2YFJA

Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNQIRVWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPFNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Retuning Rieske-Type Oxygenases to Expand Substrate Range.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
total genus 136
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yfjA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2yfjA01
2DE7D 2HMMA 3CX5E 2XSHA 2NWFA 2GBWA 1O7PA 3DQYA 1L0NE 4NBEA 5KLIC 3GKEA 3GTEA 3FOUA 3GCFA 4NBAA 3BCCE 2BMQA 1P84E 2NVEA 2Q3WA 3GZYA 2DE6A 1O7NA 5CXMA 1SQBE 4H13D 2QPZA 4NBED 1EZVE 5AEUA 1JM1A 4NBAD 1L0LE 1NTME 4PV1D 3VCPA 3EQQA 1PP9E 3EN1A 2GBXA 4QUQA 2NVGA 4HM5A 5AEWA 2A06E 3L70E 4HM0A 2DE5D 1KYOE 2XRXA 4HM3A 2ZT9D 3GL2A 3GOBA 1RFSA 3L72E 3L73E 1NYKA 4P1BH 3CWBE 4QDCA 2BMRA 3GTSA 3GL0A 2NUKA 1KB9E 3GCEA 1UUVA 1BE3E 3H1LE 1SJGA 3VMID 2E4PA 3H1HE 1PPJE 1VM9A 4HKVA 5BOKA 2DE5A 1G8JB 1SQXE 4QURA 4QUPA 2NVFA 3GB4A 3H1IE 1FQTA 4NBCD 2E4QA 2YFLA 4QDFA 3VMIA 4NBFA 4NBGA 3VMHD 2B24A 1SQPE 4NBCA 4NB9A 4U3FE 4OGQD 2BCCE 3AZCA 2FYUE 1G8KB 4H0LD 3VMGD 4EMJB 2HMOA 4P1CH 3CXHE 4QDDA 2XR8A 4HM1A 4NB9D 2XSOA 2YFIA 2YVJB 1O7MA 1WW9A 4AIVA 4PD4E 2DE7A 5KKZC 2HMJA 2YFJA 4H44D 4QDFB 4HM8A 3VMGA 4HM4A 1VCKA 3GZXA 1SQVE 3D89A 2JO6A 1ULIA 4NBDD 1BCCE 2YIUC 4HJLA 2QJPC 4NB8D 4HM2A 4NBDA 2HMNA 2JZAA 4HM6A 2DE6D 1Q90C 1SQQE 5HL4A 3GKQA 3N0QA 3TGUE 2E74D 3L71E 3L75E 1NTKE 4QCKA 1ULJA 4NBFD 2HMKA 3H1JE 4NBGD 2HMLA 4NB8A 3VMHA 4NBBA 2D2CD 2E75D 1O7GA 1NTZE 2IBZE 1O7WA 1WQLA 2QJYC 1NDOA 1UUWA 2B1XA 5KLVE 4AAYB 3L74E 3C0DA 2QJKC 2ZYLA 1Z01A 1EG9A 2FYNC 1ZRTE 4NBHA 3VCAA 2E76D 1Z02A 4NBBD 2CKFA 1NU1E 1VF5D 1RIEA 1O7HA 3H1KE 4HM7A 2I7FA 2NUMA 4NBHD 1Z03A 2BMOA
chains in the Genus database with same CATH superfamily
2DE7D 2HMMA 3CX5E 2XSHA 2NWFA 2GBWA 1O7PA 3DQYA 1L0NE 4NBEA 5KLIC 3GKEA 3GTEA 3FOUA 3GCFA 4NBAA 3BCCE 2BMQA 1P84E 2NVEA 2Q3WA 3GZYA 2DE6A 1O7NA 5CXMA 1SQBE 4H13D 2QPZA 4NBED 1EZVE 5AEUA 1JM1A 4NBAD 1L0LE 1NTME 4PV1D 3VCPA 3EQQA 1PP9E 3EN1A 2GBXA 4QUQA 2NVGA 4HM5A 5AEWA 2A06E 3L70E 4HM0A 2DE5D 1KYOE 2XRXA 4HM3A 2ZT9D 3GL2A 3GOBA 1RFSA 3L72E 3L73E 1NYKA 4P1BH 3CWBE 4QDCA 2BMRA 3GTSA 3GL0A 2NUKA 1KB9E 3GCEA 1UUVA 1BE3E 3H1LE 1SJGA 3VMID 2E4PA 3H1HE 1PPJE 1VM9A 4HKVA 5BOKA 2DE5A 1G8JB 1SQXE 4QURA 4QUPA 2NVFA 3GB4A 3H1IE 1FQTA 4NBCD 2E4QA 2YFLA 4QDFA 3VMIA 4NBFA 4NBGA 3VMHD 2B24A 1SQPE 4NBCA 4NB9A 4U3FE 4OGQD 2BCCE 3AZCA 2FYUE 1G8KB 4H0LD 3VMGD 4EMJB 2HMOA 4P1CH 3CXHE 4QDDA 2XR8A 4HM1A 4NB9D 2XSOA 2YFIA 2YVJB 1O7MA 1WW9A 4AIVA 4PD4E 2DE7A 5KKZC 2HMJA 2YFJA 4H44D 4QDFB 4HM8A 3VMGA 4HM4A 1VCKA 3GZXA 1SQVE 3D89A 2JO6A 1ULIA 4NBDD 1BCCE 2YIUC 4HJLA 2QJPC 4NB8D 4HM2A 4NBDA 2HMNA 2JZAA 4HM6A 2DE6D 1Q90C 1SQQE 5HL4A 3GKQA 3N0QA 3TGUE 2E74D 3L71E 3L75E 1NTKE 4QCKA 1ULJA 4NBFD 2HMKA 3H1JE 4NBGD 2HMLA 4NB8A 3VMHA 4NBBA 2D2CD 2E75D 1O7GA 1NTZE 2IBZE 1O7WA 1WQLA 2QJYC 1NDOA 1UUWA 2B1XA 5KLVE 4AAYB 3L74E 3C0DA 2QJKC 2ZYLA 1Z01A 1EG9A 2FYNC 1ZRTE 4NBHA 3VCAA 2E76D 1Z02A 4NBBD 2CKFA 1NU1E 1VF5D 1RIEA 1O7HA 3H1KE 4HM7A 2I7FA 2NUMA 4NBHD 1Z03A 2BMOA
chains in the Genus database with same CATH topology
2DE7D 2HMMA 3CX5E 2XSHA 2NWFA 2GBWA 1O7PA 3DQYA 1L0NE 4NBEA 5KLIC 3GKEA 3GTEA 3FOUA 3GCFA 4NBAA 3BCCE 2BMQA 1P84E 2NVEA 2Q3WA 3GZYA 2DE6A 1O7NA 5CXMA 1SQBE 4H13D 2QPZA 4NBED 1EZVE 5AEUA 1JM1A 4NBAD 1L0LE 1NTME 4PV1D 3VCPA 3EQQA 1PP9E 3EN1A 2GBXA 4QUQA 2NVGA 4HM5A 5AEWA 2A06E 3L70E 4HM0A 2DE5D 1KYOE 2XRXA 4HM3A 2ZT9D 3GL2A 3GOBA 1RFSA 3L72E 3L73E 1NYKA 4P1BH 3CWBE 4QDCA 2BMRA 3GTSA 3GL0A 2NUKA 1KB9E 3GCEA 1UUVA 1BE3E 3H1LE 1SJGA 3VMID 2E4PA 3H1HE 1PPJE 1VM9A 4HKVA 5BOKA 2DE5A 1G8JB 1SQXE 4QURA 4QUPA 2NVFA 3GB4A 3H1IE 1FQTA 4NBCD 2E4QA 2YFLA 4QDFA 3VMIA 4NBFA 4NBGA 3VMHD 2B24A 1SQPE 4NBCA 4NB9A 4U3FE 4OGQD 2BCCE 3AZCA 2FYUE 1G8KB 4H0LD 3VMGD 4EMJB 2HMOA 4P1CH 3CXHE 4QDDA 2XR8A 4HM1A 4NB9D 2XSOA 2YFIA 2YVJB 1O7MA 1WW9A 4AIVA 4PD4E 2DE7A 5KKZC 2HMJA 2YFJA 4H44D 4QDFB 4HM8A 3VMGA 4HM4A 1VCKA 3GZXA 1SQVE 3D89A 2JO6A 1ULIA 4NBDD 1BCCE 2YIUC 4HJLA 2QJPC 4NB8D 4HM2A 4NBDA 2HMNA 2JZAA 4HM6A 2DE6D 1Q90C 1SQQE 5HL4A 3GKQA 3N0QA 3TGUE 2E74D 3L71E 3L75E 1NTKE 4QCKA 1ULJA 4NBFD 2HMKA 3H1JE 4NBGD 2HMLA 4NB8A 3VMHA 4NBBA 2D2CD 2E75D 1O7GA 1NTZE 2IBZE 1O7WA 1WQLA 2QJYC 1NDOA 1UUWA 2B1XA 5KLVE 4AAYB 3L74E 3C0DA 2QJKC 2ZYLA 1Z01A 1EG9A 2FYNC 1ZRTE 4NBHA 3VCAA 2E76D 1Z02A 4NBBD 2CKFA 1NU1E 1VF5D 1RIEA 1O7HA 3H1KE 4HM7A 2I7FA 2NUMA 4NBHD 1Z03A 2BMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE7 D;  2HMM A;  3CX5 E;  2XSH A;  2NWF A;  2GBW A;  1O7P A;  3DQY A;  1L0N E;  4NBE A;  5KLI C;  3GKE A;  3GTE A;  3FOU A;  3GCF A;  4NBA A;  3BCC E;  2BMQ A;  1P84 E;  2NVE A;  2Q3W A;  3GZY A;  2DE6 A;  1O7N A;  5CXM A;  1SQB E;  4H13 D;  2QPZ A;  4NBE D;  1EZV E;  5AEU A;  1JM1 A;  4NBA D;  1L0L E;  1NTM E;  4PV1 D;  3VCP A;  3EQQ A;  1PP9 E;  3EN1 A;  2GBX A;  4QUQ A;  2NVG A;  4HM5 A;  5AEW A;  2A06 E;  3L70 E;  4HM0 A;  2DE5 D;  1KYO E;  2XRX A;  4HM3 A;  2ZT9 D;  3GL2 A;  3GOB A;  1RFS A;  3L72 E;  3L73 E;  1NYK A;  4P1B H;  3CWB E;  4QDC A;  2BMR A;  3GTS A;  3GL0 A;  2NUK A;  1KB9 E;  3GCE A;  1UUV A;  1BE3 E;  3H1L E;  1SJG A;  3VMI D;  2E4P A;  3H1H E;  1PPJ E;  1VM9 A;  4HKV A;  5BOK A;  2DE5 A;  1G8J B;  1SQX E;  4QUR A;  4QUP A;  2NVF A;  3GB4 A;  3H1I E;  1FQT A;  4NBC D;  2E4Q A;  2YFL A;  4QDF A;  3VMI A;  4NBF A;  4NBG A;  3VMH D;  2B24 A;  1SQP E;  4NBC A;  4NB9 A;  4U3F E;  4OGQ D;  2BCC E;  3AZC A;  2FYU E;  1G8K B;  4H0L D;  3VMG D;  4EMJ B;  2HMO A;  4P1C H;  3CXH E;  4QDD A;  2XR8 A;  4HM1 A;  4NB9 D;  2XSO A;  2YFI A;  2YVJ B;  1O7M A;  1WW9 A;  4AIV A;  4PD4 E;  2DE7 A;  5KKZ C;  2HMJ A;  2YFJ A;  4H44 D;  4QDF B;  4HM8 A;  3VMG A;  4HM4 A;  1VCK A;  3GZX A;  1SQV E;  3D89 A;  2JO6 A;  1ULI A;  4NBD D;  1BCC E;  2YIU C;  4HJL A;  2QJP C;  4NB8 D;  4HM2 A;  4NBD A;  2HMN A;  2JZA A;  4HM6 A;  2DE6 D;  1Q90 C;  1SQQ E;  5HL4 A;  3GKQ A;  3N0Q A;  3TGU E;  2E74 D;  3L71 E;  3L75 E;  1NTK E;  4QCK A;  1ULJ A;  4NBF D;  2HMK A;  3H1J E;  4NBG D;  2HML A;  4NB8 A;  3VMH A;  4NBB A;  2D2C D;  2E75 D;  1O7G A;  1NTZ E;  2IBZ E;  1O7W A;  1WQL A;  2QJY C;  1NDO A;  1UUW A;  2B1X A;  5KLV E;  4AAY B;  3L74 E;  3C0D A;  2QJK C;  2ZYL A;  1Z01 A;  1EG9 A;  2FYN C;  1ZRT E;  4NBH A;  3VCA A;  2E76 D;  1Z02 A;  4NBB D;  2CKF A;  1NU1 E;  1VF5 D;  1RIE A;  1O7H A;  3H1K E;  4HM7 A;  2I7F A;  2NUM A;  4NBH D;  1Z03 A;  2BMO A; 
#chains in the Genus database with same CATH topology
 2DE7 D;  2HMM A;  3CX5 E;  2XSH A;  2NWF A;  2GBW A;  1O7P A;  3DQY A;  1L0N E;  4NBE A;  5KLI C;  3GKE A;  3GTE A;  3FOU A;  3GCF A;  4NBA A;  3BCC E;  2BMQ A;  1P84 E;  2NVE A;  2Q3W A;  3GZY A;  2DE6 A;  1O7N A;  5CXM A;  1SQB E;  4H13 D;  2QPZ A;  4NBE D;  1EZV E;  5AEU A;  1JM1 A;  4NBA D;  1L0L E;  1NTM E;  4PV1 D;  3VCP A;  3EQQ A;  1PP9 E;  3EN1 A;  2GBX A;  4QUQ A;  2NVG A;  4HM5 A;  5AEW A;  2A06 E;  3L70 E;  4HM0 A;  2DE5 D;  1KYO E;  2XRX A;  4HM3 A;  2ZT9 D;  3GL2 A;  3GOB A;  1RFS A;  3L72 E;  3L73 E;  1NYK A;  4P1B H;  3CWB E;  4QDC A;  2BMR A;  3GTS A;  3GL0 A;  2NUK A;  1KB9 E;  3GCE A;  1UUV A;  1BE3 E;  3H1L E;  1SJG A;  3VMI D;  2E4P A;  3H1H E;  1PPJ E;  1VM9 A;  4HKV A;  5BOK A;  2DE5 A;  1G8J B;  1SQX E;  4QUR A;  4QUP A;  2NVF A;  3GB4 A;  3H1I E;  1FQT A;  4NBC D;  2E4Q A;  2YFL A;  4QDF A;  3VMI A;  4NBF A;  4NBG A;  3VMH D;  2B24 A;  1SQP E;  4NBC A;  4NB9 A;  4U3F E;  4OGQ D;  2BCC E;  3AZC A;  2FYU E;  1G8K B;  4H0L D;  3VMG D;  4EMJ B;  2HMO A;  4P1C H;  3CXH E;  4QDD A;  2XR8 A;  4HM1 A;  4NB9 D;  2XSO A;  2YFI A;  2YVJ B;  1O7M A;  1WW9 A;  4AIV A;  4PD4 E;  2DE7 A;  5KKZ C;  2HMJ A;  2YFJ A;  4H44 D;  4QDF B;  4HM8 A;  3VMG A;  4HM4 A;  1VCK A;  3GZX A;  1SQV E;  3D89 A;  2JO6 A;  1ULI A;  4NBD D;  1BCC E;  2YIU C;  4HJL A;  2QJP C;  4NB8 D;  4HM2 A;  4NBD A;  2HMN A;  2JZA A;  4HM6 A;  2DE6 D;  1Q90 C;  1SQQ E;  5HL4 A;  3GKQ A;  3N0Q A;  3TGU E;  2E74 D;  3L71 E;  3L75 E;  1NTK E;  4QCK A;  1ULJ A;  4NBF D;  2HMK A;  3H1J E;  4NBG D;  2HML A;  4NB8 A;  3VMH A;  4NBB A;  2D2C D;  2E75 D;  1O7G A;  1NTZ E;  2IBZ E;  1O7W A;  1WQL A;  2QJY C;  1NDO A;  1UUW A;  2B1X A;  5KLV E;  4AAY B;  3L74 E;  3C0D A;  2QJK C;  2ZYL A;  1Z01 A;  1EG9 A;  2FYN C;  1ZRT E;  4NBH A;  3VCA A;  2E76 D;  1Z02 A;  4NBB D;  2CKF A;  1NU1 E;  1VF5 D;  1RIE A;  1O7H A;  3H1K E;  4HM7 A;  2I7F A;  2NUM A;  4NBH D;  1Z03 A;  2BMO A; 
#chains in the Genus database with same CATH homology
 2DE7 D;  2HMM A;  3CX5 E;  2XSH A;  2NWF A;  2GBW A;  1O7P A;  3DQY A;  1L0N E;  4NBE A;  5KLI C;  3GKE A;  3GTE A;  3FOU A;  3GCF A;  4NBA A;  3BCC E;  2BMQ A;  1P84 E;  2NVE A;  2Q3W A;  3GZY A;  2DE6 A;  1O7N A;  5CXM A;  1SQB E;  4H13 D;  2QPZ A;  4NBE D;  1EZV E;  5AEU A;  1JM1 A;  4NBA D;  1L0L E;  1NTM E;  4PV1 D;  3VCP A;  3EQQ A;  1PP9 E;  3EN1 A;  2GBX A;  4QUQ A;  2NVG A;  4HM5 A;  5AEW A;  2A06 E;  3L70 E;  4HM0 A;  2DE5 D;  1KYO E;  2XRX A;  4HM3 A;  2ZT9 D;  3GL2 A;  3GOB A;  1RFS A;  3L72 E;  3L73 E;  1NYK A;  4P1B H;  3CWB E;  4QDC A;  2BMR A;  3GTS A;  3GL0 A;  2NUK A;  1KB9 E;  3GCE A;  1UUV A;  1BE3 E;  3H1L E;  1SJG A;  3VMI D;  2E4P A;  3H1H E;  1PPJ E;  1VM9 A;  4HKV A;  5BOK A;  2DE5 A;  1G8J B;  1SQX E;  4QUR A;  4QUP A;  2NVF A;  3GB4 A;  3H1I E;  1FQT A;  4NBC D;  2E4Q A;  2YFL A;  4QDF A;  3VMI A;  4NBF A;  4NBG A;  3VMH D;  2B24 A;  1SQP E;  4NBC A;  4NB9 A;  4U3F E;  4OGQ D;  2BCC E;  3AZC A;  2FYU E;  1G8K B;  4H0L D;  3VMG D;  4EMJ B;  2HMO A;  4P1C H;  3CXH E;  4QDD A;  2XR8 A;  4HM1 A;  4NB9 D;  2XSO A;  2YFI A;  2YVJ B;  1O7M A;  1WW9 A;  4AIV A;  4PD4 E;  2DE7 A;  5KKZ C;  2HMJ A;  2YFJ A;  4H44 D;  4QDF B;  4HM8 A;  3VMG A;  4HM4 A;  1VCK A;  3GZX A;  1SQV E;  3D89 A;  2JO6 A;  1ULI A;  4NBD D;  1BCC E;  2YIU C;  4HJL A;  2QJP C;  4NB8 D;  4HM2 A;  4NBD A;  2HMN A;  2JZA A;  4HM6 A;  2DE6 D;  1Q90 C;  1SQQ E;  5HL4 A;  3GKQ A;  3N0Q A;  3TGU E;  2E74 D;  3L71 E;  3L75 E;  1NTK E;  4QCK A;  1ULJ A;  4NBF D;  2HMK A;  3H1J E;  4NBG D;  2HML A;  4NB8 A;  3VMH A;  4NBB A;  2D2C D;  2E75 D;  1O7G A;  1NTZ E;  2IBZ E;  1O7W A;  1WQL A;  2QJY C;  1NDO A;  1UUW A;  2B1X A;  5KLV E;  4AAY B;  3L74 E;  3C0D A;  2QJK C;  2ZYL A;  1Z01 A;  1EG9 A;  2FYN C;  1ZRT E;  4NBH A;  3VCA A;  2E76 D;  1Z02 A;  4NBB D;  2CKF A;  1NU1 E;  1VF5 D;  1RIE A;  1O7H A;  3H1K E;  4HM7 A;  2I7F A;  2NUM A;  4NBH D;  1Z03 A;  2BMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...