2YFJA

Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNQIRVWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPFNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Retuning Rieske-Type Oxygenases to Expand Substrate Range.
pubmed doi rcsb
source organism Burkholderia xenovorans
total genus 136
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yfjA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2yfjA01
2NWFA 3GKEA 4NB8D 1SQXE 4NBAD 2GBXA 1SQPE 2E4PA 3GTSA 2DE7A 4NBGA 4HM2A 3GZXA 3GZYA 1NTME 4QUQA 1O7GA 3D89A 4NBCD 4H13D 3GB4A 2A06E 4NBFD 3FOUA 2YFLA 2BCCE 2HMNA 3CX5E 4QDFA 1RFSA 1VF5D 1NTZE 3L71E 4HM6A 4NBAA 2BMOA 5BOKA 3VCPA 3VMID 2E74D 2YFIA 1SQVE 4QCKA 3L73E 4NBBD 3VMGD 1O7HA 3VCAA 4QURA 1BCCE 1ZRTE 2D2CD 3EQQA 2HMKA 4P1CH 5AEWA 4HKVA 2QJPC 4NBFA 4NBCA 1SJGA 2NVEA 3GCFA 1O7NA 2JO6A 1EG9A 1NTKE 3CWBE 3H1HE 1ULJA 3H1LE 1L0NE 1WW9A 2DE5D 4EMJB 4PV1D 3VMIA 2FYUE 4HJLA 4NBBA 2FYNC 2BMRA 2YIUC 2YFJA 4NBDD 1NDOA 3GKQA 1P84E 4NBHD 4AAYB 1KYOE 3L75E 3L72E 4NB8A 4HM4A 2NUKA 4NBED 1G8KB 2HMLA 1L0LE 1UUWA 2DE5A 3EN1A 1Q90C 3L74E 3GL0A 2JZAA 5KLIC 1O7WA 1PP9E 1SQQE 3C0DA 4HM0A 4HM8A 1UUVA 2XR8A 4NBDA 3L70E 3CXHE 5CXMA 4H0LD 4NBHA 3N0QA 5AEUA 1BE3E 1VCKA 2XSHA 1ULIA 1G8JB 2E4QA 2HMOA 4NBEA 4HM3A 4QDDA 1KB9E 1NU1E 3VMGA 1EZVE 3H1JE 2I7FA 3VMHD 3TGUE 2DE6D 2NVFA 1SQBE 2HMJA 2E76D 1Z03A 4PD4E 2QJKC 1RIEA 3GL2A 4NB9D 5KLVE 4H44D 3GCEA 4QDCA 1WQLA 3AZCA 2ZYLA 2IBZE 2GBWA 3H1IE 2B1XA 4U3FE 2E75D 5HL4A 3VMHA 2CKFA 2DE6A 1PPJE 3GOBA 2Q3WA 3BCCE 1Z01A 1O7PA 4P1BH 2NVGA 3H1KE 4NB9A 1O7MA 1Z02A 3DQYA 4HM7A 1FQTA 4HM5A 2BMQA 2YVJB 4OGQD 2B24A 2XRXA 4HM1A 2DE7D 2QPZA 4NBGD 4AIVA 5KKZC 4QUPA 2HMMA 2NUMA 2QJYC 4QDFB 1JM1A 3GTEA 2ZT9D 2XSOA 1VM9A 1NYKA
chains in the Genus database with same CATH superfamily
2NWFA 3GKEA 4NB8D 1SQXE 4NBAD 2GBXA 1SQPE 2E4PA 3GTSA 2DE7A 4NBGA 4HM2A 3GZXA 3GZYA 1NTME 4QUQA 1O7GA 3D89A 4NBCD 4H13D 3GB4A 2A06E 4NBFD 3FOUA 2YFLA 2BCCE 2HMNA 3CX5E 4QDFA 1RFSA 1VF5D 1NTZE 3L71E 4HM6A 4NBAA 2BMOA 5BOKA 3VCPA 3VMID 2E74D 2YFIA 1SQVE 4QCKA 3L73E 4NBBD 3VMGD 1O7HA 3VCAA 4QURA 1BCCE 1ZRTE 2D2CD 3EQQA 2HMKA 4P1CH 5AEWA 4HKVA 2QJPC 4NBFA 4NBCA 1SJGA 2NVEA 3GCFA 1O7NA 2JO6A 1EG9A 1NTKE 3CWBE 3H1HE 1ULJA 3H1LE 1L0NE 1WW9A 2DE5D 4EMJB 4PV1D 3VMIA 2FYUE 4HJLA 4NBBA 2FYNC 2BMRA 2YIUC 2YFJA 4NBDD 1NDOA 3GKQA 1P84E 4NBHD 4AAYB 1KYOE 3L75E 3L72E 4NB8A 4HM4A 2NUKA 4NBED 1G8KB 2HMLA 1L0LE 1UUWA 2DE5A 3EN1A 1Q90C 3L74E 3GL0A 2JZAA 5KLIC 1O7WA 1PP9E 1SQQE 3C0DA 4HM0A 4HM8A 1UUVA 2XR8A 4NBDA 3L70E 3CXHE 5CXMA 4H0LD 4NBHA 3N0QA 5AEUA 1BE3E 1VCKA 2XSHA 1ULIA 1G8JB 2E4QA 2HMOA 4NBEA 4HM3A 4QDDA 1KB9E 1NU1E 3VMGA 1EZVE 3H1JE 2I7FA 3VMHD 3TGUE 2DE6D 2NVFA 1SQBE 2HMJA 2E76D 1Z03A 4PD4E 2QJKC 1RIEA 3GL2A 4NB9D 5KLVE 4H44D 3GCEA 4QDCA 1WQLA 3AZCA 2ZYLA 2IBZE 2GBWA 3H1IE 2B1XA 4U3FE 2E75D 5HL4A 3VMHA 2CKFA 2DE6A 1PPJE 3GOBA 2Q3WA 3BCCE 1Z01A 1O7PA 4P1BH 2NVGA 3H1KE 4NB9A 1O7MA 1Z02A 3DQYA 4HM7A 1FQTA 4HM5A 2BMQA 2YVJB 4OGQD 2B24A 2XRXA 4HM1A 2DE7D 2QPZA 4NBGD 4AIVA 5KKZC 4QUPA 2HMMA 2NUMA 2QJYC 4QDFB 1JM1A 3GTEA 2ZT9D 2XSOA 1VM9A 1NYKA
chains in the Genus database with same CATH topology
2NWFA 3GKEA 4NB8D 1SQXE 4NBAD 2GBXA 1SQPE 2E4PA 3GTSA 2DE7A 4NBGA 4HM2A 3GZXA 3GZYA 1NTME 4QUQA 1O7GA 3D89A 4NBCD 4H13D 3GB4A 2A06E 4NBFD 3FOUA 2YFLA 2BCCE 2HMNA 3CX5E 4QDFA 1RFSA 1VF5D 1NTZE 3L71E 4HM6A 4NBAA 2BMOA 5BOKA 3VCPA 3VMID 2E74D 2YFIA 1SQVE 4QCKA 3L73E 4NBBD 3VMGD 1O7HA 3VCAA 4QURA 1BCCE 1ZRTE 2D2CD 3EQQA 2HMKA 4P1CH 5AEWA 4HKVA 2QJPC 4NBFA 4NBCA 1SJGA 2NVEA 3GCFA 1O7NA 2JO6A 1EG9A 1NTKE 3CWBE 3H1HE 1ULJA 3H1LE 1L0NE 1WW9A 2DE5D 4EMJB 4PV1D 3VMIA 2FYUE 4HJLA 4NBBA 2FYNC 2BMRA 2YIUC 2YFJA 4NBDD 1NDOA 3GKQA 1P84E 4NBHD 4AAYB 1KYOE 3L75E 3L72E 4NB8A 4HM4A 2NUKA 4NBED 1G8KB 2HMLA 1L0LE 1UUWA 2DE5A 3EN1A 1Q90C 3L74E 3GL0A 2JZAA 5KLIC 1O7WA 1PP9E 1SQQE 3C0DA 4HM0A 4HM8A 1UUVA 2XR8A 4NBDA 3L70E 3CXHE 5CXMA 4H0LD 4NBHA 3N0QA 5AEUA 1BE3E 1VCKA 2XSHA 1ULIA 1G8JB 2E4QA 2HMOA 4NBEA 4HM3A 4QDDA 1KB9E 1NU1E 3VMGA 1EZVE 3H1JE 2I7FA 3VMHD 3TGUE 2DE6D 2NVFA 1SQBE 2HMJA 2E76D 1Z03A 4PD4E 2QJKC 1RIEA 3GL2A 4NB9D 5KLVE 4H44D 3GCEA 4QDCA 1WQLA 3AZCA 2ZYLA 2IBZE 2GBWA 3H1IE 2B1XA 4U3FE 2E75D 5HL4A 3VMHA 2CKFA 2DE6A 1PPJE 3GOBA 2Q3WA 3BCCE 1Z01A 1O7PA 4P1BH 2NVGA 3H1KE 4NB9A 1O7MA 1Z02A 3DQYA 4HM7A 1FQTA 4HM5A 2BMQA 2YVJB 4OGQD 2B24A 2XRXA 4HM1A 2DE7D 2QPZA 4NBGD 4AIVA 5KKZC 4QUPA 2HMMA 2NUMA 2QJYC 4QDFB 1JM1A 3GTEA 2ZT9D 2XSOA 1VM9A 1NYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NWF A;  3GKE A;  4NB8 D;  1SQX E;  4NBA D;  2GBX A;  1SQP E;  2E4P A;  3GTS A;  2DE7 A;  4NBG A;  4HM2 A;  3GZX A;  3GZY A;  1NTM E;  4QUQ A;  1O7G A;  3D89 A;  4NBC D;  4H13 D;  3GB4 A;  2A06 E;  4NBF D;  3FOU A;  2YFL A;  2BCC E;  2HMN A;  3CX5 E;  4QDF A;  1RFS A;  1VF5 D;  1NTZ E;  3L71 E;  4HM6 A;  4NBA A;  2BMO A;  5BOK A;  3VCP A;  3VMI D;  2E74 D;  2YFI A;  1SQV E;  4QCK A;  3L73 E;  4NBB D;  3VMG D;  1O7H A;  3VCA A;  4QUR A;  1BCC E;  1ZRT E;  2D2C D;  3EQQ A;  2HMK A;  4P1C H;  5AEW A;  4HKV A;  2QJP C;  4NBF A;  4NBC A;  1SJG A;  2NVE A;  3GCF A;  1O7N A;  2JO6 A;  1EG9 A;  1NTK E;  3CWB E;  3H1H E;  1ULJ A;  3H1L E;  1L0N E;  1WW9 A;  2DE5 D;  4EMJ B;  4PV1 D;  3VMI A;  2FYU E;  4HJL A;  4NBB A;  2FYN C;  2BMR A;  2YIU C;  2YFJ A;  4NBD D;  1NDO A;  3GKQ A;  1P84 E;  4NBH D;  4AAY B;  1KYO E;  3L75 E;  3L72 E;  4NB8 A;  4HM4 A;  2NUK A;  4NBE D;  1G8K B;  2HML A;  1L0L E;  1UUW A;  2DE5 A;  3EN1 A;  1Q90 C;  3L74 E;  3GL0 A;  2JZA A;  5KLI C;  1O7W A;  1PP9 E;  1SQQ E;  3C0D A;  4HM0 A;  4HM8 A;  1UUV A;  2XR8 A;  4NBD A;  3L70 E;  3CXH E;  5CXM A;  4H0L D;  4NBH A;  3N0Q A;  5AEU A;  1BE3 E;  1VCK A;  2XSH A;  1ULI A;  1G8J B;  2E4Q A;  2HMO A;  4NBE A;  4HM3 A;  4QDD A;  1KB9 E;  1NU1 E;  3VMG A;  1EZV E;  3H1J E;  2I7F A;  3VMH D;  3TGU E;  2DE6 D;  2NVF A;  1SQB E;  2HMJ A;  2E76 D;  1Z03 A;  4PD4 E;  2QJK C;  1RIE A;  3GL2 A;  4NB9 D;  5KLV E;  4H44 D;  3GCE A;  4QDC A;  1WQL A;  3AZC A;  2ZYL A;  2IBZ E;  2GBW A;  3H1I E;  2B1X A;  4U3F E;  2E75 D;  5HL4 A;  3VMH A;  2CKF A;  2DE6 A;  1PPJ E;  3GOB A;  2Q3W A;  3BCC E;  1Z01 A;  1O7P A;  4P1B H;  2NVG A;  3H1K E;  4NB9 A;  1O7M A;  1Z02 A;  3DQY A;  4HM7 A;  1FQT A;  4HM5 A;  2BMQ A;  2YVJ B;  4OGQ D;  2B24 A;  2XRX A;  4HM1 A;  2DE7 D;  2QPZ A;  4NBG D;  4AIV A;  5KKZ C;  4QUP A;  2HMM A;  2NUM A;  2QJY C;  4QDF B;  1JM1 A;  3GTE A;  2ZT9 D;  2XSO A;  1VM9 A;  1NYK A; 
#chains in the Genus database with same CATH topology
 2NWF A;  3GKE A;  4NB8 D;  1SQX E;  4NBA D;  2GBX A;  1SQP E;  2E4P A;  3GTS A;  2DE7 A;  4NBG A;  4HM2 A;  3GZX A;  3GZY A;  1NTM E;  4QUQ A;  1O7G A;  3D89 A;  4NBC D;  4H13 D;  3GB4 A;  2A06 E;  4NBF D;  3FOU A;  2YFL A;  2BCC E;  2HMN A;  3CX5 E;  4QDF A;  1RFS A;  1VF5 D;  1NTZ E;  3L71 E;  4HM6 A;  4NBA A;  2BMO A;  5BOK A;  3VCP A;  3VMI D;  2E74 D;  2YFI A;  1SQV E;  4QCK A;  3L73 E;  4NBB D;  3VMG D;  1O7H A;  3VCA A;  4QUR A;  1BCC E;  1ZRT E;  2D2C D;  3EQQ A;  2HMK A;  4P1C H;  5AEW A;  4HKV A;  2QJP C;  4NBF A;  4NBC A;  1SJG A;  2NVE A;  3GCF A;  1O7N A;  2JO6 A;  1EG9 A;  1NTK E;  3CWB E;  3H1H E;  1ULJ A;  3H1L E;  1L0N E;  1WW9 A;  2DE5 D;  4EMJ B;  4PV1 D;  3VMI A;  2FYU E;  4HJL A;  4NBB A;  2FYN C;  2BMR A;  2YIU C;  2YFJ A;  4NBD D;  1NDO A;  3GKQ A;  1P84 E;  4NBH D;  4AAY B;  1KYO E;  3L75 E;  3L72 E;  4NB8 A;  4HM4 A;  2NUK A;  4NBE D;  1G8K B;  2HML A;  1L0L E;  1UUW A;  2DE5 A;  3EN1 A;  1Q90 C;  3L74 E;  3GL0 A;  2JZA A;  5KLI C;  1O7W A;  1PP9 E;  1SQQ E;  3C0D A;  4HM0 A;  4HM8 A;  1UUV A;  2XR8 A;  4NBD A;  3L70 E;  3CXH E;  5CXM A;  4H0L D;  4NBH A;  3N0Q A;  5AEU A;  1BE3 E;  1VCK A;  2XSH A;  1ULI A;  1G8J B;  2E4Q A;  2HMO A;  4NBE A;  4HM3 A;  4QDD A;  1KB9 E;  1NU1 E;  3VMG A;  1EZV E;  3H1J E;  2I7F A;  3VMH D;  3TGU E;  2DE6 D;  2NVF A;  1SQB E;  2HMJ A;  2E76 D;  1Z03 A;  4PD4 E;  2QJK C;  1RIE A;  3GL2 A;  4NB9 D;  5KLV E;  4H44 D;  3GCE A;  4QDC A;  1WQL A;  3AZC A;  2ZYL A;  2IBZ E;  2GBW A;  3H1I E;  2B1X A;  4U3F E;  2E75 D;  5HL4 A;  3VMH A;  2CKF A;  2DE6 A;  1PPJ E;  3GOB A;  2Q3W A;  3BCC E;  1Z01 A;  1O7P A;  4P1B H;  2NVG A;  3H1K E;  4NB9 A;  1O7M A;  1Z02 A;  3DQY A;  4HM7 A;  1FQT A;  4HM5 A;  2BMQ A;  2YVJ B;  4OGQ D;  2B24 A;  2XRX A;  4HM1 A;  2DE7 D;  2QPZ A;  4NBG D;  4AIV A;  5KKZ C;  4QUP A;  2HMM A;  2NUM A;  2QJY C;  4QDF B;  1JM1 A;  3GTE A;  2ZT9 D;  2XSO A;  1VM9 A;  1NYK A; 
#chains in the Genus database with same CATH homology
 2NWF A;  3GKE A;  4NB8 D;  1SQX E;  4NBA D;  2GBX A;  1SQP E;  2E4P A;  3GTS A;  2DE7 A;  4NBG A;  4HM2 A;  3GZX A;  3GZY A;  1NTM E;  4QUQ A;  1O7G A;  3D89 A;  4NBC D;  4H13 D;  3GB4 A;  2A06 E;  4NBF D;  3FOU A;  2YFL A;  2BCC E;  2HMN A;  3CX5 E;  4QDF A;  1RFS A;  1VF5 D;  1NTZ E;  3L71 E;  4HM6 A;  4NBA A;  2BMO A;  5BOK A;  3VCP A;  3VMI D;  2E74 D;  2YFI A;  1SQV E;  4QCK A;  3L73 E;  4NBB D;  3VMG D;  1O7H A;  3VCA A;  4QUR A;  1BCC E;  1ZRT E;  2D2C D;  3EQQ A;  2HMK A;  4P1C H;  5AEW A;  4HKV A;  2QJP C;  4NBF A;  4NBC A;  1SJG A;  2NVE A;  3GCF A;  1O7N A;  2JO6 A;  1EG9 A;  1NTK E;  3CWB E;  3H1H E;  1ULJ A;  3H1L E;  1L0N E;  1WW9 A;  2DE5 D;  4EMJ B;  4PV1 D;  3VMI A;  2FYU E;  4HJL A;  4NBB A;  2FYN C;  2BMR A;  2YIU C;  2YFJ A;  4NBD D;  1NDO A;  3GKQ A;  1P84 E;  4NBH D;  4AAY B;  1KYO E;  3L75 E;  3L72 E;  4NB8 A;  4HM4 A;  2NUK A;  4NBE D;  1G8K B;  2HML A;  1L0L E;  1UUW A;  2DE5 A;  3EN1 A;  1Q90 C;  3L74 E;  3GL0 A;  2JZA A;  5KLI C;  1O7W A;  1PP9 E;  1SQQ E;  3C0D A;  4HM0 A;  4HM8 A;  1UUV A;  2XR8 A;  4NBD A;  3L70 E;  3CXH E;  5CXM A;  4H0L D;  4NBH A;  3N0Q A;  5AEU A;  1BE3 E;  1VCK A;  2XSH A;  1ULI A;  1G8J B;  2E4Q A;  2HMO A;  4NBE A;  4HM3 A;  4QDD A;  1KB9 E;  1NU1 E;  3VMG A;  1EZV E;  3H1J E;  2I7F A;  3VMH D;  3TGU E;  2DE6 D;  2NVF A;  1SQB E;  2HMJ A;  2E76 D;  1Z03 A;  4PD4 E;  2QJK C;  1RIE A;  3GL2 A;  4NB9 D;  5KLV E;  4H44 D;  3GCE A;  4QDC A;  1WQL A;  3AZC A;  2ZYL A;  2IBZ E;  2GBW A;  3H1I E;  2B1X A;  4U3F E;  2E75 D;  5HL4 A;  3VMH A;  2CKF A;  2DE6 A;  1PPJ E;  3GOB A;  2Q3W A;  3BCC E;  1Z01 A;  1O7P A;  4P1B H;  2NVG A;  3H1K E;  4NB9 A;  1O7M A;  1Z02 A;  3DQY A;  4HM7 A;  1FQT A;  4HM5 A;  2BMQ A;  2YVJ B;  4OGQ D;  2B24 A;  2XRX A;  4HM1 A;  2DE7 D;  2QPZ A;  4NBG D;  4AIV A;  5KKZ C;  4QUP A;  2HMM A;  2NUM A;  2QJY C;  4QDF B;  1JM1 A;  3GTE A;  2ZT9 D;  2XSO A;  1VM9 A;  1NYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...