1KYOE

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
b'KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 46
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1kyoE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1kyoE02
2YFJA 4QCKA 2Q3WA 3GL0A 2ZYLA 3GTSA 2GBWA 1NTZE 5KKZC 1ULJA 2HMOA 3L74E 2QPZA 4QDCA 5KLIC 1BGYE 2BCCE 4NBFD 5HL4A 4D6TE 1NYKA 3GCEA 5CXMA 1FQTA 2NVGA 3CWBE 3H1HE 2I7FA 2E74D 2XRXA 1ZRTE 2ZT9D 2BMRA 2E75D 4H13D 1L0LE 4HM2A 4HM1A 1O7GA 3H1LE 2IBZE 1NU1E 2YVJB 3TGUE 1O7HA 4HM0A 4HM4A 4HKVA 3H1IE 3D89A 1P84E 2GBXA 3EQQA 1SQBE 2BMQA 4P1CH 3GB4A 2DE7D 1EZVE 1NTKE 3L71E 3N0QA 4HM8A 1O7WA 4QUQA 4H44D 4U3FE 3H1KE 3GZYA 2DE5D 4EMJB 2D2CD 1ULIA 4AAYB 4NB8D 2YIUC 3VCAA 2HMLA 1BE3E 3GKEA 2XR8A 4NBHD 3VCPA 1L0NE 1NDOA 1O7PA 2B24A 4NBCD 4OGQD 2YFIA 4NBED 3VMHD 5BOKA 4HM7A 4HM6A 2NWFA 2CKFA 4QDDA 1O7MA 3VMGD 4AIVA 3DQYA 1G8JB 4QUPA 3CX5E 4PV1D 4NBAD 2QJPC 2NVFA 2XSOA 3H1JE 3L70E 1Q90C 2E4QA 2HMKA 4NB9D 3L72E 1SQQE 3GZXA 1WQLA 5KLVE 3CXHE 1UUWA 4HM3A 1BCCE 1O7NA 2HMMA 2A06E 4QURA 2XSHA 2E76D 3L73E 1JM1A 3GOBA 1SJGA 4H0LD 2DE6D 2QJYC 4QDFB 1KB9E 1VCKA 1VM9A 1SQVE 1NTME 1SQPE 4NBBD 2YFLA 5AEUA 4NBGD 1EG9A 2BMOA 1RFSA 3EN1A 1RIEA 3FOUA 4NBDD 4HJLA 1UUVA 1G8KB 1PPJE 2B1XA 2FYNC 3C0DA 4QDFA 5AEWA 3VMID 3AZCA 4P1BH 3L75E 1VF5D 2NUMA 2JO6A 2JZAA 1PP9E 2QJKC 4HM5A 4PD4E 1KYOE 2HMJA 3GTEA 2NUKA 3GL2A 2HMNA 2E4PA 2NVEA 3BCCE 2FYUE 1SQXE
chains in the Genus database with same CATH superfamily
2BEQD 1WMKA 3II6A 3GL0A 5AVZB 5KLIC 1OW6A 2KSEA 2Q9IA 1M1JA 2H7HA 4JQ0D 2P58A 3V5BA 2XU6A 2XRXA 1BE3J 2XKMA 2ZT9D 1L0ND 2ZYDA 1L0LD 2IBZE 1O7HA 3A0HH 2FBWC 3MGNA 3LW5H 3GB4A 3CCUP 3WMM0 1KN7A 2HPCB 4W7ZA 2D2CD 4ZKUA 2E76B 2HMLA 3N7NA 2K9JB 4NBHD 3IFMA 1OMIA 1NDOA 1LTTC 1SQPJ 3VMHD 1NAYA 2AXTE 2M3EA 1FAVA 1ZR2A 2NPSB 1BDCA 5KTBA 3H1JE 5AW3B 2BASA 4DJGA 2A06E 3L75G 2YKQA 3G3ZA 1NKZB 1JM1A 1PP9D 1KB9E 1CSBA 1SQVD 2HLOA 3SSUA 1H0TA 1UUVA 1KILC 3HD7D 4K3AA 1H8AA 1GK4A 2NUMA 3H32A 2JZAA 1BE3G 3PLNA 2AXCA 5H2FH 3E1RA 4EOTA 1YJWP 3GL2A 5AW1B 4GDOA 2B88A 2FYUD 5E79H 1ZV8A 3P8CE 3RK3D 1N7SC 1BGYE 4NBFD 1S2EA 2IZ0A 2C0WA 2G8YA 2O01J 2KS1B 3GHGB 5APSA 3A0HE 1AVOA 1IFIA 3HTKB 1Z56A 1GDTA 4WY4C 4XA4A 1VPCA 1X8YA 5CJ0A 1S3JA 2QJKB 1DEEG 3EWKA 4UB8H 3EQQA 1HH0A 3L71E 3M9HA 3KXDA 3RK2C 1U7JA 3H1KE 1ULIA 4AAYB 2YIUC 3L73G 3V2PA 2K37A 1PV3A 1SFCD 3DQYA 1JY2P 4UB6H 1KILE 4DOJA 1WQLA 2N1TC 1USDA 4WBAA 2QJYC 3AEFC 4Y99C 5DJTB 3CI9A 1KMIZ 3A2AA 3BCCD 1L2PA 3CCQP 4NBDD 2O1KA 1RF1A 4GODA 2B1XA 3BASA 1LTJA 1NTZJ 3L74G 4D6TJ 1JEKA 3FX0A 5H2FE 1GW4A 3CL3D 3H1HJ 1MFTA 1KTMA 2E74B 1MFZA 5E79E 4PD4D 3H1LJ 1NU1J 2R3CA 2M5AB 2P1JA 2Q3WA 4U3FD 3AE9C 1L4AB 1SQPK 2P7JA 3U59A 1NAFA 3ITKA 1L0NJ 2E75D 4UB8E 1JY3P 4I1LA 1NHLA 2CK3H 3FXEA 2ZYGA 3V2NA 1FOSF 3AECC 2BMQA 3TDKA 1P84D 1YTZI 2E5TA 3I55P 4XFJA 2KK7A 2ZXXA 1BCCG 1PGPA 1MKMA 5AVYB 4KHXA 3H6PA 1J1DC 2LKMA 1NTMG 2CKFA 2WT7A 1T3JA 3VMGD 3NTNA 1FS0E 1PZQA 1Q2NA 2Q3EA 3U1AA 1Q90C 1PPJD 1QLED 1NTZG 1KQFB 3USSA 3L72D 1FZCA 3PHLA 4HM3A 2HMMA 3CXHD 1GU5A 3AEBC 1SJGA 1S5LH 1PP9J 1LT1A 3VP9A 1GL2B 2QM8A 1NU1G 1ZLLA 2R32A 3EN1A 4I2LC 3D70A 2KLVA 2I1JA 3CMEP 2A45G 2BCCJ 2QJPB 3S1KA 1KQSO 1DX7A 3CWBJ 1L0NG 1L0LG 2NUKA 5AW8B 1LWUB 3MTUE 1E79H 3HE4A 2QPZA 1SLQA 1TU3F 2E76C 1PFIA 5AVRB 2NVGA 3FWNA 4GOEA 1KQGB 4OGQB 2NPSC 3M0DC 1DEBA 1KYOI 5CCGA 4HJGH 3C1LA 5APYA 1UIXA 1MUUA 3OAKA 5APUA 5KKZB 2OYIC 2HYNA 1YITP 3GF7A 1MV8A 1PP9G 1SQVG 4HM7A 1X79B 1NTZK 4PV1D 3CX5D 3IR9A 3MZWB 1R5LA 2GUVA 1S5LE 2H88C 3TYYA 1GU4A 1N8RQ 2OTLP 1VF5B 1NU1K 5GTIH 1WT6A 2XZRA 2L5GB 3A5TA 4NBGD 1SQPD 1QL2A 3BCCJ 1SQXD 4JYBA 2ZVOB 2LR2A 2FYUG 2YMKA 2WZ7A 5C39A 1JY2O 3VMID 4TT3H 1L0NK 2KUBA 3GHGC 1EQ7A 2Q3IA 1YQ4C 5AW4B 2H43A 2QJKC 4HM5A 4NPDA 3EQ2A 2IBZD 1Y9BA 1JMBA 2GUSA 1SQBJ 3CMAP 1NO4A 1PIXA 1S1CX 1LTSC 4ZKPA 5CCHC 4U3FJ 4H44B 2E42A 2MJZA 3CCJP 3TSIA 2IYOA 1LJ2A 1ZRTE 3A3YB 4IFDK 3CLQA 3CD6P 4B86A 3H1JD 2O1JA 4ASWA 1T3UA 2HR3A 5KLVJ 3S4RA 2A06D 1KD1Q 1N73A 1AQ5A 4BXLA 2WPRA 1KB9D 1JY3O 2YFIA 3TNUA 5L8RJ 1G8JB 3GG2A 3L70E 1T8ZA 2Z5HA 1SQQE 3U1CA 1URQC 5GTIE 2E74C 1S72P 1DD3A 4H0LD 1PL5A 1Y8AA 2E43A 2WSFH 3GMAA 4O9BA 3C0DA 1L4AC 3P8CD 3G4SP 3CPWO 4U3FG 4KT0J 4IFMA 2M0BA 3L75E 3AE1C 2QEXP 1RE3A 3G71P 1CZQA 1S4XA 1X0TA 1DH3A 3GTEA 4DT0A 2HFED 1FDOA 1FZBA 1HWTC 4A7PA 3B5NB 4QDCA 1PGOA 4NPFX 3H1KD 4D6TD 2KXPB 4U7JA 3H1HD 3JSVC 4RKUJ 4DCKA 1YHQP 3H1LD 1S9KE 4HM0A 4L74A 1K9MQ 2W8ZA 2SPZA 1IZNB 2XNXA 2KZJA 1PPJG 1NTKE 1RH5B 3E1IA 3L72G 3CCRP 1KILD 1M57D 4EMJB 1ZW0A 1GL2C 1LTJB 1YJ9P 3O6QB 2XR8A 3KPEA 1YI2P 3SWFA 3MUDA 2RN0A 2WSCH 1R8EA 2QJPC 2XSOA 1LTAC 1W2BO 1ZOYC 2ZYAA 1UUWA 1OWAA 1VQ7P 3L73E 2A45I 1LWUC 3B71A 3RL0g 5APTA 2FFDA 1SQBK 2OGUA 3RL0D 2WMMA 5APQA 4OH8B 1SQXJ 4R4LA 3VN0A 4HJLA 3AZCA 4ASVA 3HUSB 4P1BH 3RK2D 1YIJP 2ZXEB 2KSJA 4EIJA 3M9QA 3AE7C 1OIPA 4OGQC 2JO6A 4H13B 2OYIB 2HMJA 3VMXA 3HD7A 1M1KQ 5AVQB 1KV4A 5KLVK 5KKZC 4C7NA 1OZHA 3L74E 2N1TA 3S9OA 2BCCD 2WTYA 2N1TD 3CWBD 5APVA 4HM2A 1GK6A 2H8PD 4L76A 4TLFA 2Y9ZA 1VL2A 2BEZF 3H1JJ 1VF5C 1EZVD 2PAJA 3FXDA 1NYHA 1XTCC 2DE5D 1VQ4P 2ITAA 5TISH 1SQPG 1T2KC 3AE8C 1SQXG 3V4QA 4NBAD 1CI6A 5BU5A 2HMKA 2JR8A 4IFFA 2B87B 3JCUH 1BCCE 2HG5D 1O7NA 1K8AQ 3HE4B 2KNCA 1SFCA 1LT9A 4NPEA 4QDFB 1FZEA 1QEXA 1NTME 3MIWA 4BRYA 3TF5A 1SS1A 5AVUB 1RFSA 2G3AA 3CC4P 2IFNA 5EFWB 2FY8A 4H44C 1G8KB 1BGYJ 4N78D 2YMYA 3HE5B 2OYHA 2VRSA 2DW3A 1W5CE 5APXA 3LW5J 2E4PA 2P2UA 2Q1KA 5AW6B 3QWOC 2RMZA 3H1JG 1M8OB 1JCDA 1KFNA 2FXOA 1Q90D 4N3YB 3WUVA 3H1KJ 1T6AA 2A06G 1RHZB 2V7QH 1OW8A 1URQB 1IFDA 1L0LE 5AW9B 1VQ9P 2YVJB 3H1IE 1AFOA 5TJHA 1SQBD 3PH0A 1M7LA 2WQYC 5TISE 1YBKA 1SQXK 1FZAA 3ZDMA 2YO3A 3T97A 4PD4I 2KB7P 4QUPA 3JCUE 2KI7B 5AVXB 2IX7C 2LXBA 3L37A 5KLVD 2JEEA 1LP1B 2E76D 2JO1A 2NPSA 3V6IA 1SQVE 4NBBD 1RE4A 1EG9A 1JB0J 3B5NC 2NPSD 2H89C 2K9YA 1FDMA 3JC22 3UIAA 1P84I 2Y0CA 3H1KG 4D6TG 3H1HG 1ZRTD 2Q5UA 3E7KA 2W27A 3M91A 1FZFA 3H1LG 1KQLA 2W6JH 1N73B 2FYUE 3AE5C 4PD4H 4AQRD 1RF1C 2WPVB 3CCVP 5AW0B 3TNUB 3SFEC 1LTJC 3AEDC 3SFDC 2R5BA 1SVFA 2QVAA 3C9IA 1NJIQ 1X22A 3CXHI 3GF3A 2KS1A 1QVFO 3GHGA 3L70D 3HTKA 1SQQD 1P84H 3LIDA 4JPZB 1EC5A 4W80A 2E75C 1RQUA 1O7PA 4NBCD 1FJKA 4NBED 1JCCA 1G2CA 4PJ0E 3Q5PA 1E5WA 3HUSC 2KOGA 1EDIA 2V7QJ 4HH2A 4IOIH 2P10A 3FWLA 4WWIA 5CCHD 3OA7A 4H13C 3GOBA 2WSEH 4R4MA 2NRGA 3CXHH 5AEUA 3TK1A 4DZOA 2KZIA 1RF0A 1IFJA 1AV1A 5AW7B 1UIIA 1NH4A 2QE7H 2BCCG 3F89A 3Q5SA 1FZCC 1K04A 3CWBG 2J5UA 1R5SA 2ZT9B 4PD4E 1ZN5A 3FGAD 1S5LX 1M1JB 5AW5B 3I5CA 1VQMP 1X9VA 4QCKA 4HKZH 5KJ7C 1KYOH 4C46A 4WVZA 1NTKD 1EZVG 1D7MA 1VDFA 1N2DC 1JM0A 3CX5I 2D2CB 1U7MA 2PFXA 1KZUB 2E74D 2QSIA 2WWWA 1NVOA 1G1IA 4JYCA 1AQTA 3TGUE 2FYZA 3D89A 1P84E 2FFDB 2YXRB 3GLMA 4RJTA 1JTHA 2Q7CA 3N0QA 3SWYA 1L4AD 3AE6C 3ABVC 1NOHA 4IL6H 3M9BA 3H25A 3N4XA 2XDJA 3AE4C 2IBZI 3V2QA 4AUWA 5CCGC 3PRJA 2E4QA 2E5YA 2J59M 3L72E 3HD7B 2JWDA 2Y9YA 3GZXA 3CXHE 4C7RA 1H0TB 4JBZA 3VYIA 4JF7A 1VM9A 3R4YA 3VMYA 2O01N 3H32B 3BCCG 3CCSP 1U57A 3WUTA 3RK3B 1YQ3C 1HGVA 2GM4A 3RGUA 5APWA 1GL2D 1Y47A 1KYOE 1Q7YQ 1ZMEC 1KB9I 4RESB 2YFJA 1SQBG 1XTGB 3IAOA 2GBWA 2C9NY 1J1EB 1BGYD 2PGDA 1EXJA 5CXMA 1FQTA 2I7FA 2CPBA 2KP8A 1HJBA 3OW2O 4EYYQ 1SFCB 1LT9B 1JUNA 3P32A 4BRYB 4WB4A 3WU2H 3L70J 1O7WA 3L71D 1SQQJ 4YXWH 2R44A 3VOPA 2CPSA 4IL6E 5KLVG 3VCAA 1BE3E 4K35A 1PGJA 2O01H 4OGQD 3AE3C 5BOKA 2OYHB 3D6YA 2P67A 3NXSA 1KILA 3CX5E 1EXIA 1A02J 1PGQA 3AEAC 3L75J 1RF1B 1IFMA 4GT1A 2J58A 2OQQA 1H89A 1N73C 1SQPE 3R2PA 3D71A 3D6ZA 2BMOA 2M3BA 1LNQA 1RIEA 3FOUA 1W2EA 1N7SA 5AEWA 1Q81Q 4H0LC 1GW3A 1VF5D 4QMAA 1KFMA 1N7SD 2WSSH 4Y28J 1GZLA 4WY4A 4W7YA 1HGZA 1ZXGA 2E75B 3CCEP 1G1JA 2NVEA 3BRTB 2XNDH 4WY4D 3H1ID 3Q2YA 1T2KD 1OW7A 3T97B 4EI2A 3EFGA 3L70G 1NTKJ 2IFMA 1SQQG 1NKNA 2Z5IA 2BMRA 1RE3C 2B9BA 1VQKP 1A02F 3WU2E 1H88A 2YKPA 1FBMA 4LLHA 2QM7A 1JOCA 3AE2C 4HM8A 4QUQA 4H44D 1VQPP 1LTBC 2WT7B 1DIPA 2WSFJ 1J2JB 4NB8D 2IPPA 3L73J 3GKEA 4I6MC 2A45H 5B66H 1FZCB 3NFQA 2W83C 2POHA 3IN6A 3VMZA 1IFPA 3CC2P 1GTWA 3RBZA 3P7KA 3MP7B 2WVRA 2ZT9C 3I56P 3V2RA 3O8ZA 1M1JC 1OVUA 1VQ5P 2QRXA 1IJDB 3KYQA 3MUDC 2IDBA 4LC1A 2N9BA 1IK7A 1NTKG 3L74J 2D2CC 4HB1A 2JDIH 1FOSE 1EZVI 3MD0A 3RL0C 1LGHB 2W6AA 5GTHH 3KQGA 1ZR4A 2FFDC 2HMNA 2IBZG 1SQQK 3K5BA 1RY3A 1YJNP 1G2CB 3G9RA 1NTZE 1Q82Q 3L35A 1OX3A 4D6TE 2PP6A 2YXQB 3H1HE 4OWFA 4GKGA 4ZNCA 2Z4EA 1KORA 5CBNA 1BDDA 4KJMA 3B5NA 1O7GA 3H1LE 2WSCJ 1NU1E 1N86A 2R5DA 4HKVA 5KAFH 3HD7C 3B5ND 4PV1B 2ZVNB 2K1AA 5CBOA 3L71J 4EDFA 5B66E 1BCCJ 2HODA 2YO2A 3Q5RA 1L0NE 2B24A 1OVRA 1NTMJ 4LGDE 3BVHA 2NWFA 3RK3C 3LIEA 3O6QA 2GA1A 3F5HA 5BVZA 2JP3A 4OVNF 2AEFA 3C8VA 2DE6D 2ZJSE 5B5EH 1NTKK 3RBXA 1K73Q 5M1BA 4YTPC 2HPCA 3A7OA 5AVTB 1J1EC 1VQ6P 2Y0DA 4PJ0H 2K9JA 2JWAA 5GTHE 1BGYG 3W67A 1WRGA 1YYCA 1JTHB 2OYOA 3M0AA 1PP9E 1QX8A 2MKVA 1L0LJ 1SFCC 1LT9C 3M0DA 1OXZA 1N7LA 2M8RA 3TGUD 3HUSA 4I7ZB 2AEJA 1CW5A 3MHVA 3H1IJ 1BSHA 5AVWB 2FXPA 4BWNA 2HMOA 2Y0EA 3L71G 2BCCE 2WITA 3KZIH 5HL4A 2OYIA 2FYNB 3P8MC 3GCEA 4AYCA 2IZ1A 3CWBE 2I8DA 1HJ0A 2OYHC 3BRVB 5KAFE 4H13D 4HM1A 1HVVA 4UB6E 1FU1A 4HM4A 2JKVA 3B8EB 4P1CH 1EZVE 3KDPB 3RK3E 3G6EP 1HUCA 2B89A 3GZYA 5KLIB 2KLUA 4H0LB 2PRRA 4RO0A 1OVVA 1SQVJ 1GD2E 1QL1A 5KJ7A 3PTZA 4N6JA 4AIVA 2YNYA 2JJLA 4XE5B 5KJ7D 1K05A 4NB9D 2C0XA 3A0BH 3AEEC 2IYPA 5B5EE 2RH0A 4QURA 2XSHA 2Q6QA 1KYOD 2YFLA 2B87A 2OTKE 2FYUJ 3H1IG 2QG4A 1FZGA 5CCHA 1NWQA 4N78E 4QDFA 1VQ8P 3B4SA 3M06A 3VTPC 3L75D 3OJAB 5AVVB 1KC8Q 1JY2N 1JNMA 1FJPA 5KAIH 1DD4A 5AVSB 1EDJA 3NMDA 1GMJA 3BCCE 3CCMP 1RE4C 5AW2B 3KZIE 3V4WA 3HE5A 1NGMB 1IC2A 2W6BA 2FKWB 1ULJA 1AA0A 5CCGD 1NYKA 1KILB 2LXCB 1FC2C 1NTMK 1BE3D 1IFNA 4YXDC 1USEA 4GOFA 1S9KD 1Q86Q 3L4FA 1SQBE 3Q1MA 2N9YB 1URQA 4U3FE 4ZMDA 3IF4A 3Q3DA 3PJSK 1N7SB 2C9LY 3PP5A 3VCPA 1URQD 2M5AA 2NZ2A 1LTGC 3WUUA 2ZFCA 3RL0B 4HM6A 3BATA 2XV5A 4WY4B 1O7MA 3A0BE 1L4AA 1JY3N 2UWJE 1AJYA 5KLVE 1L0LK 3RK2B 3L73D 3CC7P 1VCKA 2YIUB 3L36A 1ZP0C 2QIWA 1LP1A 1QGKB 1PPJE 3CCLP 3GW6A 4L75A 5DJUB 5KAIE 2FXMA 5CJ4A 1YTZT 2L91A 2KYVA 3CX5H 1HF9A 4YPCA 4C7NB 2N1TB 1HBWA 2QJYB 3TGUJ 4PV1C 4Y99B 1JMMA 1RF0C 2QA4P 1IO4A 2ZYLA 3GTSA 2OTJP 1BSNA 3QH9A 1HTLC 3L74D 2WPSA 1GL2A 2I1KA 1SQVK 1SP4A 1OFCX 4Z1MH 2OARA 3EFFK 2K3RA 1JO5A 1VQNP 2GBXA 2KIKA 4GIFA 3VP8A 2DE7D 3W68A 3L72J 4L73A 1VQOP 1VQLP 2WSEJ 1EDLA 1LWUA 1CI6B 2FYUK 2YKOA 2ZAEB 4M3LA 4MN4C 5CMZA 3VMAA 2KNCB 4QDDA 1IK9A 2WPQA 2NVFA 2R3SA 2AXTH 2O3JA 1AVYA 1BCCD 3AEGC 4I7ZC 1RQVA 2W90A 3HRNA 1FDIA 1NTMD 4CPGA 3TGUG 1M56D 4IL6X 1MZ9A 4HYTB 3KHUA 1J1DB 2K88A 1KB9H 5BU8B 2RKLA 3SWKA 2FYNC 1LTIC 5K5GB 5CHXA 1NTZD 2AEMA 1FE6A 1EDKA 1QVGO 2HODB 1NU1D 1M90Q 2V4HA 1SQXE
chains in the Genus database with same CATH topology
2YFJA 4QCKA 2Q3WA 3GL0A 2ZYLA 3GTSA 2GBWA 1NTZE 5KKZC 1ULJA 2HMOA 3L74E 2QPZA 4QDCA 5KLIC 1BGYE 2BCCE 4NBFD 5HL4A 4D6TE 1NYKA 3GCEA 5CXMA 1FQTA 2NVGA 3CWBE 3H1HE 2I7FA 2E74D 2XRXA 1ZRTE 2ZT9D 2BMRA 2E75D 4H13D 1L0LE 4HM2A 4HM1A 1O7GA 3H1LE 2IBZE 1NU1E 2YVJB 3TGUE 1O7HA 4HM0A 4HM4A 4HKVA 3H1IE 3D89A 1P84E 2GBXA 3EQQA 1SQBE 2BMQA 4P1CH 3GB4A 2DE7D 1EZVE 1NTKE 3L71E 3N0QA 4HM8A 1O7WA 4QUQA 4H44D 4U3FE 3H1KE 3GZYA 2DE5D 4EMJB 2D2CD 1ULIA 4AAYB 4NB8D 2YIUC 3VCAA 2HMLA 1BE3E 3GKEA 2XR8A 4NBHD 3VCPA 1L0NE 1NDOA 1O7PA 2B24A 4NBCD 4OGQD 2YFIA 4NBED 3VMHD 5BOKA 4HM7A 4HM6A 2NWFA 2CKFA 4QDDA 1O7MA 3VMGD 4AIVA 3DQYA 1G8JB 4QUPA 3CX5E 4PV1D 4NBAD 2QJPC 2NVFA 2XSOA 3H1JE 3L70E 1Q90C 2E4QA 2HMKA 4NB9D 3L72E 1SQQE 3GZXA 1WQLA 5KLVE 3CXHE 1UUWA 4HM3A 1BCCE 1O7NA 2HMMA 2A06E 4QURA 2XSHA 2E76D 3L73E 1JM1A 3GOBA 1SJGA 4H0LD 2DE6D 2QJYC 4QDFB 1KB9E 1VCKA 1VM9A 1SQVE 1NTME 1SQPE 4NBBD 2YFLA 5AEUA 4NBGD 1EG9A 2BMOA 1RFSA 3EN1A 1RIEA 3FOUA 4NBDD 4HJLA 1UUVA 1G8KB 1PPJE 2B1XA 2FYNC 3C0DA 4QDFA 5AEWA 3VMID 3AZCA 4P1BH 3L75E 1VF5D 2NUMA 2JO6A 2JZAA 1PP9E 2QJKC 4HM5A 4PD4E 1KYOE 2HMJA 3GTEA 2NUKA 3GL2A 2HMNA 2E4PA 2NVEA 3BCCE 2FYUE 1SQXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFJ A;  4QCK A;  2Q3W A;  3GL0 A;  2ZYL A;  3GTS A;  2GBW A;  1NTZ E;  5KKZ C;  1ULJ A;  2HMO A;  3L74 E;  2QPZ A;  4QDC A;  5KLI C;  1BGY E;  2BCC E;  4NBF D;  5HL4 A;  4D6T E;  1NYK A;  3GCE A;  5CXM A;  1FQT A;  2NVG A;  3CWB E;  3H1H E;  2I7F A;  2E74 D;  2XRX A;  1ZRT E;  2ZT9 D;  2BMR A;  2E75 D;  4H13 D;  1L0L E;  4HM2 A;  4HM1 A;  1O7G A;  3H1L E;  2IBZ E;  1NU1 E;  2YVJ B;  3TGU E;  1O7H A;  4HM0 A;  4HM4 A;  4HKV A;  3H1I E;  3D89 A;  1P84 E;  2GBX A;  3EQQ A;  1SQB E;  2BMQ A;  4P1C H;  3GB4 A;  2DE7 D;  1EZV E;  1NTK E;  3L71 E;  3N0Q A;  4HM8 A;  1O7W A;  4QUQ A;  4H44 D;  4U3F E;  3H1K E;  3GZY A;  2DE5 D;  4EMJ B;  2D2C D;  1ULI A;  4AAY B;  4NB8 D;  2YIU C;  3VCA A;  2HML A;  1BE3 E;  3GKE A;  2XR8 A;  4NBH D;  3VCP A;  1L0N E;  1NDO A;  1O7P A;  2B24 A;  4NBC D;  4OGQ D;  2YFI A;  4NBE D;  3VMH D;  5BOK A;  4HM7 A;  4HM6 A;  2NWF A;  2CKF A;  4QDD A;  1O7M A;  3VMG D;  4AIV A;  3DQY A;  1G8J B;  4QUP A;  3CX5 E;  4PV1 D;  4NBA D;  2QJP C;  2NVF A;  2XSO A;  3H1J E;  3L70 E;  1Q90 C;  2E4Q A;  2HMK A;  4NB9 D;  3L72 E;  1SQQ E;  3GZX A;  1WQL A;  5KLV E;  3CXH E;  1UUW A;  4HM3 A;  1BCC E;  1O7N A;  2HMM A;  2A06 E;  4QUR A;  2XSH A;  2E76 D;  3L73 E;  1JM1 A;  3GOB A;  1SJG A;  4H0L D;  2DE6 D;  2QJY C;  4QDF B;  1KB9 E;  1VCK A;  1VM9 A;  1SQV E;  1NTM E;  1SQP E;  4NBB D;  2YFL A;  5AEU A;  4NBG D;  1EG9 A;  2BMO A;  1RFS A;  3EN1 A;  1RIE A;  3FOU A;  4NBD D;  4HJL A;  1UUV A;  1G8K B;  1PPJ E;  2B1X A;  2FYN C;  3C0D A;  4QDF A;  5AEW A;  3VMI D;  3AZC A;  4P1B H;  3L75 E;  1VF5 D;  2NUM A;  2JO6 A;  2JZA A;  1PP9 E;  2QJK C;  4HM5 A;  4PD4 E;  1KYO E;  2HMJ A;  3GTE A;  2NUK A;  3GL2 A;  2HMN A;  2E4P A;  2NVE A;  3BCC E;  2FYU E;  1SQX E; 
#chains in the Genus database with same CATH topology
 2BEQ D;  1WMK A;  3II6 A;  3GL0 A;  5AVZ B;  5KLI C;  1OW6 A;  2KSE A;  2Q9I A;  1M1J A;  2H7H A;  4JQ0 D;  2P58 A;  3V5B A;  2XU6 A;  2XRX A;  1BE3 J;  2XKM A;  2ZT9 D;  1L0N D;  2ZYD A;  1L0L D;  2IBZ E;  1O7H A;  3A0H H;  2FBW C;  3MGN A;  3LW5 H;  3GB4 A;  3CCU P;  3WMM 0;  1KN7 A;  2HPC B;  4W7Z A;  2D2C D;  4ZKU A;  2E76 B;  2HML A;  3N7N A;  2K9J B;  4NBH D;  3IFM A;  1OMI A;  1NDO A;  1LTT C;  1SQP J;  3VMH D;  1NAY A;  2AXT E;  2M3E A;  1FAV A;  1ZR2 A;  2NPS B;  1BDC A;  5KTB A;  3H1J E;  5AW3 B;  2BAS A;  4DJG A;  2A06 E;  3L75 G;  2YKQ A;  3G3Z A;  1NKZ B;  1JM1 A;  1PP9 D;  1KB9 E;  1CSB A;  1SQV D;  2HLO A;  3SSU A;  1H0T A;  1UUV A;  1KIL C;  3HD7 D;  4K3A A;  1H8A A;  1GK4 A;  2NUM A;  3H32 A;  2JZA A;  1BE3 G;  3PLN A;  2AXC A;  5H2F H;  3E1R A;  4EOT A;  1YJW P;  3GL2 A;  5AW1 B;  4GDO A;  2B88 A;  2FYU D;  5E79 H;  1ZV8 A;  3P8C E;  3RK3 D;  1N7S C;  1BGY E;  4NBF D;  1S2E A;  2IZ0 A;  2C0W A;  2G8Y A;  2O01 J;  2KS1 B;  3GHG B;  5APS A;  3A0H E;  1AVO A;  1IFI A;  3HTK B;  1Z56 A;  1GDT A;  4WY4 C;  4XA4 A;  1VPC A;  1X8Y A;  5CJ0 A;  1S3J A;  2QJK B;  1DEE G;  3EWK A;  4UB8 H;  3EQQ A;  1HH0 A;  3L71 E;  3M9H A;  3KXD A;  3RK2 C;  1U7J A;  3H1K E;  1ULI A;  4AAY B;  2YIU C;  3L73 G;  3V2P A;  2K37 A;  1PV3 A;  1SFC D;  3DQY A;  1JY2 P;  4UB6 H;  1KIL E;  4DOJ A;  1WQL A;  2N1T C;  1USD A;  4WBA A;  2QJY C;  3AEF C;  4Y99 C;  5DJT B;  3CI9 A;  1KMI Z;  3A2A A;  3BCC D;  1L2P A;  3CCQ P;  4NBD D;  2O1K A;  1RF1 A;  4GOD A;  2B1X A;  3BAS A;  1LTJ A;  1NTZ J;  3L74 G;  4D6T J;  1JEK A;  3FX0 A;  5H2F E;  1GW4 A;  3CL3 D;  3H1H J;  1MFT A;  1KTM A;  2E74 B;  1MFZ A;  5E79 E;  4PD4 D;  3H1L J;  1NU1 J;  2R3C A;  2M5A B;  2P1J A;  2Q3W A;  4U3F D;  3AE9 C;  1L4A B;  1SQP K;  2P7J A;  3U59 A;  1NAF A;  3ITK A;  1L0N J;  2E75 D;  4UB8 E;  1JY3 P;  4I1L A;  1NHL A;  2CK3 H;  3FXE A;  2ZYG A;  3V2N A;  1FOS F;  3AEC C;  2BMQ A;  3TDK A;  1P84 D;  1YTZ I;  2E5T A;  3I55 P;  4XFJ A;  2KK7 A;  2ZXX A;  1BCC G;  1PGP A;  1MKM A;  5AVY B;  4KHX A;  3H6P A;  1J1D C;  2LKM A;  1NTM G;  2CKF A;  2WT7 A;  1T3J A;  3VMG D;  3NTN A;  1FS0 E;  1PZQ A;  1Q2N A;  2Q3E A;  3U1A A;  1Q90 C;  1PPJ D;  1QLE D;  1NTZ G;  1KQF B;  3USS A;  3L72 D;  1FZC A;  3PHL A;  4HM3 A;  2HMM A;  3CXH D;  1GU5 A;  3AEB C;  1SJG A;  1S5L H;  1PP9 J;  1LT1 A;  3VP9 A;  1GL2 B;  2QM8 A;  1NU1 G;  1ZLL A;  2R32 A;  3EN1 A;  4I2L C;  3D70 A;  2KLV A;  2I1J A;  3CME P;  2A45 G;  2BCC J;  2QJP B;  3S1K A;  1KQS O;  1DX7 A;  3CWB J;  1L0N G;  1L0L G;  2NUK A;  5AW8 B;  1LWU B;  3MTU E;  1E79 H;  3HE4 A;  2QPZ A;  1SLQ A;  1TU3 F;  2E76 C;  1PFI A;  5AVR B;  2NVG A;  3FWN A;  4GOE A;  1KQG B;  4OGQ B;  2NPS C;  3M0D C;  1DEB A;  1KYO I;  5CCG A;  4HJG H;  3C1L A;  5APY A;  1UIX A;  1MUU A;  3OAK A;  5APU A;  5KKZ B;  2OYI C;  2HYN A;  1YIT P;  3GF7 A;  1MV8 A;  1PP9 G;  1SQV G;  4HM7 A;  1X79 B;  1NTZ K;  4PV1 D;  3CX5 D;  3IR9 A;  3MZW B;  1R5L A;  2GUV A;  1S5L E;  2H88 C;  3TYY A;  1GU4 A;  1N8R Q;  2OTL P;  1VF5 B;  1NU1 K;  5GTI H;  1WT6 A;  2XZR A;  2L5G B;  3A5T A;  4NBG D;  1SQP D;  1QL2 A;  3BCC J;  1SQX D;  4JYB A;  2ZVO B;  2LR2 A;  2FYU G;  2YMK A;  2WZ7 A;  5C39 A;  1JY2 O;  3VMI D;  4TT3 H;  1L0N K;  2KUB A;  3GHG C;  1EQ7 A;  2Q3I A;  1YQ4 C;  5AW4 B;  2H43 A;  2QJK C;  4HM5 A;  4NPD A;  3EQ2 A;  2IBZ D;  1Y9B A;  1JMB A;  2GUS A;  1SQB J;  3CMA P;  1NO4 A;  1PIX A;  1S1C X;  1LTS C;  4ZKP A;  5CCH C;  4U3F J;  4H44 B;  2E42 A;  2MJZ A;  3CCJ P;  3TSI A;  2IYO A;  1LJ2 A;  1ZRT E;  3A3Y B;  4IFD K;  3CLQ A;  3CD6 P;  4B86 A;  3H1J D;  2O1J A;  4ASW A;  1T3U A;  2HR3 A;  5KLV J;  3S4R A;  2A06 D;  1KD1 Q;  1N73 A;  1AQ5 A;  4BXL A;  2WPR A;  1KB9 D;  1JY3 O;  2YFI A;  3TNU A;  5L8R J;  1G8J B;  3GG2 A;  3L70 E;  1T8Z A;  2Z5H A;  1SQQ E;  3U1C A;  1URQ C;  5GTI E;  2E74 C;  1S72 P;  1DD3 A;  4H0L D;  1PL5 A;  1Y8A A;  2E43 A;  2WSF H;  3GMA A;  4O9B A;  3C0D A;  1L4A C;  3P8C D;  3G4S P;  3CPW O;  4U3F G;  4KT0 J;  4IFM A;  2M0B A;  3L75 E;  3AE1 C;  2QEX P;  1RE3 A;  3G71 P;  1CZQ A;  1S4X A;  1X0T A;  1DH3 A;  3GTE A;  4DT0 A;  2HFE D;  1FDO A;  1FZB A;  1HWT C;  4A7P A;  3B5N B;  4QDC A;  1PGO A;  4NPF X;  3H1K D;  4D6T D;  2KXP B;  4U7J A;  3H1H D;  3JSV C;  4RKU J;  4DCK A;  1YHQ P;  3H1L D;  1S9K E;  4HM0 A;  4L74 A;  1K9M Q;  2W8Z A;  2SPZ A;  1IZN B;  2XNX A;  2KZJ A;  1PPJ G;  1NTK E;  1RH5 B;  3E1I A;  3L72 G;  3CCR P;  1KIL D;  1M57 D;  4EMJ B;  1ZW0 A;  1GL2 C;  1LTJ B;  1YJ9 P;  3O6Q B;  2XR8 A;  3KPE A;  1YI2 P;  3SWF A;  3MUD A;  2RN0 A;  2WSC H;  1R8E A;  2QJP C;  2XSO A;  1LTA C;  1W2B O;  1ZOY C;  2ZYA A;  1UUW A;  1OWA A;  1VQ7 P;  3L73 E;  2A45 I;  1LWU C;  3B71 A;  3RL0 g;  5APT A;  2FFD A;  1SQB K;  2OGU A;  3RL0 D;  2WMM A;  5APQ A;  4OH8 B;  1SQX J;  4R4L A;  3VN0 A;  4HJL A;  3AZC A;  4ASV A;  3HUS B;  4P1B H;  3RK2 D;  1YIJ P;  2ZXE B;  2KSJ A;  4EIJ A;  3M9Q A;  3AE7 C;  1OIP A;  4OGQ C;  2JO6 A;  4H13 B;  2OYI B;  2HMJ A;  3VMX A;  3HD7 A;  1M1K Q;  5AVQ B;  1KV4 A;  5KLV K;  5KKZ C;  4C7N A;  1OZH A;  3L74 E;  2N1T A;  3S9O A;  2BCC D;  2WTY A;  2N1T D;  3CWB D;  5APV A;  4HM2 A;  1GK6 A;  2H8P D;  4L76 A;  4TLF A;  2Y9Z A;  1VL2 A;  2BEZ F;  3H1J J;  1VF5 C;  1EZV D;  2PAJ A;  3FXD A;  1NYH A;  1XTC C;  2DE5 D;  1VQ4 P;  2ITA A;  5TIS H;  1SQP G;  1T2K C;  3AE8 C;  1SQX G;  3V4Q A;  4NBA D;  1CI6 A;  5BU5 A;  2HMK A;  2JR8 A;  4IFF A;  2B87 B;  3JCU H;  1BCC E;  2HG5 D;  1O7N A;  1K8A Q;  3HE4 B;  2KNC A;  1SFC A;  1LT9 A;  4NPE A;  4QDF B;  1FZE A;  1QEX A;  1NTM E;  3MIW A;  4BRY A;  3TF5 A;  1SS1 A;  5AVU B;  1RFS A;  2G3A A;  3CC4 P;  2IFN A;  5EFW B;  2FY8 A;  4H44 C;  1G8K B;  1BGY J;  4N78 D;  2YMY A;  3HE5 B;  2OYH A;  2VRS A;  2DW3 A;  1W5C E;  5APX A;  3LW5 J;  2E4P A;  2P2U A;  2Q1K A;  5AW6 B;  3QWO C;  2RMZ A;  3H1J G;  1M8O B;  1JCD A;  1KFN A;  2FXO A;  1Q90 D;  4N3Y B;  3WUV A;  3H1K J;  1T6A A;  2A06 G;  1RHZ B;  2V7Q H;  1OW8 A;  1URQ B;  1IFD A;  1L0L E;  5AW9 B;  1VQ9 P;  2YVJ B;  3H1I E;  1AFO A;  5TJH A;  1SQB D;  3PH0 A;  1M7L A;  2WQY C;  5TIS E;  1YBK A;  1SQX K;  1FZA A;  3ZDM A;  2YO3 A;  3T97 A;  4PD4 I;  2KB7 P;  4QUP A;  3JCU E;  2KI7 B;  5AVX B;  2IX7 C;  2LXB A;  3L37 A;  5KLV D;  2JEE A;  1LP1 B;  2E76 D;  2JO1 A;  2NPS A;  3V6I A;  1SQV E;  4NBB D;  1RE4 A;  1EG9 A;  1JB0 J;  3B5N C;  2NPS D;  2H89 C;  2K9Y A;  1FDM A;  3JC2 2;  3UIA A;  1P84 I;  2Y0C A;  3H1K G;  4D6T G;  3H1H G;  1ZRT D;  2Q5U A;  3E7K A;  2W27 A;  3M91 A;  1FZF A;  3H1L G;  1KQL A;  2W6J H;  1N73 B;  2FYU E;  3AE5 C;  4PD4 H;  4AQR D;  1RF1 C;  2WPV B;  3CCV P;  5AW0 B;  3TNU B;  3SFE C;  1LTJ C;  3AED C;  3SFD C;  2R5B A;  1SVF A;  2QVA A;  3C9I A;  1NJI Q;  1X22 A;  3CXH I;  3GF3 A;  2KS1 A;  1QVF O;  3GHG A;  3L70 D;  3HTK A;  1SQQ D;  1P84 H;  3LID A;  4JPZ B;  1EC5 A;  4W80 A;  2E75 C;  1RQU A;  1O7P A;  4NBC D;  1FJK A;  4NBE D;  1JCC A;  1G2C A;  4PJ0 E;  3Q5P A;  1E5W A;  3HUS C;  2KOG A;  1EDI A;  2V7Q J;  4HH2 A;  4IOI H;  2P10 A;  3FWL A;  4WWI A;  5CCH D;  3OA7 A;  4H13 C;  3GOB A;  2WSE H;  4R4M A;  2NRG A;  3CXH H;  5AEU A;  3TK1 A;  4DZO A;  2KZI A;  1RF0 A;  1IFJ A;  1AV1 A;  5AW7 B;  1UII A;  1NH4 A;  2QE7 H;  2BCC G;  3F89 A;  3Q5S A;  1FZC C;  1K04 A;  3CWB G;  2J5U A;  1R5S A;  2ZT9 B;  4PD4 E;  1ZN5 A;  3FGA D;  1S5L X;  1M1J B;  5AW5 B;  3I5C A;  1VQM P;  1X9V A;  4QCK A;  4HKZ H;  5KJ7 C;  1KYO H;  4C46 A;  4WVZ A;  1NTK D;  1EZV G;  1D7M A;  1VDF A;  1N2D C;  1JM0 A;  3CX5 I;  2D2C B;  1U7M A;  2PFX A;  1KZU B;  2E74 D;  2QSI A;  2WWW A;  1NVO A;  1G1I A;  4JYC A;  1AQT A;  3TGU E;  2FYZ A;  3D89 A;  1P84 E;  2FFD B;  2YXR B;  3GLM A;  4RJT A;  1JTH A;  2Q7C A;  3N0Q A;  3SWY A;  1L4A D;  3AE6 C;  3ABV C;  1NOH A;  4IL6 H;  3M9B A;  3H25 A;  3N4X A;  2XDJ A;  3AE4 C;  2IBZ I;  3V2Q A;  4AUW A;  5CCG C;  3PRJ A;  2E4Q A;  2E5Y A;  2J59 M;  3L72 E;  3HD7 B;  2JWD A;  2Y9Y A;  3GZX A;  3CXH E;  4C7R A;  1H0T B;  4JBZ A;  3VYI A;  4JF7 A;  1VM9 A;  3R4Y A;  3VMY A;  2O01 N;  3H32 B;  3BCC G;  3CCS P;  1U57 A;  3WUT A;  3RK3 B;  1YQ3 C;  1HGV A;  2GM4 A;  3RGU A;  5APW A;  1GL2 D;  1Y47 A;  1KYO E;  1Q7Y Q;  1ZME C;  1KB9 I;  4RES B;  2YFJ A;  1SQB G;  1XTG B;  3IAO A;  2GBW A;  2C9N Y;  1J1E B;  1BGY D;  2PGD A;  1EXJ A;  5CXM A;  1FQT A;  2I7F A;  2CPB A;  2KP8 A;  1HJB A;  3OW2 O;  4EYY Q;  1SFC B;  1LT9 B;  1JUN A;  3P32 A;  4BRY B;  4WB4 A;  3WU2 H;  3L70 J;  1O7W A;  3L71 D;  1SQQ J;  4YXW H;  2R44 A;  3VOP A;  2CPS A;  4IL6 E;  5KLV G;  3VCA A;  1BE3 E;  4K35 A;  1PGJ A;  2O01 H;  4OGQ D;  3AE3 C;  5BOK A;  2OYH B;  3D6Y A;  2P67 A;  3NXS A;  1KIL A;  3CX5 E;  1EXI A;  1A02 J;  1PGQ A;  3AEA C;  3L75 J;  1RF1 B;  1IFM A;  4GT1 A;  2J58 A;  2OQQ A;  1H89 A;  1N73 C;  1SQP E;  3R2P A;  3D71 A;  3D6Z A;  2BMO A;  2M3B A;  1LNQ A;  1RIE A;  3FOU A;  1W2E A;  1N7S A;  5AEW A;  1Q81 Q;  4H0L C;  1GW3 A;  1VF5 D;  4QMA A;  1KFM A;  1N7S D;  2WSS H;  4Y28 J;  1GZL A;  4WY4 A;  4W7Y A;  1HGZ A;  1ZXG A;  2E75 B;  3CCE P;  1G1J A;  2NVE A;  3BRT B;  2XND H;  4WY4 D;  3H1I D;  3Q2Y A;  1T2K D;  1OW7 A;  3T97 B;  4EI2 A;  3EFG A;  3L70 G;  1NTK J;  2IFM A;  1SQQ G;  1NKN A;  2Z5I A;  2BMR A;  1RE3 C;  2B9B A;  1VQK P;  1A02 F;  3WU2 E;  1H88 A;  2YKP A;  1FBM A;  4LLH A;  2QM7 A;  1JOC A;  3AE2 C;  4HM8 A;  4QUQ A;  4H44 D;  1VQP P;  1LTB C;  2WT7 B;  1DIP A;  2WSF J;  1J2J B;  4NB8 D;  2IPP A;  3L73 J;  3GKE A;  4I6M C;  2A45 H;  5B66 H;  1FZC B;  3NFQ A;  2W83 C;  2POH A;  3IN6 A;  3VMZ A;  1IFP A;  3CC2 P;  1GTW A;  3RBZ A;  3P7K A;  3MP7 B;  2WVR A;  2ZT9 C;  3I56 P;  3V2R A;  3O8Z A;  1M1J C;  1OVU A;  1VQ5 P;  2QRX A;  1IJD B;  3KYQ A;  3MUD C;  2IDB A;  4LC1 A;  2N9B A;  1IK7 A;  1NTK G;  3L74 J;  2D2C C;  4HB1 A;  2JDI H;  1FOS E;  1EZV I;  3MD0 A;  3RL0 C;  1LGH B;  2W6A A;  5GTH H;  3KQG A;  1ZR4 A;  2FFD C;  2HMN A;  2IBZ G;  1SQQ K;  3K5B A;  1RY3 A;  1YJN P;  1G2C B;  3G9R A;  1NTZ E;  1Q82 Q;  3L35 A;  1OX3 A;  4D6T E;  2PP6 A;  2YXQ B;  3H1H E;  4OWF A;  4GKG A;  4ZNC A;  2Z4E A;  1KOR A;  5CBN A;  1BDD A;  4KJM A;  3B5N A;  1O7G A;  3H1L E;  2WSC J;  1NU1 E;  1N86 A;  2R5D A;  4HKV A;  5KAF H;  3HD7 C;  3B5N D;  4PV1 B;  2ZVN B;  2K1A A;  5CBO A;  3L71 J;  4EDF A;  5B66 E;  1BCC J;  2HOD A;  2YO2 A;  3Q5R A;  1L0N E;  2B24 A;  1OVR A;  1NTM J;  4LGD E;  3BVH A;  2NWF A;  3RK3 C;  3LIE A;  3O6Q A;  2GA1 A;  3F5H A;  5BVZ A;  2JP3 A;  4OVN F;  2AEF A;  3C8V A;  2DE6 D;  2ZJS E;  5B5E H;  1NTK K;  3RBX A;  1K73 Q;  5M1B A;  4YTP C;  2HPC A;  3A7O A;  5AVT B;  1J1E C;  1VQ6 P;  2Y0D A;  4PJ0 H;  2K9J A;  2JWA A;  5GTH E;  1BGY G;  3W67 A;  1WRG A;  1YYC A;  1JTH B;  2OYO A;  3M0A A;  1PP9 E;  1QX8 A;  2MKV A;  1L0L J;  1SFC C;  1LT9 C;  3M0D A;  1OXZ A;  1N7L A;  2M8R A;  3TGU D;  3HUS A;  4I7Z B;  2AEJ A;  1CW5 A;  3MHV A;  3H1I J;  1BSH A;  5AVW B;  2FXP A;  4BWN A;  2HMO A;  2Y0E A;  3L71 G;  2BCC E;  2WIT A;  3KZI H;  5HL4 A;  2OYI A;  2FYN B;  3P8M C;  3GCE A;  4AYC A;  2IZ1 A;  3CWB E;  2I8D A;  1HJ0 A;  2OYH C;  3BRV B;  5KAF E;  4H13 D;  4HM1 A;  1HVV A;  4UB6 E;  1FU1 A;  4HM4 A;  2JKV A;  3B8E B;  4P1C H;  1EZV E;  3KDP B;  3RK3 E;  3G6E P;  1HUC A;  2B89 A;  3GZY A;  5KLI B;  2KLU A;  4H0L B;  2PRR A;  4RO0 A;  1OVV A;  1SQV J;  1GD2 E;  1QL1 A;  5KJ7 A;  3PTZ A;  4N6J A;  4AIV A;  2YNY A;  2JJL A;  4XE5 B;  5KJ7 D;  1K05 A;  4NB9 D;  2C0X A;  3A0B H;  3AEE C;  2IYP A;  5B5E E;  2RH0 A;  4QUR A;  2XSH A;  2Q6Q A;  1KYO D;  2YFL A;  2B87 A;  2OTK E;  2FYU J;  3H1I G;  2QG4 A;  1FZG A;  5CCH A;  1NWQ A;  4N78 E;  4QDF A;  1VQ8 P;  3B4S A;  3M06 A;  3VTP C;  3L75 D;  3OJA B;  5AVV B;  1KC8 Q;  1JY2 N;  1JNM A;  1FJP A;  5KAI H;  1DD4 A;  5AVS B;  1EDJ A;  3NMD A;  1GMJ A;  3BCC E;  3CCM P;  1RE4 C;  5AW2 B;  3KZI E;  3V4W A;  3HE5 A;  1NGM B;  1IC2 A;  2W6B A;  2FKW B;  1ULJ A;  1AA0 A;  5CCG D;  1NYK A;  1KIL B;  2LXC B;  1FC2 C;  1NTM K;  1BE3 D;  1IFN A;  4YXD C;  1USE A;  4GOF A;  1S9K D;  1Q86 Q;  3L4F A;  1SQB E;  3Q1M A;  2N9Y B;  1URQ A;  4U3F E;  4ZMD A;  3IF4 A;  3Q3D A;  3PJS K;  1N7S B;  2C9L Y;  3PP5 A;  3VCP A;  1URQ D;  2M5A A;  2NZ2 A;  1LTG C;  3WUU A;  2ZFC A;  3RL0 B;  4HM6 A;  3BAT A;  2XV5 A;  4WY4 B;  1O7M A;  3A0B E;  1L4A A;  1JY3 N;  2UWJ E;  1AJY A;  5KLV E;  1L0L K;  3RK2 B;  3L73 D;  3CC7 P;  1VCK A;  2YIU B;  3L36 A;  1ZP0 C;  2QIW A;  1LP1 A;  1QGK B;  1PPJ E;  3CCL P;  3GW6 A;  4L75 A;  5DJU B;  5KAI E;  2FXM A;  5CJ4 A;  1YTZ T;  2L91 A;  2KYV A;  3CX5 H;  1HF9 A;  4YPC A;  4C7N B;  2N1T B;  1HBW A;  2QJY B;  3TGU J;  4PV1 C;  4Y99 B;  1JMM A;  1RF0 C;  2QA4 P;  1IO4 A;  2ZYL A;  3GTS A;  2OTJ P;  1BSN A;  3QH9 A;  1HTL C;  3L74 D;  2WPS A;  1GL2 A;  2I1K A;  1SQV K;  1SP4 A;  1OFC X;  4Z1M H;  2OAR A;  3EFF K;  2K3R A;  1JO5 A;  1VQN P;  2GBX A;  2KIK A;  4GIF A;  3VP8 A;  2DE7 D;  3W68 A;  3L72 J;  4L73 A;  1VQO P;  1VQL P;  2WSE J;  1EDL A;  1LWU A;  1CI6 B;  2FYU K;  2YKO A;  2ZAE B;  4M3L A;  4MN4 C;  5CMZ A;  3VMA A;  2KNC B;  4QDD A;  1IK9 A;  2WPQ A;  2NVF A;  2R3S A;  2AXT H;  2O3J A;  1AVY A;  1BCC D;  3AEG C;  4I7Z C;  1RQV A;  2W90 A;  3HRN A;  1FDI A;  1NTM D;  4CPG A;  3TGU G;  1M56 D;  4IL6 X;  1MZ9 A;  4HYT B;  3KHU A;  1J1D B;  2K88 A;  1KB9 H;  5BU8 B;  2RKL A;  3SWK A;  2FYN C;  1LTI C;  5K5G B;  5CHX A;  1NTZ D;  2AEM A;  1FE6 A;  1EDK A;  1QVG O;  2HOD B;  1NU1 D;  1M90 Q;  2V4H A;  1SQX E; 
#chains in the Genus database with same CATH homology
 2YFJ A;  4QCK A;  2Q3W A;  3GL0 A;  2ZYL A;  3GTS A;  2GBW A;  1NTZ E;  5KKZ C;  1ULJ A;  2HMO A;  3L74 E;  2QPZ A;  4QDC A;  5KLI C;  1BGY E;  2BCC E;  4NBF D;  5HL4 A;  4D6T E;  1NYK A;  3GCE A;  5CXM A;  1FQT A;  2NVG A;  3CWB E;  3H1H E;  2I7F A;  2E74 D;  2XRX A;  1ZRT E;  2ZT9 D;  2BMR A;  2E75 D;  4H13 D;  1L0L E;  4HM2 A;  4HM1 A;  1O7G A;  3H1L E;  2IBZ E;  1NU1 E;  2YVJ B;  3TGU E;  1O7H A;  4HM0 A;  4HM4 A;  4HKV A;  3H1I E;  3D89 A;  1P84 E;  2GBX A;  3EQQ A;  1SQB E;  2BMQ A;  4P1C H;  3GB4 A;  2DE7 D;  1EZV E;  1NTK E;  3L71 E;  3N0Q A;  4HM8 A;  1O7W A;  4QUQ A;  4H44 D;  4U3F E;  3H1K E;  3GZY A;  2DE5 D;  4EMJ B;  2D2C D;  1ULI A;  4AAY B;  4NB8 D;  2YIU C;  3VCA A;  2HML A;  1BE3 E;  3GKE A;  2XR8 A;  4NBH D;  3VCP A;  1L0N E;  1NDO A;  1O7P A;  2B24 A;  4NBC D;  4OGQ D;  2YFI A;  4NBE D;  3VMH D;  5BOK A;  4HM7 A;  4HM6 A;  2NWF A;  2CKF A;  4QDD A;  1O7M A;  3VMG D;  4AIV A;  3DQY A;  1G8J B;  4QUP A;  3CX5 E;  4PV1 D;  4NBA D;  2QJP C;  2NVF A;  2XSO A;  3H1J E;  3L70 E;  1Q90 C;  2E4Q A;  2HMK A;  4NB9 D;  3L72 E;  1SQQ E;  3GZX A;  1WQL A;  5KLV E;  3CXH E;  1UUW A;  4HM3 A;  1BCC E;  1O7N A;  2HMM A;  2A06 E;  4QUR A;  2XSH A;  2E76 D;  3L73 E;  1JM1 A;  3GOB A;  1SJG A;  4H0L D;  2DE6 D;  2QJY C;  4QDF B;  1KB9 E;  1VCK A;  1VM9 A;  1SQV E;  1NTM E;  1SQP E;  4NBB D;  2YFL A;  5AEU A;  4NBG D;  1EG9 A;  2BMO A;  1RFS A;  3EN1 A;  1RIE A;  3FOU A;  4NBD D;  4HJL A;  1UUV A;  1G8K B;  1PPJ E;  2B1X A;  2FYN C;  3C0D A;  4QDF A;  5AEW A;  3VMI D;  3AZC A;  4P1B H;  3L75 E;  1VF5 D;  2NUM A;  2JO6 A;  2JZA A;  1PP9 E;  2QJK C;  4HM5 A;  4PD4 E;  1KYO E;  2HMJ A;  3GTE A;  2NUK A;  3GL2 A;  2HMN A;  2E4P A;  2NVE A;  3BCC E;  2FYU E;  1SQX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...