2YFJA

Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNQIRVWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPFNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Retuning Rieske-Type Oxygenases to Expand Substrate Range.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 136
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yfjA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2yfjA01
3VMID 4PD4E 2QJYC 5KLVE 4P1CH 2D2CD 3GB4A 3H1JE 4HM8A 4QURA 1BE3E 1NTKE 5KKZC 5KLIC 3VCAA 3GCEA 1BCCE 1RIEA 1O7PA 1VF5D 2NUKA 3GTEA 1SQPE 4NBFA 4NBFD 4U3FE 1O7MA 4AAYB 4NBDA 1EG9A 3EQQA 4NBEA 1O7GA 4HM3A 2CKFA 4QDFB 2BMOA 4QUQA 2BMQA 3H1HE 2HMMA 4P1BH 1Z02A 2HMOA 1UUVA 3AZCA 1SJGA 1NDOA 4PV1D 2DE5A 1FQTA 4HM5A 1P84E 4NBAD 2DE5D 2E76D 3EN1A 3GOBA 2FYUE 1ZRTE 4HM0A 2IBZE 1SQQE 5CXMA 1ULIA 4H13D 2HMNA 3VMGA 2XRXA 3L71E 4HM1A 1KB9E 4HM4A 2YIUC 3L75E 1L0LE 4AIVA 3GL2A 2NVFA 3VCPA 3GCFA 2XSOA 1JM1A 2JO6A 1G8JB 2E4QA 2E74D 1PPJE 4HM2A 2NVGA 4H0LD 2GBWA 2HMKA 1Z01A 4NBDD 1EZVE 4EMJB 1G8KB 2ZT9D 4NBHA 4NBED 2E75D 4QDFA 2DE7A 3C0DA 2QJKC 4NBHD 3GZXA 3H1LE 1NTZE 4H44D 4QCKA 2Q3WA 3GTSA 1KYOE 2XR8A 1Z03A 1O7WA 1VCKA 2A06E 3GKEA 1SQXE 1SQVE 2YFJA 4NBGA 3VMHA 2NVEA 1PP9E 3VMGD 4QDCA 1WQLA 1L0NE 1VM9A 3GL0A 4NB9A 1UUWA 2JZAA 5AEWA 1NTME 3FOUA 2DE6A 3CWBE 3N0QA 2YFIA 2DE6D 2GBXA 3L72E 2I7FA 3TGUE 4HM6A 1NU1E 1RFSA 1SQBE 3CX5E 4HJLA 4QUPA 1Q90C 2XSHA 3H1KE 3H1IE 3L73E 2DE7D 2ZYLA 3BCCE 4NBCA 3GZYA 2QPZA 2YVJB 5AEUA 2B1XA 4NBCD 2FYNC 4NB8A 2BMRA 3GKQA 2YFLA 1WW9A 4NBBA 1ULJA 2BCCE 1O7HA 2HMLA 4NBGD 4NB8D 5HL4A 4NBBD 2NWFA 3VMHD 3CXHE 3L70E 2NUMA 3D89A 4HKVA 3DQYA 3L74E 2QJPC 5BOKA 1NYKA 2HMJA 1O7NA 4NB9D 2E4PA 4HM7A 4QDDA 3VMIA 4NBAA 4OGQD 2B24A
chains in the Genus database with same CATH superfamily
3VMID 4PD4E 2QJYC 5KLVE 4P1CH 2D2CD 3GB4A 3H1JE 4HM8A 4QURA 1BE3E 1NTKE 5KKZC 5KLIC 3VCAA 3GCEA 1BCCE 1RIEA 1O7PA 1VF5D 2NUKA 3GTEA 1SQPE 4NBFA 4NBFD 4U3FE 1O7MA 4AAYB 4NBDA 1EG9A 3EQQA 4NBEA 1O7GA 4HM3A 2CKFA 4QDFB 2BMOA 4QUQA 2BMQA 3H1HE 2HMMA 4P1BH 1Z02A 2HMOA 1UUVA 3AZCA 1SJGA 1NDOA 4PV1D 2DE5A 1FQTA 4HM5A 1P84E 4NBAD 2DE5D 2E76D 3EN1A 3GOBA 2FYUE 1ZRTE 4HM0A 2IBZE 1SQQE 5CXMA 1ULIA 4H13D 2HMNA 3VMGA 2XRXA 3L71E 4HM1A 1KB9E 4HM4A 2YIUC 3L75E 1L0LE 4AIVA 3GL2A 2NVFA 3VCPA 3GCFA 2XSOA 1JM1A 2JO6A 1G8JB 2E4QA 2E74D 1PPJE 4HM2A 2NVGA 4H0LD 2GBWA 2HMKA 1Z01A 4NBDD 1EZVE 4EMJB 1G8KB 2ZT9D 4NBHA 4NBED 2E75D 4QDFA 2DE7A 3C0DA 2QJKC 4NBHD 3GZXA 3H1LE 1NTZE 4H44D 4QCKA 2Q3WA 3GTSA 1KYOE 2XR8A 1Z03A 1O7WA 1VCKA 2A06E 3GKEA 1SQXE 1SQVE 2YFJA 4NBGA 3VMHA 2NVEA 1PP9E 3VMGD 4QDCA 1WQLA 1L0NE 1VM9A 3GL0A 4NB9A 1UUWA 2JZAA 5AEWA 1NTME 3FOUA 2DE6A 3CWBE 3N0QA 2YFIA 2DE6D 2GBXA 3L72E 2I7FA 3TGUE 4HM6A 1NU1E 1RFSA 1SQBE 3CX5E 4HJLA 4QUPA 1Q90C 2XSHA 3H1KE 3H1IE 3L73E 2DE7D 2ZYLA 3BCCE 4NBCA 3GZYA 2QPZA 2YVJB 5AEUA 2B1XA 4NBCD 2FYNC 4NB8A 2BMRA 3GKQA 2YFLA 1WW9A 4NBBA 1ULJA 2BCCE 1O7HA 2HMLA 4NBGD 4NB8D 5HL4A 4NBBD 2NWFA 3VMHD 3CXHE 3L70E 2NUMA 3D89A 4HKVA 3DQYA 3L74E 2QJPC 5BOKA 1NYKA 2HMJA 1O7NA 4NB9D 2E4PA 4HM7A 4QDDA 3VMIA 4NBAA 4OGQD 2B24A
chains in the Genus database with same CATH topology
3VMID 4PD4E 2QJYC 5KLVE 4P1CH 2D2CD 3GB4A 3H1JE 4HM8A 4QURA 1BE3E 1NTKE 5KKZC 5KLIC 3VCAA 3GCEA 1BCCE 1RIEA 1O7PA 1VF5D 2NUKA 3GTEA 1SQPE 4NBFA 4NBFD 4U3FE 1O7MA 4AAYB 4NBDA 1EG9A 3EQQA 4NBEA 1O7GA 4HM3A 2CKFA 4QDFB 2BMOA 4QUQA 2BMQA 3H1HE 2HMMA 4P1BH 1Z02A 2HMOA 1UUVA 3AZCA 1SJGA 1NDOA 4PV1D 2DE5A 1FQTA 4HM5A 1P84E 4NBAD 2DE5D 2E76D 3EN1A 3GOBA 2FYUE 1ZRTE 4HM0A 2IBZE 1SQQE 5CXMA 1ULIA 4H13D 2HMNA 3VMGA 2XRXA 3L71E 4HM1A 1KB9E 4HM4A 2YIUC 3L75E 1L0LE 4AIVA 3GL2A 2NVFA 3VCPA 3GCFA 2XSOA 1JM1A 2JO6A 1G8JB 2E4QA 2E74D 1PPJE 4HM2A 2NVGA 4H0LD 2GBWA 2HMKA 1Z01A 4NBDD 1EZVE 4EMJB 1G8KB 2ZT9D 4NBHA 4NBED 2E75D 4QDFA 2DE7A 3C0DA 2QJKC 4NBHD 3GZXA 3H1LE 1NTZE 4H44D 4QCKA 2Q3WA 3GTSA 1KYOE 2XR8A 1Z03A 1O7WA 1VCKA 2A06E 3GKEA 1SQXE 1SQVE 2YFJA 4NBGA 3VMHA 2NVEA 1PP9E 3VMGD 4QDCA 1WQLA 1L0NE 1VM9A 3GL0A 4NB9A 1UUWA 2JZAA 5AEWA 1NTME 3FOUA 2DE6A 3CWBE 3N0QA 2YFIA 2DE6D 2GBXA 3L72E 2I7FA 3TGUE 4HM6A 1NU1E 1RFSA 1SQBE 3CX5E 4HJLA 4QUPA 1Q90C 2XSHA 3H1KE 3H1IE 3L73E 2DE7D 2ZYLA 3BCCE 4NBCA 3GZYA 2QPZA 2YVJB 5AEUA 2B1XA 4NBCD 2FYNC 4NB8A 2BMRA 3GKQA 2YFLA 1WW9A 4NBBA 1ULJA 2BCCE 1O7HA 2HMLA 4NBGD 4NB8D 5HL4A 4NBBD 2NWFA 3VMHD 3CXHE 3L70E 2NUMA 3D89A 4HKVA 3DQYA 3L74E 2QJPC 5BOKA 1NYKA 2HMJA 1O7NA 4NB9D 2E4PA 4HM7A 4QDDA 3VMIA 4NBAA 4OGQD 2B24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMI D;  4PD4 E;  2QJY C;  5KLV E;  4P1C H;  2D2C D;  3GB4 A;  3H1J E;  4HM8 A;  4QUR A;  1BE3 E;  1NTK E;  5KKZ C;  5KLI C;  3VCA A;  3GCE A;  1BCC E;  1RIE A;  1O7P A;  1VF5 D;  2NUK A;  3GTE A;  1SQP E;  4NBF A;  4NBF D;  4U3F E;  1O7M A;  4AAY B;  4NBD A;  1EG9 A;  3EQQ A;  4NBE A;  1O7G A;  4HM3 A;  2CKF A;  4QDF B;  2BMO A;  4QUQ A;  2BMQ A;  3H1H E;  2HMM A;  4P1B H;  1Z02 A;  2HMO A;  1UUV A;  3AZC A;  1SJG A;  1NDO A;  4PV1 D;  2DE5 A;  1FQT A;  4HM5 A;  1P84 E;  4NBA D;  2DE5 D;  2E76 D;  3EN1 A;  3GOB A;  2FYU E;  1ZRT E;  4HM0 A;  2IBZ E;  1SQQ E;  5CXM A;  1ULI A;  4H13 D;  2HMN A;  3VMG A;  2XRX A;  3L71 E;  4HM1 A;  1KB9 E;  4HM4 A;  2YIU C;  3L75 E;  1L0L E;  4AIV A;  3GL2 A;  2NVF A;  3VCP A;  3GCF A;  2XSO A;  1JM1 A;  2JO6 A;  1G8J B;  2E4Q A;  2E74 D;  1PPJ E;  4HM2 A;  2NVG A;  4H0L D;  2GBW A;  2HMK A;  1Z01 A;  4NBD D;  1EZV E;  4EMJ B;  1G8K B;  2ZT9 D;  4NBH A;  4NBE D;  2E75 D;  4QDF A;  2DE7 A;  3C0D A;  2QJK C;  4NBH D;  3GZX A;  3H1L E;  1NTZ E;  4H44 D;  4QCK A;  2Q3W A;  3GTS A;  1KYO E;  2XR8 A;  1Z03 A;  1O7W A;  1VCK A;  2A06 E;  3GKE A;  1SQX E;  1SQV E;  2YFJ A;  4NBG A;  3VMH A;  2NVE A;  1PP9 E;  3VMG D;  4QDC A;  1WQL A;  1L0N E;  1VM9 A;  3GL0 A;  4NB9 A;  1UUW A;  2JZA A;  5AEW A;  1NTM E;  3FOU A;  2DE6 A;  3CWB E;  3N0Q A;  2YFI A;  2DE6 D;  2GBX A;  3L72 E;  2I7F A;  3TGU E;  4HM6 A;  1NU1 E;  1RFS A;  1SQB E;  3CX5 E;  4HJL A;  4QUP A;  1Q90 C;  2XSH A;  3H1K E;  3H1I E;  3L73 E;  2DE7 D;  2ZYL A;  3BCC E;  4NBC A;  3GZY A;  2QPZ A;  2YVJ B;  5AEU A;  2B1X A;  4NBC D;  2FYN C;  4NB8 A;  2BMR A;  3GKQ A;  2YFL A;  1WW9 A;  4NBB A;  1ULJ A;  2BCC E;  1O7H A;  2HML A;  4NBG D;  4NB8 D;  5HL4 A;  4NBB D;  2NWF A;  3VMH D;  3CXH E;  3L70 E;  2NUM A;  3D89 A;  4HKV A;  3DQY A;  3L74 E;  2QJP C;  5BOK A;  1NYK A;  2HMJ A;  1O7N A;  4NB9 D;  2E4P A;  4HM7 A;  4QDD A;  3VMI A;  4NBA A;  4OGQ D;  2B24 A; 
#chains in the Genus database with same CATH topology
 3VMI D;  4PD4 E;  2QJY C;  5KLV E;  4P1C H;  2D2C D;  3GB4 A;  3H1J E;  4HM8 A;  4QUR A;  1BE3 E;  1NTK E;  5KKZ C;  5KLI C;  3VCA A;  3GCE A;  1BCC E;  1RIE A;  1O7P A;  1VF5 D;  2NUK A;  3GTE A;  1SQP E;  4NBF A;  4NBF D;  4U3F E;  1O7M A;  4AAY B;  4NBD A;  1EG9 A;  3EQQ A;  4NBE A;  1O7G A;  4HM3 A;  2CKF A;  4QDF B;  2BMO A;  4QUQ A;  2BMQ A;  3H1H E;  2HMM A;  4P1B H;  1Z02 A;  2HMO A;  1UUV A;  3AZC A;  1SJG A;  1NDO A;  4PV1 D;  2DE5 A;  1FQT A;  4HM5 A;  1P84 E;  4NBA D;  2DE5 D;  2E76 D;  3EN1 A;  3GOB A;  2FYU E;  1ZRT E;  4HM0 A;  2IBZ E;  1SQQ E;  5CXM A;  1ULI A;  4H13 D;  2HMN A;  3VMG A;  2XRX A;  3L71 E;  4HM1 A;  1KB9 E;  4HM4 A;  2YIU C;  3L75 E;  1L0L E;  4AIV A;  3GL2 A;  2NVF A;  3VCP A;  3GCF A;  2XSO A;  1JM1 A;  2JO6 A;  1G8J B;  2E4Q A;  2E74 D;  1PPJ E;  4HM2 A;  2NVG A;  4H0L D;  2GBW A;  2HMK A;  1Z01 A;  4NBD D;  1EZV E;  4EMJ B;  1G8K B;  2ZT9 D;  4NBH A;  4NBE D;  2E75 D;  4QDF A;  2DE7 A;  3C0D A;  2QJK C;  4NBH D;  3GZX A;  3H1L E;  1NTZ E;  4H44 D;  4QCK A;  2Q3W A;  3GTS A;  1KYO E;  2XR8 A;  1Z03 A;  1O7W A;  1VCK A;  2A06 E;  3GKE A;  1SQX E;  1SQV E;  2YFJ A;  4NBG A;  3VMH A;  2NVE A;  1PP9 E;  3VMG D;  4QDC A;  1WQL A;  1L0N E;  1VM9 A;  3GL0 A;  4NB9 A;  1UUW A;  2JZA A;  5AEW A;  1NTM E;  3FOU A;  2DE6 A;  3CWB E;  3N0Q A;  2YFI A;  2DE6 D;  2GBX A;  3L72 E;  2I7F A;  3TGU E;  4HM6 A;  1NU1 E;  1RFS A;  1SQB E;  3CX5 E;  4HJL A;  4QUP A;  1Q90 C;  2XSH A;  3H1K E;  3H1I E;  3L73 E;  2DE7 D;  2ZYL A;  3BCC E;  4NBC A;  3GZY A;  2QPZ A;  2YVJ B;  5AEU A;  2B1X A;  4NBC D;  2FYN C;  4NB8 A;  2BMR A;  3GKQ A;  2YFL A;  1WW9 A;  4NBB A;  1ULJ A;  2BCC E;  1O7H A;  2HML A;  4NBG D;  4NB8 D;  5HL4 A;  4NBB D;  2NWF A;  3VMH D;  3CXH E;  3L70 E;  2NUM A;  3D89 A;  4HKV A;  3DQY A;  3L74 E;  2QJP C;  5BOK A;  1NYK A;  2HMJ A;  1O7N A;  4NB9 D;  2E4P A;  4HM7 A;  4QDD A;  3VMI A;  4NBA A;  4OGQ D;  2B24 A; 
#chains in the Genus database with same CATH homology
 3VMI D;  4PD4 E;  2QJY C;  5KLV E;  4P1C H;  2D2C D;  3GB4 A;  3H1J E;  4HM8 A;  4QUR A;  1BE3 E;  1NTK E;  5KKZ C;  5KLI C;  3VCA A;  3GCE A;  1BCC E;  1RIE A;  1O7P A;  1VF5 D;  2NUK A;  3GTE A;  1SQP E;  4NBF A;  4NBF D;  4U3F E;  1O7M A;  4AAY B;  4NBD A;  1EG9 A;  3EQQ A;  4NBE A;  1O7G A;  4HM3 A;  2CKF A;  4QDF B;  2BMO A;  4QUQ A;  2BMQ A;  3H1H E;  2HMM A;  4P1B H;  1Z02 A;  2HMO A;  1UUV A;  3AZC A;  1SJG A;  1NDO A;  4PV1 D;  2DE5 A;  1FQT A;  4HM5 A;  1P84 E;  4NBA D;  2DE5 D;  2E76 D;  3EN1 A;  3GOB A;  2FYU E;  1ZRT E;  4HM0 A;  2IBZ E;  1SQQ E;  5CXM A;  1ULI A;  4H13 D;  2HMN A;  3VMG A;  2XRX A;  3L71 E;  4HM1 A;  1KB9 E;  4HM4 A;  2YIU C;  3L75 E;  1L0L E;  4AIV A;  3GL2 A;  2NVF A;  3VCP A;  3GCF A;  2XSO A;  1JM1 A;  2JO6 A;  1G8J B;  2E4Q A;  2E74 D;  1PPJ E;  4HM2 A;  2NVG A;  4H0L D;  2GBW A;  2HMK A;  1Z01 A;  4NBD D;  1EZV E;  4EMJ B;  1G8K B;  2ZT9 D;  4NBH A;  4NBE D;  2E75 D;  4QDF A;  2DE7 A;  3C0D A;  2QJK C;  4NBH D;  3GZX A;  3H1L E;  1NTZ E;  4H44 D;  4QCK A;  2Q3W A;  3GTS A;  1KYO E;  2XR8 A;  1Z03 A;  1O7W A;  1VCK A;  2A06 E;  3GKE A;  1SQX E;  1SQV E;  2YFJ A;  4NBG A;  3VMH A;  2NVE A;  1PP9 E;  3VMG D;  4QDC A;  1WQL A;  1L0N E;  1VM9 A;  3GL0 A;  4NB9 A;  1UUW A;  2JZA A;  5AEW A;  1NTM E;  3FOU A;  2DE6 A;  3CWB E;  3N0Q A;  2YFI A;  2DE6 D;  2GBX A;  3L72 E;  2I7F A;  3TGU E;  4HM6 A;  1NU1 E;  1RFS A;  1SQB E;  3CX5 E;  4HJL A;  4QUP A;  1Q90 C;  2XSH A;  3H1K E;  3H1I E;  3L73 E;  2DE7 D;  2ZYL A;  3BCC E;  4NBC A;  3GZY A;  2QPZ A;  2YVJ B;  5AEU A;  2B1X A;  4NBC D;  2FYN C;  4NB8 A;  2BMR A;  3GKQ A;  2YFL A;  1WW9 A;  4NBB A;  1ULJ A;  2BCC E;  1O7H A;  2HML A;  4NBG D;  4NB8 D;  5HL4 A;  4NBB D;  2NWF A;  3VMH D;  3CXH E;  3L70 E;  2NUM A;  3D89 A;  4HKV A;  3DQY A;  3L74 E;  2QJP C;  5BOK A;  1NYK A;  2HMJ A;  1O7N A;  4NB9 D;  2E4P A;  4HM7 A;  4QDD A;  3VMI A;  4NBA A;  4OGQ D;  2B24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...