2QG4A 2Q1KA 1NAYA 3A0BE 1SQXE 2B1XA 5APQA 4XA4A 4KHXA 1L0ND 4IFDK 1ZW0A 3QH9A 2MKVA 1ZLLA 1U57A 1S5LH 1ZRTE 1LTJC 3V2PA 1JTHA 3CMAP 2XV5A 1HBWA 1X9VA 1KQFB 5AW7B 3L72J 4WY4D 1S3JA 3N0QA 3M0DA 1EQ7A 4Y28J 2GM4A 2C0WA 5AEUA 2H7HA 2AXTE 3H1IG 2K1AA 2JO6A 2NZ2A 3D6ZA 4GODA 2YFJA 3WU2H 2WPQA 2D2CD 2QJPB 4IL6X 3RK3E 1NTKK 1DEEG 2WWWA 1L4AA 4Y99C 4NBDD 1OVVA 3CCRP 4K3AA 1KYOH 3CC7P 1GL2D 2AEFA 3GG2A 4D6TD 3D71A 1NTZK 2JP3A 3IR9A 3SFDC 1YTZI 2HPCB 3HD7C 1QEXA 1X8YA 4HM7A 3BCCG 1AQ5A 1FZAA 2QVAA 1O7NA 3L35A 3B8EB 1S5LE 1LWUA 2HLOA 3H1KJ 5KJ7C 1RF1C 1BE3J 1H88A 4L76A 5APYA 1PGPA 3L72E 2FYUD 3RK3D 2BMRA 2B88A 1N2DC 1YJ9P 1GD2E 1VQNP 1HTLC 1PP9G 2N9YB 1P84H 3N4XA 1M1JC 3WUTA 2KLUA 1SFCD 2Y0DA 3KHUA 3LW5J 3L70E 1Q81Q 1VL2A 2NUKA 3QWOC 1NOHA 2H88C 3TGUD 1RF0A 1N73B 4HM6A 1JEKA 1LNQA 2WT7B 2ZXEB 1KILB 1K8AQ 1GW3A 2O3JA 1YHQP 1BE3G 5HL4A 5H2FE 3I56P 2M8RA 1OFCX 1IK7A 4U3FG 4D6TJ 4DOJA 3AECC 1NU1G 2BEZF 2ZAEB 4IOIH 2KYVA 1PIXA 3RBZA 3SWYA 1RHZB 1MKMA 1KD1Q 1VQMP 4AUWA 2IBZE 2J58A 1A02F 3H1LD 5AW8B 3GZYA 1SP4A 2OYIB 3VOPA 1L0LK 2AEJA 4JF7A 3BVHA 3O6QB 2D2CC 3L73G 4N78D 1KILD 1FZCB 4ZNCA 1T8ZA 1S9KD 1LTIC 1ZR2A 1BGYD 1VDFA 3CCUP 2I1JA 2HMMA 1VQ9P 2HR3A 3GHGA 3CL3D 5BOKA 1IFDA 1RH5B 4D6TG 1SQPG 1MFZA 1GK4A 1OZHA 4NPDA 3CWBE 3AE1C 3D70A 2NVFA 1R8EA 2C0XA 1H8AA 2IFMA 2HMLA 1S5LX 1EZVD 4I7ZB 3SWFA 2IBZG 1BGYG 2E74C 1U7MA 3IAOA 3RK3B 2GA1A 3BCCE 1NH4A 3H1HD 1FJPA 2YO3A 1MUUA 4WB4A 1HWTC 2OYHA 1U7JA 2Y0EA 1ZRTD 3E1RA 2OYHB 1QL2A 3LIDA 2KOGA 5AW3B 3OW2O 2B87A 2K9JB 1CI6A 1N7SC 2IFNA 1L0NJ 1M1KQ 2FYNB 1WMKA 1GL2B 2IYOA 2NUMA 3EFFK 1KYOI 3JC22 2IBZI 5KKZB 1PPJE 2P2UA 1K04A 1SQVK 2WSCJ 3KZIE 3L36A 4UB8H 4LLHA 3BATA 2MJZA 1OW6A 3AE2C 1JY3O 3MD0A 1N7LA 1NTKE 2P10A 2YIUC 1K73Q 3A0BH 5B66H 3VCPA 1EC5A 4TT3H 3MIWA 2HG5D 4NB8D 5TISE 2ZVOB 2QE7H 1HUCA 3S4RA 4WY4B 4HKVA 2YIUB 3PRJA 3AE8C 1O7MA 1KB9I 1L0LE 2QA4P 3CC4P 4H0LD 4PD4I 3USSA 3WU2E 1MFTA 3BCCD 3M0AA 1EDKA 4L73A 3TK1A 5KAFH 1FJKA 3FGAD 3NTNA 2IZ0A 4C7RA 1Z56A 3KYQA 1LGHB 1GK6A 3L73J 3Q5PA 3VMID 5AW4B 4P1BH 3G4SP 3G3ZA 1IFIA 5AVSB 3L75G 5APUA 1NJIQ 1KYOE 4KJMA 2KI7B 4OGQD 3CXHI 1G2CB 2Z5IA 2LKMA 3PLNA 1P84D 1Q90D 1URQB 5EFWB 4LGDE 1NU1J 2E43A 5CCHC 1QL1A 2XZRA 5KLIB 1BSHA 3GF3A 5BU8B 1AFOA 1J1DB 3MZWB 1ZV8A 1H89A 2YO2A 4GT1A 3B5NB 2K88A 1VF5C 3FWNA 4NPFX 3L74J 1VQ8P 1SFCC 2ZT9B 2P67A 4JYBA 2WPSA 2NPSB 1KILC 5TJHA 3V5BA 1SQQE 1FS0E 2Q3WA 2KLVA 1GW4A 1SQQK 3CX5D 2E75C 1ZR4A 1VF5B 1VQPP 1Q2NA 2GBXA 2BASA 1PV3A 1USDA 4IL6H 1G8JB 1SQQJ 5H2FH 3TSIA 3VCAA 2FXPA 3U59A 4YXWH 1OW8A 4I6MC 3VMYA 1W2BO 1NHLA 5CHXA 1OMIA 4R4MA 2OTLP 1XTCC 2KZIA 3R2PA 3M91A 1JY3N 1NTMG 1RE4A 1MV8A 1K05A 2WSCH 3VP9A 2QSIA 3AEDC 4QDFA 1SQXJ 2GUSA 3CMEP 1FDMA 2QJKB 1PL5A 3VMXA 1L4AC 1ZOYC 1UUVA 2LXCB 5KKZC 4GDOA 1NO4A 2YFIA 2ZJSE 1NU1D 3HUSB 1NVOA 1FZGA 1JB0J 2A06D 4I7ZC 3BRTB 2QJPC 3M9BA 3H32A 4GKGA 5CJ4A 2J5UA 2P58A 3AEBC 2XU6A 2OYOA 1L4AB 4Y99B 1GL2A 3H1IJ 3TGUG 1ULJA 1KFNA 2JEEA 3AE6C 3MGNA 1LP1B 1G1JA 1P84I 1NYKA 1G8KB 2B89A 3CI9A 2UWJE 1O7PA 3A7OA 2YKPA 3RL0B 1ZN5A 3HD7B 3NXSA 3EWKA 3OA7A 2BMQA 3V2RA 4H13B 2CPSA 4UB6E 4RO0A 5B66E 1SQBE 2R3CA 2HMKA 3H1JG 3CD6P 3CWBG 3L71E 1BDDA 3RBXA 5AVXB 1RF1B 1LWUC 3KZIH 4UB8E 1S72P 2GUVA 1NTKG 4W7ZA 1VQKP 1FDOA 3RL0C 4D6TE 1OVRA 2XNXA 5BU5A 2IBZD 1EZVG 3CXHE 3HE5B 2W6JH 4HYTB 1RE3A 1L0NG 2GBWA 2BCCE 3E1IA 1VCKA 1NTZG 5GTIH 1HF9A 2W27A 1SQVJ 1KFMA 2E75D 2FFDA 2P1JA 2Z5HA 4RJTA 2RKLA 1GMJA 2PAJA 5KAIH 3A3YB 3L70G 2FYZA 3TYYA 1SJGA 4PD4H 3FXDA 3W68A 3H1LE 1USEA 3PHLA 2A45H 5K5GB 1G2CA 1BE3E 4XFJA 1FZFA 4DCKA 2BCCG 2ZYAA 5TISH 4H44C 2IPPA 1P84E 3SFEC 1VF5D 3AE4C 1KILE 4K35A 2NPSC 3SWKA 2PFXA 2YNYA 1M56D 1N7SA 5AW6B 1BCCJ 3VMZA 2XR8A 5CCGA 2E75B 3PTZA 2ZT9D 3U1AA 2E42A 2Q7CA 1OVUA 3L73E 4QMAA 4QUPA 2YMYA 4AQRD 2NPSA 2B87B 1NTZE 2K9JA 3CX5I 1XTGB 2FKWB 1RIEA 3H1JJ 2IYPA 3GKEA 5DJUB 2WSEJ 2HMOA 1QGKB 3GB4A 2M0BA 2N1TC 4BXLA 2C9NY 2WQYC 1LTTC 4HM0A 5GTHH 4PD4E 4W7YA 3A2AA 4GIFA 1OIPA 1HGVA 1LT9A 1ULIA 2H8PD 1EDJA 2ZVNB 2M5AA 2ZXXA 1LTGC 3L75D 2DE7D 3H1LJ 1DEBA 3L72G 2WZ7A 1CW5A 3TNUB 3PP5A 2YKQA 1SQPK 1LTJB 3W67A 2NPSD 2OYHC 3A0HE 3G6EP 5AW5B 4C7NB 1BCCD 2WSFJ 4C7NA 2JJLA 3AE5C 1EXIA 4DJGA 3G9RA 3L70J 2FYNC 1OW7A 4NBHD 3F89A 2OTJP 3C9IA 2V7QH 3CCMP 1R5LA 3H1IE 3HE4B 5C39A 1NTKD 1JCDA 1IC2A 4QUQA 4OVNF 2E74B 1M7LA 1URQD 2WSSH 4ZMDA 2JR8A 3H1JD 2NWFA 5GTHE 3L74G 5KJ7D 3L75E 2YMKA 4EI2A 5KLVJ 3FXEA 2WPVB 2KSEA 4HJLA 3MHVA 2DE6D 4WY4C 4EMJB 3HD7D 4EOTA 3Q5SA 1Y47A 2WVRA 3RL0D 1VQ6P 4I2LC 1SQBK 1M1JA 2KZJA 2XNDH 1SQBD 4NBED 1AA0A 3O6QA 1O7HA 1YBKA 3H25A 1L0LG 2IZ1A 1S4XA 1JY2N 1J1EB 2JKVA 4NBFD 1QX8A 1T2KC 2WMMA 5CCHA 5AEWA 1TU3F 2JWDA 5AW2B 2Q3EA 2PRRA 1D7MA 1LWUB 1DH3A 3AE9C 1UUWA 1KYOD 2R3SA 1NKZB 1RQUA 4RKUJ 1JCCA 1J1EC 2I7FA 3CCEP 3GW6A 1KV4A 3MUDA 3WUVA 2KIKA 1VM9A 3L74E 3L75J 1SQXK 4L75A 5CBOA 3B71A 1LT9B 3Q5RA 4EYYQ 2NVEA 1EZVI 2W8ZA 1JM0A 1OXZA 3KDPB 4BWNA 3VMGD 3JSVC 2FXMA 3CXHH 3P8CE 2ZT9C 1N73A 1JTHB 4QDDA 1FE6A 3V2QA 1BCCG 4EIJA 2IDBA 3HRNA 3EN1A 1DD3A 3P32A 5AVTB 5AVVB 3EQ2A 3HE4A 1HJBA 3L71D 4TLFA 1N73C 1ZXGA 2Y9ZA 1FZBA 2RH0A 3Q2YA 1IFJA 3WMM0 3KPEA 2KK7A 3FWLA 5CCGC 1NYHA 3B5NC 1JY2P 2H43A 5BVZA 1PP9J 1M8OB 3GF7A 2IX7C 5AW0B 3UIAA 5AVWB 4RESB 2ZYGA 1GU5A 1BE3D 1PFIA 1BGYE 3L72D 1LTJA 3KQGA 4QDFB 4PD4D 3CCVP 1IJDB 4OGQB 2HODA 2QM8A 2HODB 1NU1K 3L4FA 3TGUJ 1Q7YQ 1KB9D 3M06A 1VPCA 3E7KA 5KLVE 4BRYA 4CPGA 4ZKPA 2KUBA 1DX7A 2O01H 5B5EH 3L73D 2L91A 3ZDMA 4PV1B 4U7JA 4PV1D 3IN6A 3TDKA 1Q90C 1AV1A 3AEFC 2XKMA 1GL2C 2H89C 3A0HH 3L71G 1BDCA 4HM8A 2FYUE 1BGYJ 4H0LB 1KZUB 4YXDC 1L0NE 2B9BA 1Y8AA 5CXMA 1S9KE 3PJSK 2FFDB 2Q6QA 1KB9H 3LIEA 1M57D 3RK3C 3F5HA 4DT0A 4U3FD 3H1HE 3AEAC 1M1JB 4JQ0D 3ABVC 4U3FJ 4H0LC 2WITA 1SQPD 1VQOP 5KJ7A 1RF1A 2BCCD 2LR2A 2Q5UA 2P7JA 3NFQA 1S2EA 3O8ZA 2BCCJ 3AE7C 3PH0A 3JCUE 3H1KD 3HE5A 3I55P 2RMZA 4ZKUA 2YKOA 3CCQP 5AVQB 3P7KA 5E79H 4NBBD 2V4HA 4WVZA 3EFGA 3H1ID 1O7GA 1A02J 4U3FE 3N7NA 2FYUG 5APXA
chains in the Genus database with same CATH topology
4HM2A 1NTZE 2ZYLA 1WQLA 2E74D 2CKFA 3VMGD 1RFSA 4D6TE 2E4PA 3DQYA 2BMOA 3GL0A 2NVGA 3D89A 4PV1D 2DE5D 1JM1A 4HM5A 2NUMA 4HJLA 1RIEA 4P1CH 4H44D 2IBZE 1Q90C 1KYOE 3GKEA 3H1KE 3GZYA 2DE6D 3CXHE 1PPJE 2XRXA 4OGQD 4QDFA 2HMOA 3EQQA 3GB4A 4QDDA 4EMJB 2GBWA 1NTME 2BCCE 1VCKA 4HM8A 4QURA 4HM3A 1NTKE 2FYUE 2E76D 4HM7A 3GL2A 2YIUC 3CX5E 1NU1E 1O7WA 4AAYB 4HM0A 3EN1A 2XSHA 1NDOA 1L0NE 1O7NA 1UUVA 3VCPA 5KKZC 4PD4E 2QJKC 4H13D 2A06E 1FQTA 5CXMA 1SQXE 2E75D 3H1JE 2YFIA 4AIVA 3GTSA 3L72E 2B1XA 4NBED 2HMMA 1ULIA 2XSOA 4HM1A 2BMRA 4NB8D 5BOKA 1O7HA 4QCKA 1SJGA 3H1HE 2HMNA 2QJPC 2DE7D 1KB9E 1ZRTE 3GTEA 3VMHD 3H1LE 4HKVA 4NBFD 2E4QA 1SQVE 4HM4A 2QPZA 3CWBE 1SQQE 1ULJA 3GOBA 1O7MA 5AEWA 3GCEA 4QDCA 2Q3WA 1BE3E 3N0QA 2NVFA 4NBGD 1L0LE 2HMJA 5KLIC 1BCCE 3TGUE 1P84E 2HMLA 1NYKA 1SQPE 3L70E 1G8KB 1VF5D 5AEUA 4H0LD 2JO6A 1O7PA 2FYNC 2NUKA 1UUWA 2GBXA 1EZVE 4NBHD 1BGYE 3AZCA 3FOUA 1EG9A 1PP9E 2YFJA 4QDFB 3H1IE 2BMQA 1G8JB 4NB9D 4NBCD 4HM6A 2I7FA 2D2CD 2XR8A 3BCCE 3C0DA 2B24A 4NBBD 2JZAA 5HL4A 4QUQA 1SQBE 1VM9A 2YVJB 2ZT9D 3L74E 3VCAA 2HMKA 3GZXA 4NBDD 1O7GA 3L71E 5KLVE 2QJYC 3L73E 2NWFA 4NBAD 4QUPA 2NVEA 4U3FE 3VMID 2YFLA 4P1BH 3L75E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM2 A;  1NTZ E;  2ZYL A;  1WQL A;  2E74 D;  2CKF A;  3VMG D;  1RFS A;  4D6T E;  2E4P A;  3DQY A;  2BMO A;  3GL0 A;  2NVG A;  3D89 A;  4PV1 D;  2DE5 D;  1JM1 A;  4HM5 A;  2NUM A;  4HJL A;  1RIE A;  4P1C H;  4H44 D;  2IBZ E;  1Q90 C;  1KYO E;  3GKE A;  3H1K E;  3GZY A;  2DE6 D;  3CXH E;  1PPJ E;  2XRX A;  4OGQ D;  4QDF A;  2HMO A;  3EQQ A;  3GB4 A;  4QDD A;  4EMJ B;  2GBW A;  1NTM E;  2BCC E;  1VCK A;  4HM8 A;  4QUR A;  4HM3 A;  1NTK E;  2FYU E;  2E76 D;  4HM7 A;  3GL2 A;  2YIU C;  3CX5 E;  1NU1 E;  1O7W A;  4AAY B;  4HM0 A;  3EN1 A;  2XSH A;  1NDO A;  1L0N E;  1O7N A;  1UUV A;  3VCP A;  5KKZ C;  4PD4 E;  2QJK C;  4H13 D;  2A06 E;  1FQT A;  5CXM A;  1SQX E;  2E75 D;  3H1J E;  2YFI A;  4AIV A;  3GTS A;  3L72 E;  2B1X A;  4NBE D;  2HMM A;  1ULI A;  2XSO A;  4HM1 A;  2BMR A;  4NB8 D;  5BOK A;  1O7H A;  4QCK A;  1SJG A;  3H1H E;  2HMN A;  2QJP C;  2DE7 D;  1KB9 E;  1ZRT E;  3GTE A;  3VMH D;  3H1L E;  4HKV A;  4NBF D;  2E4Q A;  1SQV E;  4HM4 A;  2QPZ A;  3CWB E;  1SQQ E;  1ULJ A;  3GOB A;  1O7M A;  5AEW A;  3GCE A;  4QDC A;  2Q3W A;  1BE3 E;  3N0Q A;  2NVF A;  4NBG D;  1L0L E;  2HMJ A;  5KLI C;  1BCC E;  3TGU E;  1P84 E;  2HML A;  1NYK A;  1SQP E;  3L70 E;  1G8K B;  1VF5 D;  5AEU A;  4H0L D;  2JO6 A;  1O7P A;  2FYN C;  2NUK A;  1UUW A;  2GBX A;  1EZV E;  4NBH D;  1BGY E;  3AZC A;  3FOU A;  1EG9 A;  1PP9 E;  2YFJ A;  4QDF B;  3H1I E;  2BMQ A;  1G8J B;  4NB9 D;  4NBC D;  4HM6 A;  2I7F A;  2D2C D;  2XR8 A;  3BCC E;  3C0D A;  2B24 A;  4NBB D;  2JZA A;  5HL4 A;  4QUQ A;  1SQB E;  1VM9 A;  2YVJ B;  2ZT9 D;  3L74 E;  3VCA A;  2HMK A;  3GZX A;  4NBD D;  1O7G A;  3L71 E;  5KLV E;  2QJY C;  3L73 E;  2NWF A;  4NBA D;  4QUP A;  2NVE A;  4U3F E;  3VMI D;  2YFL A;  4P1B H;  3L75 E; 
#chains in the Genus database with same CATH topology
 4YTP C;  1VQ7 P;  1SQB J;  1WQL A;  1L0L D;  2CKF A;  1Q82 Q;  1RFS A;  3II6 A;  1OWA A;  3V6I A;  5B5E E;  1VQ4 P;  5APS A;  2QM7 A;  3BCC J;  2PP6 A;  3TF5 A;  2Y0C A;  1ZP0 C;  2N9B A;  4HKZ H;  1N8R Q;  2FYU J;  4MN4 C;  1IK9 A;  4AAY B;  1NU1 E;  2QRX A;  4HB1 A;  1FDI A;  2WPR A;  3MTU E;  1JMB A;  3MP7 B;  1H0T A;  1LTB C;  2LXB A;  5CJ0 A;  1N7S B;  1R5S A;  3CWB J;  1VQ5 P;  1L2P A;  1KMI Z;  3OJA B;  1PZQ A;  1QVG O;  1IO4 A;  1IZN B;  1SQV E;  1SFC B;  1URQ A;  2QPZ A;  4HM4 A;  1AVO A;  2K9Y A;  2SPZ A;  4QDC A;  4L74 A;  1RY3 A;  4NBG D;  2HMJ A;  3SSU A;  2KNC B;  3TGU E;  1YQ3 C;  1EDL A;  2KNC A;  1SS1 A;  1FBM A;  2KB7 P;  2I8D A;  2QEX P;  1VQL P;  1SQP J;  5APV A;  1BSN A;  3AZC A;  1KQG B;  3V4Q A;  1SVF A;  3BAS A;  3RL0 g;  3CCL P;  1AQT A;  1URQ C;  4R4L A;  1L0L J;  3P8M C;  3GZX A;  3CPW O;  1JMM A;  2W6B A;  2YFL A;  3AEE C;  1X22 A;  3HTK B;  3HTK A;  3B4S A;  3OAK A;  3L71 J;  4B86 A;  3RK2 D;  1T3J A;  4NPE A;  2DE5 D;  2M5A B;  3CWB D;  1KN7 A;  2XRX A;  1SQX G;  1DD4 A;  3I5C A;  2WSF H;  4HM3 A;  4PV1 C;  1KQS O;  2OYI C;  1N86 A;  1PP9 D;  2XSH A;  1NDO A;  3RGU A;  5M1B A;  1YTZ T;  2QJK C;  1CZQ A;  2A45 I;  4WBA A;  1SQX D;  1X79 B;  3GTS A;  3L74 D;  2D2C B;  2JDI H;  3VN0 A;  3FX0 A;  1K9M Q;  1HVV A;  4ASV A;  1IFP A;  1X0T A;  2DW3 A;  1GDT A;  2G8Y A;  4JBZ A;  2O1K A;  2AEM A;  3AEG C;  2PGD A;  5CBN A;  1PGJ A;  2FYU K;  1HH0 A;  2OGU A;  1Y9B A;  2ITA A;  1EXJ A;  1LTS C;  1NWQ A;  3T97 A;  2OAR A;  3T97 B;  2QJY B;  3HUS A;  3GMA A;  4N6J A;  1CSB A;  1JNM A;  3H32 B;  2YXR B;  5APW A;  1NKN A;  1FU1 A;  2KXP B;  3A5T A;  3GLM A;  1NGM B;  1SQV G;  2A45 G;  3H6P A;  4Z1M H;  2E76 C;  1NTZ J;  1LTA C;  1FZE A;  2NRG A;  5KTB A;  1LP1 A;  1PGO A;  2M3B A;  3HUS C;  2E4P A;  3GL0 A;  2NVG A;  4UB6 H;  3D89 A;  2FFD C;  4HM5 A;  2Q9I A;  5AW9 B;  4P1C H;  4H44 D;  3P8C D;  2Q3I A;  1SFC A;  1DIP A;  2M3E A;  2FBW C;  2WT7 A;  1NTK J;  1KIL A;  3MUD C;  3CX5 E;  5KAF E;  2R44 A;  4WWI A;  4HJG H;  4AYC A;  2HYN A;  2KSJ A;  2L5G B;  1YJN P;  3D6Y A;  3U1C A;  2OTK E;  1RE4 C;  3ITK A;  4DZO A;  3Q3D A;  4HM1 A;  5KLV D;  1WRG A;  1KQL A;  1KC8 Q;  4H13 C;  2HMN A;  3M9H A;  2O1J A;  1SQQ D;  2YXQ B;  3H1H J;  1JOC A;  4JYC A;  1H0T B;  2E4Q A;  3V4W A;  4ASW A;  3GCE A;  1J2J B;  2OQQ A;  1FOS E;  2W83 C;  3H1H G;  4YPC A;  1SQP E;  5AW1 B;  4PJ0 E;  3M9Q A;  2JO1 A;  5AVR B;  3K5B A;  3GHG B;  1PGQ A;  4NB9 D;  2POH A;  4NBC D;  3VP8 A;  2JZA A;  1L4A D;  3L37 A;  1E5W A;  3M0D C;  2BEQ D;  2WTY A;  5GTI E;  2FXO A;  4HM2 A;  1IFM A;  1YIJ P;  5E79 E;  2E74 D;  1RF0 C;  1AVY A;  1T3U A;  3GHG C;  3DQY A;  2R5B A;  1AJY A;  1PPJ G;  3H1K G;  1LT9 C;  3IFM A;  1Q86 Q;  4GOE A;  1JY3 P;  5AVU B;  2A06 G;  1G1I A;  5KLV G;  1SQB G;  1HGZ A;  2E76 D;  3B5N A;  3BRV B;  3GL2 A;  3LW5 H;  1O7W A;  1M90 Q;  2CPB A;  2N1T B;  4H13 D;  1RQV A;  2A06 E;  3Q1M A;  2AXC A;  2C9L Y;  3G71 P;  3HD7 A;  3S1K A;  4EDF A;  2I1K A;  1KB9 E;  1ZME C;  3VMH D;  3CXH D;  4M3L A;  1W2E A;  3L70 D;  2Z4E A;  1FOS F;  3VTP C;  2W90 A;  4IFF A;  1YYC A;  2HPC A;  1JY2 O;  3H1L G;  1EZV E;  3VYI A;  2JWA A;  1EG9 A;  2RN0 A;  2XDJ A;  3CCJ P;  1NTM K;  5CCH D;  4W80 A;  1RE3 C;  3C8V A;  2R5D A;  1YIT P;  2YVJ B;  3TNU A;  5CMZ A;  2QJY C;  3R4Y A;  1KTM A;  3NMD A;  4IFM A;  5CCG D;  1OX3 A;  3CX5 H;  3JCU H;  1YJW P;  1CI6 B;  1S1C X;  4OWF A;  2HFE D;  2R32 A;  4H44 B;  2VRS A;  3VMA A;  3KXD A;  5L8R J;  2BMO A;  4IL6 E;  1JM1 A;  1W5C E;  3H1K E;  2ZYD A;  4N78 E;  1JO5 A;  1J1D C;  2J59 M;  1FC2 C;  1NTM D;  4QUR A;  1GTW A;  4O9B A;  1NTM J;  2K37 A;  4KT0 J;  1FQT A;  4XE5 B;  3H1J E;  4AIV A;  1HJ0 A;  3WUU A;  2XSO A;  1T6A A;  3CLQ A;  4QCK A;  1YI2 P;  3IF4 A;  2V7Q J;  1KOR A;  1SLQ A;  4JPZ B;  2K3R A;  3GTE A;  5AVY B;  4C46 A;  4WY4 A;  1UIX A;  2O01 N;  1EDI A;  1SQQ G;  4LC1 A;  4N3Y B;  3GOB A;  5KAI E;  1NTZ D;  2E5T A;  5AVZ B;  2N1T D;  5KLI C;  1BCC E;  1JUN A;  1PPJ D;  2KP8 A;  2O01 J;  1NAF A;  1LJ2 A;  2E76 B;  3B5N D;  2E5Y A;  1QLE D;  4OGQ C;  3FOU A;  1PP9 E;  4PJ0 H;  3RK2 C;  5KLV K;  3C0D A;  2FY8 A;  4HH2 A;  1E79 H;  2B24 A;  1IFN A;  1FZC A;  2N1T A;  4A7P A;  2W6A A;  5APT A;  4GOF A;  3CC2 P;  2ZFC A;  1QVF O;  1LT1 A;  4OH8 B;  3C1L A;  4NBA D;  2KS1 B;  3CCS P;  2KS1 A;  3V2N A;  1N7S D;  2OYI A;  1T2K D;  2ZYL A;  1FAV A;  2WSE H;  1WT6 A;  1MZ9 A;  2AXT H;  2QIW A;  3RK2 B;  2Y9Y A;  1UII A;  3AE3 C;  1YQ4 C;  4BRY B;  1FZC C;  1GZL A;  1GU4 A;  1SQV D;  3EQQ A;  2CK3 H;  1NTM E;  3S9O A;  5DJT B;  2G3A A;  4I1L A;  1L0N K;  2QG4 A;  2Q1K A;  1NAY A;  3A0B E;  1SQX E;  2B1X A;  5APQ A;  4XA4 A;  4KHX A;  1L0N D;  4IFD K;  1ZW0 A;  3QH9 A;  2MKV A;  1ZLL A;  1U57 A;  1S5L H;  1ZRT E;  1LTJ C;  3V2P A;  1JTH A;  3CMA P;  2XV5 A;  1HBW A;  1X9V A;  1KQF B;  5AW7 B;  3L72 J;  4WY4 D;  1S3J A;  3N0Q A;  3M0D A;  1EQ7 A;  4Y28 J;  2GM4 A;  2C0W A;  5AEU A;  2H7H A;  2AXT E;  3H1I G;  2K1A A;  2JO6 A;  2NZ2 A;  3D6Z A;  4GOD A;  2YFJ A;  3WU2 H;  2WPQ A;  2D2C D;  2QJP B;  4IL6 X;  3RK3 E;  1NTK K;  1DEE G;  2WWW A;  1L4A A;  4Y99 C;  4NBD D;  1OVV A;  3CCR P;  4K3A A;  1KYO H;  3CC7 P;  1GL2 D;  2AEF A;  3GG2 A;  4D6T D;  3D71 A;  1NTZ K;  2JP3 A;  3IR9 A;  3SFD C;  1YTZ I;  2HPC B;  3HD7 C;  1QEX A;  1X8Y A;  4HM7 A;  3BCC G;  1AQ5 A;  1FZA A;  2QVA A;  1O7N A;  3L35 A;  3B8E B;  1S5L E;  1LWU A;  2HLO A;  3H1K J;  5KJ7 C;  1RF1 C;  1BE3 J;  1H88 A;  4L76 A;  5APY A;  1PGP A;  3L72 E;  2FYU D;  3RK3 D;  2BMR A;  2B88 A;  1N2D C;  1YJ9 P;  1GD2 E;  1VQN P;  1HTL C;  1PP9 G;  2N9Y B;  1P84 H;  3N4X A;  1M1J C;  3WUT A;  2KLU A;  1SFC D;  2Y0D A;  3KHU A;  3LW5 J;  3L70 E;  1Q81 Q;  1VL2 A;  2NUK A;  3QWO C;  1NOH A;  2H88 C;  3TGU D;  1RF0 A;  1N73 B;  4HM6 A;  1JEK A;  1LNQ A;  2WT7 B;  2ZXE B;  1KIL B;  1K8A Q;  1GW3 A;  2O3J A;  1YHQ P;  1BE3 G;  5HL4 A;  5H2F E;  3I56 P;  2M8R A;  1OFC X;  1IK7 A;  4U3F G;  4D6T J;  4DOJ A;  3AEC C;  1NU1 G;  2BEZ F;  2ZAE B;  4IOI H;  2KYV A;  1PIX A;  3RBZ A;  3SWY A;  1RHZ B;  1MKM A;  1KD1 Q;  1VQM P;  4AUW A;  2IBZ E;  2J58 A;  1A02 F;  3H1L D;  5AW8 B;  3GZY A;  1SP4 A;  2OYI B;  3VOP A;  1L0L K;  2AEJ A;  4JF7 A;  3BVH A;  3O6Q B;  2D2C C;  3L73 G;  4N78 D;  1KIL D;  1FZC B;  4ZNC A;  1T8Z A;  1S9K D;  1LTI C;  1ZR2 A;  1BGY D;  1VDF A;  3CCU P;  2I1J A;  2HMM A;  1VQ9 P;  2HR3 A;  3GHG A;  3CL3 D;  5BOK A;  1IFD A;  1RH5 B;  4D6T G;  1SQP G;  1MFZ A;  1GK4 A;  1OZH A;  4NPD A;  3CWB E;  3AE1 C;  3D70 A;  2NVF A;  1R8E A;  2C0X A;  1H8A A;  2IFM A;  2HML A;  1S5L X;  1EZV D;  4I7Z B;  3SWF A;  2IBZ G;  1BGY G;  2E74 C;  1U7M A;  3IAO A;  3RK3 B;  2GA1 A;  3BCC E;  1NH4 A;  3H1H D;  1FJP A;  2YO3 A;  1MUU A;  4WB4 A;  1HWT C;  2OYH A;  1U7J A;  2Y0E A;  1ZRT D;  3E1R A;  2OYH B;  1QL2 A;  3LID A;  2KOG A;  5AW3 B;  3OW2 O;  2B87 A;  2K9J B;  1CI6 A;  1N7S C;  2IFN A;  1L0N J;  1M1K Q;  2FYN B;  1WMK A;  1GL2 B;  2IYO A;  2NUM A;  3EFF K;  1KYO I;  3JC2 2;  2IBZ I;  5KKZ B;  1PPJ E;  2P2U A;  1K04 A;  1SQV K;  2WSC J;  3KZI E;  3L36 A;  4UB8 H;  4LLH A;  3BAT A;  2MJZ A;  1OW6 A;  3AE2 C;  1JY3 O;  3MD0 A;  1N7L A;  1NTK E;  2P10 A;  2YIU C;  1K73 Q;  3A0B H;  5B66 H;  3VCP A;  1EC5 A;  4TT3 H;  3MIW A;  2HG5 D;  4NB8 D;  5TIS E;  2ZVO B;  2QE7 H;  1HUC A;  3S4R A;  4WY4 B;  4HKV A;  2YIU B;  3PRJ A;  3AE8 C;  1O7M A;  1KB9 I;  1L0L E;  2QA4 P;  3CC4 P;  4H0L D;  4PD4 I;  3USS A;  3WU2 E;  1MFT A;  3BCC D;  3M0A A;  1EDK A;  4L73 A;  3TK1 A;  5KAF H;  1FJK A;  3FGA D;  3NTN A;  2IZ0 A;  4C7R A;  1Z56 A;  3KYQ A;  1LGH B;  1GK6 A;  3L73 J;  3Q5P A;  3VMI D;  5AW4 B;  4P1B H;  3G4S P;  3G3Z A;  1IFI A;  5AVS B;  3L75 G;  5APU A;  1NJI Q;  1KYO E;  4KJM A;  2KI7 B;  4OGQ D;  3CXH I;  1G2C B;  2Z5I A;  2LKM A;  3PLN A;  1P84 D;  1Q90 D;  1URQ B;  5EFW B;  4LGD E;  1NU1 J;  2E43 A;  5CCH C;  1QL1 A;  2XZR A;  5KLI B;  1BSH A;  3GF3 A;  5BU8 B;  1AFO A;  1J1D B;  3MZW B;  1ZV8 A;  1H89 A;  2YO2 A;  4GT1 A;  3B5N B;  2K88 A;  1VF5 C;  3FWN A;  4NPF X;  3L74 J;  1VQ8 P;  1SFC C;  2ZT9 B;  2P67 A;  4JYB A;  2WPS A;  2NPS B;  1KIL C;  5TJH A;  3V5B A;  1SQQ E;  1FS0 E;  2Q3W A;  2KLV A;  1GW4 A;  1SQQ K;  3CX5 D;  2E75 C;  1ZR4 A;  1VF5 B;  1VQP P;  1Q2N A;  2GBX A;  2BAS A;  1PV3 A;  1USD A;  4IL6 H;  1G8J B;  1SQQ J;  5H2F H;  3TSI A;  3VCA A;  2FXP A;  3U59 A;  4YXW H;  1OW8 A;  4I6M C;  3VMY A;  1W2B O;  1NHL A;  5CHX A;  1OMI A;  4R4M A;  2OTL P;  1XTC C;  2KZI A;  3R2P A;  3M91 A;  1JY3 N;  1NTM G;  1RE4 A;  1MV8 A;  1K05 A;  2WSC H;  3VP9 A;  2QSI A;  3AED C;  4QDF A;  1SQX J;  2GUS A;  3CME P;  1FDM A;  2QJK B;  1PL5 A;  3VMX A;  1L4A C;  1ZOY C;  1UUV A;  2LXC B;  5KKZ C;  4GDO A;  1NO4 A;  2YFI A;  2ZJS E;  1NU1 D;  3HUS B;  1NVO A;  1FZG A;  1JB0 J;  2A06 D;  4I7Z C;  3BRT B;  2QJP C;  3M9B A;  3H32 A;  4GKG A;  5CJ4 A;  2J5U A;  2P58 A;  3AEB C;  2XU6 A;  2OYO A;  1L4A B;  4Y99 B;  1GL2 A;  3H1I J;  3TGU G;  1ULJ A;  1KFN A;  2JEE A;  3AE6 C;  3MGN A;  1LP1 B;  1G1J A;  1P84 I;  1NYK A;  1G8K B;  2B89 A;  3CI9 A;  2UWJ E;  1O7P A;  3A7O A;  2YKP A;  3RL0 B;  1ZN5 A;  3HD7 B;  3NXS A;  3EWK A;  3OA7 A;  2BMQ A;  3V2R A;  4H13 B;  2CPS A;  4UB6 E;  4RO0 A;  5B66 E;  1SQB E;  2R3C A;  2HMK A;  3H1J G;  3CD6 P;  3CWB G;  3L71 E;  1BDD A;  3RBX A;  5AVX B;  1RF1 B;  1LWU C;  3KZI H;  4UB8 E;  1S72 P;  2GUV A;  1NTK G;  4W7Z A;  1VQK P;  1FDO A;  3RL0 C;  4D6T E;  1OVR A;  2XNX A;  5BU5 A;  2IBZ D;  1EZV G;  3CXH E;  3HE5 B;  2W6J H;  4HYT B;  1RE3 A;  1L0N G;  2GBW A;  2BCC E;  3E1I A;  1VCK A;  1NTZ G;  5GTI H;  1HF9 A;  2W27 A;  1SQV J;  1KFM A;  2E75 D;  2FFD A;  2P1J A;  2Z5H A;  4RJT A;  2RKL A;  1GMJ A;  2PAJ A;  5KAI H;  3A3Y B;  3L70 G;  2FYZ A;  3TYY A;  1SJG A;  4PD4 H;  3FXD A;  3W68 A;  3H1L E;  1USE A;  3PHL A;  2A45 H;  5K5G B;  1G2C A;  1BE3 E;  4XFJ A;  1FZF A;  4DCK A;  2BCC G;  2ZYA A;  5TIS H;  4H44 C;  2IPP A;  1P84 E;  3SFE C;  1VF5 D;  3AE4 C;  1KIL E;  4K35 A;  2NPS C;  3SWK A;  2PFX A;  2YNY A;  1M56 D;  1N7S A;  5AW6 B;  1BCC J;  3VMZ A;  2XR8 A;  5CCG A;  2E75 B;  3PTZ A;  2ZT9 D;  3U1A A;  2E42 A;  2Q7C A;  1OVU A;  3L73 E;  4QMA A;  4QUP A;  2YMY A;  4AQR D;  2NPS A;  2B87 B;  1NTZ E;  2K9J A;  3CX5 I;  1XTG B;  2FKW B;  1RIE A;  3H1J J;  2IYP A;  3GKE A;  5DJU B;  2WSE J;  2HMO A;  1QGK B;  3GB4 A;  2M0B A;  2N1T C;  4BXL A;  2C9N Y;  2WQY C;  1LTT C;  4HM0 A;  5GTH H;  4PD4 E;  4W7Y A;  3A2A A;  4GIF A;  1OIP A;  1HGV A;  1LT9 A;  1ULI A;  2H8P D;  1EDJ A;  2ZVN B;  2M5A A;  2ZXX A;  1LTG C;  3L75 D;  2DE7 D;  3H1L J;  1DEB A;  3L72 G;  2WZ7 A;  1CW5 A;  3TNU B;  3PP5 A;  2YKQ A;  1SQP K;  1LTJ B;  3W67 A;  2NPS D;  2OYH C;  3A0H E;  3G6E P;  5AW5 B;  4C7N B;  1BCC D;  2WSF J;  4C7N A;  2JJL A;  3AE5 C;  1EXI A;  4DJG A;  3G9R A;  3L70 J;  2FYN C;  1OW7 A;  4NBH D;  3F89 A;  2OTJ P;  3C9I A;  2V7Q H;  3CCM P;  1R5L A;  3H1I E;  3HE4 B;  5C39 A;  1NTK D;  1JCD A;  1IC2 A;  4QUQ A;  4OVN F;  2E74 B;  1M7L A;  1URQ D;  2WSS H;  4ZMD A;  2JR8 A;  3H1J D;  2NWF A;  5GTH E;  3L74 G;  5KJ7 D;  3L75 E;  2YMK A;  4EI2 A;  5KLV J;  3FXE A;  2WPV B;  2KSE A;  4HJL A;  3MHV A;  2DE6 D;  4WY4 C;  4EMJ B;  3HD7 D;  4EOT A;  3Q5S A;  1Y47 A;  2WVR A;  3RL0 D;  1VQ6 P;  4I2L C;  1SQB K;  1M1J A;  2KZJ A;  2XND H;  1SQB D;  4NBE D;  1AA0 A;  3O6Q A;  1O7H A;  1YBK A;  3H25 A;  1L0L G;  2IZ1 A;  1S4X A;  1JY2 N;  1J1E B;  2JKV A;  4NBF D;  1QX8 A;  1T2K C;  2WMM A;  5CCH A;  5AEW A;  1TU3 F;  2JWD A;  5AW2 B;  2Q3E A;  2PRR A;  1D7M A;  1LWU B;  1DH3 A;  3AE9 C;  1UUW A;  1KYO D;  2R3S A;  1NKZ B;  1RQU A;  4RKU J;  1JCC A;  1J1E C;  2I7F A;  3CCE P;  3GW6 A;  1KV4 A;  3MUD A;  3WUV A;  2KIK A;  1VM9 A;  3L74 E;  3L75 J;  1SQX K;  4L75 A;  5CBO A;  3B71 A;  1LT9 B;  3Q5R A;  4EYY Q;  2NVE A;  1EZV I;  2W8Z A;  1JM0 A;  1OXZ A;  3KDP B;  4BWN A;  3VMG D;  3JSV C;  2FXM A;  3CXH H;  3P8C E;  2ZT9 C;  1N73 A;  1JTH B;  4QDD A;  1FE6 A;  3V2Q A;  1BCC G;  4EIJ A;  2IDB A;  3HRN A;  3EN1 A;  1DD3 A;  3P32 A;  5AVT B;  5AVV B;  3EQ2 A;  3HE4 A;  1HJB A;  3L71 D;  4TLF A;  1N73 C;  1ZXG A;  2Y9Z A;  1FZB A;  2RH0 A;  3Q2Y A;  1IFJ A;  3WMM 0;  3KPE A;  2KK7 A;  3FWL A;  5CCG C;  1NYH A;  3B5N C;  1JY2 P;  2H43 A;  5BVZ A;  1PP9 J;  1M8O B;  3GF7 A;  2IX7 C;  5AW0 B;  3UIA A;  5AVW B;  4RES B;  2ZYG A;  1GU5 A;  1BE3 D;  1PFI A;  1BGY E;  3L72 D;  1LTJ A;  3KQG A;  4QDF B;  4PD4 D;  3CCV P;  1IJD B;  4OGQ B;  2HOD A;  2QM8 A;  2HOD B;  1NU1 K;  3L4F A;  3TGU J;  1Q7Y Q;  1KB9 D;  3M06 A;  1VPC A;  3E7K A;  5KLV E;  4BRY A;  4CPG A;  4ZKP A;  2KUB A;  1DX7 A;  2O01 H;  5B5E H;  3L73 D;  2L91 A;  3ZDM A;  4PV1 B;  4U7J A;  4PV1 D;  3IN6 A;  3TDK A;  1Q90 C;  1AV1 A;  3AEF C;  2XKM A;  1GL2 C;  2H89 C;  3A0H H;  3L71 G;  1BDC A;  4HM8 A;  2FYU E;  1BGY J;  4H0L B;  1KZU B;  4YXD C;  1L0N E;  2B9B A;  1Y8A A;  5CXM A;  1S9K E;  3PJS K;  2FFD B;  2Q6Q A;  1KB9 H;  3LIE A;  1M57 D;  3RK3 C;  3F5H A;  4DT0 A;  4U3F D;  3H1H E;  3AEA C;  1M1J B;  4JQ0 D;  3ABV C;  4U3F J;  4H0L C;  2WIT A;  1SQP D;  1VQO P;  5KJ7 A;  1RF1 A;  2BCC D;  2LR2 A;  2Q5U A;  2P7J A;  3NFQ A;  1S2E A;  3O8Z A;  2BCC J;  3AE7 C;  3PH0 A;  3JCU E;  3H1K D;  3HE5 A;  3I55 P;  2RMZ A;  4ZKU A;  2YKO A;  3CCQ P;  5AVQ B;  3P7K A;  5E79 H;  4NBB D;  2V4H A;  4WVZ A;  3EFG A;  3H1I D;  1O7G A;  1A02 J;  4U3F E;  3N7N A;  2FYU G;  5APX A; 
#chains in the Genus database with same CATH homology
 4HM2 A;  1NTZ E;  2ZYL A;  1WQL A;  2E74 D;  2CKF A;  3VMG D;  1RFS A;  4D6T E;  2E4P A;  3DQY A;  2BMO A;  3GL0 A;  2NVG A;  3D89 A;  4PV1 D;  2DE5 D;  1JM1 A;  4HM5 A;  2NUM A;  4HJL A;  1RIE A;  4P1C H;  4H44 D;  2IBZ E;  1Q90 C;  1KYO E;  3GKE A;  3H1K E;  3GZY A;  2DE6 D;  3CXH E;  1PPJ E;  2XRX A;  4OGQ D;  4QDF A;  2HMO A;  3EQQ A;  3GB4 A;  4QDD A;  4EMJ B;  2GBW A;  1NTM E;  2BCC E;  1VCK A;  4HM8 A;  4QUR A;  4HM3 A;  1NTK E;  2FYU E;  2E76 D;  4HM7 A;  3GL2 A;  2YIU C;  3CX5 E;  1NU1 E;  1O7W A;  4AAY B;  4HM0 A;  3EN1 A;  2XSH A;  1NDO A;  1L0N E;  1O7N A;  1UUV A;  3VCP A;  5KKZ C;  4PD4 E;  2QJK C;  4H13 D;  2A06 E;  1FQT A;  5CXM A;  1SQX E;  2E75 D;  3H1J E;  2YFI A;  4AIV A;  3GTS A;  3L72 E;  2B1X A;  4NBE D;  2HMM A;  1ULI A;  2XSO A;  4HM1 A;  2BMR A;  4NB8 D;  5BOK A;  1O7H A;  4QCK A;  1SJG A;  3H1H E;  2HMN A;  2QJP C;  2DE7 D;  1KB9 E;  1ZRT E;  3GTE A;  3VMH D;  3H1L E;  4HKV A;  4NBF D;  2E4Q A;  1SQV E;  4HM4 A;  2QPZ A;  3CWB E;  1SQQ E;  1ULJ A;  3GOB A;  1O7M A;  5AEW A;  3GCE A;  4QDC A;  2Q3W A;  1BE3 E;  3N0Q A;  2NVF A;  4NBG D;  1L0L E;  2HMJ A;  5KLI C;  1BCC E;  3TGU E;  1P84 E;  2HML A;  1NYK A;  1SQP E;  3L70 E;  1G8K B;  1VF5 D;  5AEU A;  4H0L D;  2JO6 A;  1O7P A;  2FYN C;  2NUK A;  1UUW A;  2GBX A;  1EZV E;  4NBH D;  1BGY E;  3AZC A;  3FOU A;  1EG9 A;  1PP9 E;  2YFJ A;  4QDF B;  3H1I E;  2BMQ A;  1G8J B;  4NB9 D;  4NBC D;  4HM6 A;  2I7F A;  2D2C D;  2XR8 A;  3BCC E;  3C0D A;  2B24 A;  4NBB D;  2JZA A;  5HL4 A;  4QUQ A;  1SQB E;  1VM9 A;  2YVJ B;  2ZT9 D;  3L74 E;  3VCA A;  2HMK A;  3GZX A;  4NBD D;  1O7G A;  3L71 E;  5KLV E;  2QJY C;  3L73 E;  2NWF A;  4NBA D;  4QUP A;  2NVE A;  4U3F E;  3VMI D;  2YFL A;  4P1B H;  3L75 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...