1KYOE

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 46
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1kyoE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1kyoE02
1RIEA 1NTKE 1G8JB 2IBZE 4HM1A 2NVFA 3N0QA 2NVEA 4QDFA 1SQXE 3EQQA 1FQTA 2NWFA 3GTEA 3H1HE 4HM2A 1SQQE 4NBBD 1EG9A 2E74D 2B24A 2DE5D 2Q3WA 1BCCE 4EMJB 2D2CD 1PPJE 3D89A 2DE7D 2XSOA 2NVGA 2QJPC 1KB9E 2NUMA 1VM9A 1O7HA 4QUPA 3CWBE 3C0DA 1L0LE 4AAYB 3H1LE 2I7FA 2E75D 4PV1D 3GL0A 3H1KE 3GL2A 1VF5D 4P1CH 3GKEA 5BOKA 1ZRTE 5KLIC 1SQBE 1KYOE 1BE3E 3VCPA 2YFIA 1NTME 3CX5E 4NB9D 3VMHD 4H44D 1O7WA 1RFSA 2A06E 2E76D 2ZT9D 4NBFD 3DQYA 1O7NA 2DE6D 2BMRA 4QDFB 4H13D 5AEUA 2HMOA 2XSHA 4NBHD 2JZAA 2YVJB 2BMQA 1Q90C 3BCCE 1NYKA 1ULJA 1VCKA 2E4QA 2FYNC 3GZXA 4P1BH 1O7GA 4QUQA 4HM3A 2HMMA 4PD4E 4NBAD 5HL4A 1SQPE 1NTZE 2FYUE 2ZYLA 4HM0A 4NBGD 1O7PA 2XRXA 2YFJA 1BGYE 3GZYA 4HKVA 1O7MA 3L75E 2HMNA 3GCEA 3GB4A 1WQLA 4H0LD 4D6TE 3VMGD 4NBED 1G8KB 1P84E 3L72E 2HMLA 4NBDD 3L73E 4OGQD 3CXHE 2NUKA 5KKZC 2HMKA 1L0NE 1NU1E 5KLVE 4QDCA 2YFLA 2CKFA 3L70E 5AEWA 2QJYC 4HJLA 3L71E 4NB8D 4NBCD 4QURA 4AIVA 4HM7A 4HM4A 3GOBA 3VCAA 4HM5A 2YIUC 2GBWA 3GTSA 1PP9E 3H1JE 3L74E 2QPZA 3EN1A 1ULIA 2HMJA 2E4PA 1UUVA 5CXMA 4HM6A 2B1XA 2JO6A 1SJGA 2BMOA 2XR8A 2BCCE 2GBXA 1NDOA 2QJKC 4QDDA 4QCKA 1SQVE 3FOUA 3VMID 1UUWA 3AZCA 3TGUE 4HM8A 1EZVE 4U3FE 3H1IE 1JM1A
chains in the Genus database with same CATH superfamily
1RIEA 5AW5B 4BRYA 3W68A 1N73C 2WVRA 1AV1A 2ZYDA 1KB9E 2G8YA 1FS0E 1G1IA 3OJAB 2FYUK 1W5CE 3E1IA 1N73A 2KNCB 2OYHA 2Z5HA 2LKMA 3VMHD 1M7LA 3L73J 1KN7A 1N7LA 2HPCB 2MJZA 3BCCJ 1FZGA 4LLHA 1KQGB 3L4FA 1USDA 2HMOA 3L71J 1YQ3C 3SSUA 1T3JA 2D2CC 1GK6A 5GTHE 3OA7A 1USEA 1RQVA 3K5BA 2K9JA 2FKWB 5APXA 4NBDD 4WB4A 2QJPB 1KB9I 1GL2D 2E74C 1BSNA 2XDJA 3E7KA 4HM4A 2FXPA 2WSFJ 1H88A 1IFNA 1NTZD 4N78D 5TJHA 2JEEA 4HM6A 3CLQA 1L4AC 3HE4B 2BCCE 2WZ7A 4C7NA 2QRXA 1VQ6P 1NTMK 5KKZB 1L0ND 1BDDA 1KFNA 1LTIC 3L70D 2A45H 1ZMEC 2DE5D 1E5WA 2KUBA 1N86A 2Q5UA 4XFJA 1VF5B 5EFWB 5AVZB 2ZXEB 3USSA 1OVVA 3S9OA 3M0AA 2RN0A 1HJBA 2KOGA 1OFCX 3CI9A 1HH0A 1KYOE 1KZUB 2E76B 3JSVC 2W90A 4L74A 5APQA 5B5EE 1LWUC 4C7RA 4H13D 5AEUA 3Q1MA 1VCKA 4WY4A 3IFMA 2QM7A 2BEZF 1L0LD 3SFDC 4WWIA 3M06A 1NTKG 1O7PA 1KFMA 1LWUA 3MGNA 1WQLA 4H0LD 4NBED 1K05A 3AEFC 3L72E 3CCSP 1VQ9P 4BWNA 2HMKA 4IFMA 3H1LG 3RL0B 4QURA 2XNXA 2W6AA 1BCCJ 2M5AB 3FX0A 3SWKA 1N7SD 4HM5A 2YIUC 3LW5H 1KYOI 3L74E 1Y9BA 2HMJA 3ZDMA 2GUSA 3CX5D 2OYIB 1PV3A 1SJGA 3BVHA 3H1IJ 3FOUA 1HUCA 3AEGC 1M1JC 2ZFCA 3PH0A 1AVYA 3A7OA 1EG9A 1SQBG 1SS1A 4EMJB 1JY2P 4ASVA 1J2JB 1Q2NA 2G3AA 3WU2H 3RBZA 3U59A 2E75B 3CWBE 1SQPJ 3UIAA 2ITAA 1NWQA 3G9RA 1J1EB 1M1JA 3CD6P 1DD3A 1URQD 4P1CH 1BGYJ 1ZRTE 3P8MC 5C39A 3AE7C 1GL2A 4UB6E 5BU5A 2HYNA 1RF1B 2ZT9D 5KLVJ 1X79B 5AVYB 2BMRA 1M90Q 1RHZB 2BMQA 2JKVA 4D6TG 5BU8B 3KQGA 1DEBA 1IZNB 2E43A 2FYUE 2ZYLA 1IFMA 2XRXA 3L75E 1JY3P 3GCEA 1AQTA 3KDPB 2M8RA 3AE3C 1PZQA 3CCLP 1ZW0A 2ZVNB 5KKZC 2W8ZA 4K3AA 5AVSB 2YMKA 1ZOYC 1SQQJ 4AIVA 3P32A 4YPCA 4H13C 1FZCB 2OYOA 1RE4C 4U3FG 1PP9E 3H1JE 2W83C 2BCCJ 1T8ZA 2GUVA 1VF5C 5AW8B 1N8RQ 1H89A 1HJ0A 1S9KD 3VMZA 1HGZA 2OTJP 1SFCD 2IFMA 2V7QJ 1EZVE 1GDTA 1LTSC 1NU1D 2E76C 3I55P 2YXRB 5AVTB 1KILD 1FU1A 4QDFA 3MZWB 3VTPC 1FZAA 1J1DB 2Q3WA 3P8CD 1VQ4P 4NPEA 3BRVB 2PP6A 1O7HA 3H32A 1SQPK 2R44A 1OVUA 3H1KE 5AW0B 1NTME 3CX5E 4W80A 1AA0A 1MFZA 3GHGA 1O7WA 4BRYB 1N7SA 3RK3B 5AVVB 1FZEA 2WPRA 2FBWC 4QUQA 4HM3A 2M3EA 5DJUB 2MKVA 2B9BA 1EZVI 2XV5A 4JF7A 2OYIC 1SQBD 3A0HE 5KJ7D 2NZ2A 1N73B 1JMMA 1BSHA 2W6BA 4N3YB 3L73E 4OGQD 2N1TD 1VQMP 2ZT9C 3L71E 1GU5A 1SQQK 3GMAA 4ASWA 2ZYGA 2AEMA 1Q90D 3L74J 2FY8A 2CK3H 1URQA 3V4QA 1X8YA 2KLVA 3QWOC 4PJ0H 2XR8A 3PJSK 1J1EC 1GK4A 3P7KA 2YKPA 2K9YA 2K9JB 1LGHB 2J59M 1EDKA 1VPCA 2IBZE 2WITA 2Q9IA 1HWTC 2FFDA 1NYHA 1T6AA 2D2CB 2NWFA 3KXDA 3FWNA 4HYTB 3HTKA 3V2NA 4C46A 5TISH 1G2CA 1S5LH 1NTZJ 3L72G 4GOFA 1OWAA 1H8AA 2KS1A 4JYCA 4C7NB 3CCMP 2QG4A 4H44B 4BXLA 2PFXA 1LT9C 1SQXD 3EQ2A 5E79E 2KK7A 3DQYA 2DE6D 2AXTE 3U1AA 3L70J 1FC2C 2R5DA 2YVJB 2O01J 1UIIA 2KZJA 1WMKA 2WMMA 3GZXA 1FZCC 1SP4A 1LT9A 1SFCA 4NBGD 2IBZI 5H2FE 2N9YB 3GB4A 4I7ZC 3HRNA 1KILA 2L5GB 3KPEA 2YFLA 3GF3A 3TF5A 3M9QA 5AW9B 3CWBG 3H25A 1JY2N 3AE4C 4NB8D 1J1DC 3II6A 2LXBA 4WY4B 1KQFB 3RGUA 4U7JA 1YITP 3CC2P 1JNMA 2GBWA 1FJKA 1JY2O 1KTMA 1L0LJ 1ULIA 1CI6B 2O1KA 4O9BA 1LWUB 3AEEC 2E5YA 2P58A 5KJ7C 1NO4A 1X9VA 4XE5B 3N0QA 2Q3IA 3CL3D 2N1TC 2FYUG 4ZNCA 5KTBA 3Q5PA 1BCCE 2QIWA 5GTIH 3GW6A 3L75G 1IO4A 2I7FA 5AVQB 1AFOA 1EDIA 1IFJA 1LJ2A 4IFFA 1QVGO 2YFIA 2DW3A 2N1TA 1OW6A 2OYHC 4N6JA 1JY3O 1FE6A 2Y0DA 5DJTB 5CBNA 5B66E 1S4XA 1A02J 2YIUB 1PP9G 3H1JG 1PGPA 1Y8AA 1AVOA 1PPJD 2XSHA 5AW2B 3I5CA 1U7MA 2WT7A 1SQPE 4OWFA 1EZVG 2POHA 1M1JB 1BGYE 2QM8A 1Q86Q 1P84E 1EQ7A 3O8ZA 1GL2B 3IF4A 4DOJA 3R2PA 5KLVE 4QDCA 1IC2A 5AEWA 2SPZA 4HH2A 2I1KA 3H1KG 3NTNA 3LIDA 3KZIH 1NTMG 1L0LK 1UUVA 5KAIE 1IK7A 1R8EA 3O6QA 2WWWA 1NDOA 4H44C 2WSEJ 4DT0A 1MZ9A 5CJ0A 1OX3A 5CMZA 4HM2A 3N4XA 1SQQE 4NBBD 1NJIQ 2IDBA 1ZR4A 3B5ND 1L2PA 1M56D 2NVGA 1VM9A 3L73G 1QL1A 3EFGA 1M57D 3BCCG 1LP1A 1SQVD 3VN0A 1KORA 3G71P 3TGUD 2IFNA 3L71G 2K37A 2WSSH 4H13B 2NPSD 3H1HD 1KQSO 4NBFD 1NU1J 1AJYA 4QDFB 3HD7D 2WPQA 2C9NY 1YHQP 5AVRB 4WY4C 3D6ZA 2HMMA 2Q1KA 2JWAA 2H8PD 3H32B 5AVWB 2KB7P 4H0LB 2IBZG 2YFJA 5KAFH 1BE3D 2HMNA 4MN4C 4JPZB 1H0TA 1VQLP 3PTZA 2IYOA 3GHGB 2AEFA 1ZXGA 2LXCB 4JBZA 4PD4D 1N2DC 3G4SP 3EFFK 3WUUA 3A2AA 1JM1A 2WPVB 4PD4H 1YJNP 1OIPA 1LNQA 4M3LA 2XSOA 1QVFO 2A06G 1MKMA 2QEXP 4WVZA 1URQB 1OXZA 1LTJA 4Y99C 4CPGA 3V2PA 1UIXA 1MV8A 1RE3C 1RF0A 2ZXXA 2WSCH 2ZVOB 2ZT9B 2K3RA 1S2EA 1GL2C 2FFDB 2XU6A 4L73A 4I2LC 4Y28J 1JCDA 2B89A 3HTKB 1RE3A 3WUTA 3CC4P 3T97B 1QL2A 3B5NC 1G2CB 1DIPA 3VMYA 3M91A 1NTZE 2JO1A 5APUA 3HUSA 4N78E 1FZFA 5AW6B 1Q81Q 3GZYA 2KS1B 2HODA 1BCCG 2H89C 3B4SA 3Q5RA 1L0NE 4NPDA 3B5NA 1SQXJ 3BCCD 3L70E 4EDFA 2NPSC 3MTUE 4L76A 3N7NA 2J5UA 2E42A 1KC8Q 3H1IG 1FDIA 2E4PA 1TU3F 1LT9B 1SFCB 5AW4B 1A02F 3C8VA 3LIEA 3A0BH 2KIKA 2NPSA 1KILB 3CXHD 1IJDB 3HD7A 3VYIA 3IN6A 3AE6C 3CPWO 1S72P 1SQPG 3GTEA 2A45I 3MUDC 2IYPA 4IL6H 1BGYG 3JCUH 3L36A 1ZV8A 1YJ9P 2PAJA 4I7ZB 1LT1A 1EXIA 1L0LE 3CXHH 5CCGA 3W67A 3EWKA 5KLVG 3A3YB 4H0LC 1JTHA 3MUDA 1NTKD 2IZ0A 3MD0A 1EDLA 1KQLA 3GHGC 4NBHD 1S3JA 2JZAA 1N7SC 3H1LD 1PGJA 1VQNP 3TNUB 3WUVA 1WRGA 2I8DA 4OGQB 4W7ZA 1SQQG 5KLVK 2A06D 2N1TB 3AE9C 4HJGH 2OTLP 2BCCG 3RK2D 2BEQD 4Z1MH 1NH4A 2WT7B 1DD4A 3AE5C 2B87A 3G6EP 1R5SA 4ZMDA 1URQC 2OYHB 4GT1A 1VQKP 3V4WA 2VRSA 4YXDC 1UUWA 3CCEP 4JYBA 2QSIA 5KLIC 2Q6QA 4IFDK 4HM1A 2KXPB 2FFDC 4XA4A 1JCCA 3QH9A 3D89A 1YQ4C 2KI7B 4UB8H 3CX5I 1U57A 4QUPA 1Y47A 4D6TD 2NRGA 3RK3D 4PV1D 1CSBA 2E5TA 3GL2A 4QMAA 4A7PA 3O6QB 2JDIH 1NVOA 2P7JA 3H1ID 4K35A 1O7NA 3AEAC 3FXEA 1KB9D 3TYYA 1O7GA 4P1BH 2LR2A 3H6PA 2YXQB 4U3FD 2R32A 3BATA 1LP1B 1SFCC 3S1KA 1SQVJ 1L0NJ 1S9KE 1G8KB 3TGUJ 3TK1A 4ZKUA 3L74G 1KILC 1KB9H 1NU1E 1NAFA 2HLOA 1KILE 3H1HJ 2R5BA 1JB0J 4GODA 2KSJA 1GW3A 2K88A 3P8CE 5CJ4A 2YO2A 1VQ7P 1OZHA 1IK9A 2IPPA 5CXMA 1YBKA 4HKZH 2BMOA 5CBOA 3D70A 4QDDA 4L75A 2JWDA 3E1RA 2ZYAA 1BE3J 3VMID 3CCQP 4OVNF 3AECC 1H0TB 3CC7P 2NVFA 3CCRP 5GTHH 1NTZG 2A45G 2E74D 3RK2C 1LTGC 2C0WA 5APYA 2NUMA 4AAYB 5AW3B 1NGMB 2WQYC 1CW5A 2BCCD 2IX7C 4GDOA 3LW5J 5BOKA 3L70G 4EIJA 1L4AD 1SQBE 4OGQC 1JMBA 4NB9D 4AYCA 3NFQA 5AW1B 1QEXA 4PJ0E 2P10A 2WSCJ 1Q90C 1NYKA 1JM0A 5M1BA 1PL5A 1NTZK 1BDCA 2AXCA 3VP9A 4DZOA 5HL4A 1GTWA 3GLMA 1LTJB 2V7QH 4EYYQ 1WT6A 4PV1C 1KYOD 5CHXA 1NKZB 1FOSE 1SQVK 4D6TE 3FGAD 1L0NK 4RKUJ 5TISE 1S5LE 3CMEP 1XTCC 1FBMA 2QE7H 1L0LG 3JC22 4AQRD 4KT0J 2GM4A 4Y99B 1KYOH 3A5TA 1PIXA 5B5EH 3OW2O 4EI2A 3HUSB 2B1XA 4TLFA 3CCUP 3L72D 2FYZA 2M3BA 2HODB 4HM8A 4U3FE 2KLUA 1IFDA 2P2UA 3M9HA 1SQXE 1D7MA 1FQTA 3B5NB 2Y0EA 2B24A 1FDOA 3V6IA 1NHLA 2Z4EA 3L74D 1K73Q 2XZRA 1W2EA 3GL0A 2HG5D 1XTGB 1YTZT 3PP5A 3V5BA 2NPSB 1KV4A 3S4RA 1ZR2A 3HD7B 2R3SA 3MP7B 5APSA 1QGKB 1FZBA 2E4QA 4ZKPA 5BVZA 2FYNC 1FAVA 1P84I 4TT3H 3CWBD 4RESB 3L37A 4NBAD 2QA4P 2KSEA 4HM0A 1ZRTD 3AEDC 5GTIE 3VMGD 1JTHB 1MFTA 2NUKA 3C1LA 1NTKJ 2CKFA 3F89A 3V2RA 3MHVA 1VQOP 2QJYC 1AQ5A 2Z5IA 4HB1A 3B71A 5AW7B 1T2KD 2B88A 2V4HA 1G1JA 1QX8A 2FYUD 4UB6H 1PFIA 2L91A 2FXOA 3H1LJ 1L4AA 5CCGD 3L75D 2JO6A 2RMZA 1K8AQ 1JOCA 3D71A 3PLNA 3RBXA 1PGQA 4B86A 2O01H 1DX7A 1N7SB 1GD2E 1S5LX 4OH8B 4YTPC 2OTKE 1R5LA 1PPJE 3FXDA 4RO0A 1PP9D 4R4MA 1JO5A 3H1JD 2P1JA 2RKLA 3PRJA 2WTYA 1QLED 2B87B 1SQBJ 1LTJC 1K04A 1VF5D 1NU1G 1GW4A 1CI6A 1YI2P 1EZVD 1RF0C 3KZIE 1KMIZ 1VL2A 3AE8C 1X22A 1SLQA 2E76D 3Q2YA 4YXWH 3Q5SA 3AE2C 3OAKA 4W7YA 3KYQA 2PRRA 2R3CA 3H1KD 4D6TJ 5KLIB 1ZN5A 3HUSC 1O7MA 1NTMD 1ZP0C 1HGVA 3HE5A 1NU1K 3BASA 1VQ5P 3FWLA 3CCVP 2CPSA 2YKOA 1NTKK 4WBAA 1VQ8P 1NOHA 4JQ0D 4LC1A 3RL0D 3CX5H 3GTSA 1W2BO 5AVXB 2Y0CA 4DJGA 2W27A 1E79H 2YKQA 4U3FJ 2KNCA 1NAYA 3BRTB 1SQVE 1DH3A 3L73D 3TGUE 2HPCA 2XKMA 3HD7C 3F5HA 1IFIA 3L71D 3H1HE 5KAFE 1EDJA 3A0HH 2QJPC 4AUWA 3V2QA 1T2KC 1PGOA 2GA1A 2O3JA 2E75D 1K9MQ 1GMJA 1SQBK 3CMAP 2K1AA 5L8RJ 5CCGC 2AEJA 1BE3E 3SWFA 3MIWA 2IBZD 3VMAA 1RFSA 1U7JA 2QVAA 1LTBC 2YMYA 4PD4E 4GOEA 1YTZI 2WSEH 2OQQA 2Q7CA 3HE4A 3Q3DA 1OW7A 3M9BA 4HKVA 2JJLA 1SQXG 2WSFH 3ITKA 5K5GB 4NPFX 2W6JH 1RQUA 3TSIA 4I6MC 2HR3A 3RK2B 1HTLC 2RH0A 4HJLA 1RE4A 4HM7A 3L35A 2O01N 5APTA 1LTTC 3VCAA 3GF7A 2QPZA 1X0TA 3B8EB 5E79H 5APVA 3WU2E 1ZLLA 3GG2A 2AXTH 2ZJSE 2GBXA 1RH5B 1SQXK 4RJTA 4GKGA 1CZQA 3RL0g 1JEKA 3NXSA 1G8JB 1FDMA 4PD4I 2KZIA 1HVVA 2BASA 3M0DC 2YO3A 5H2FH 1DEEG 4PV1B 4IOIH 1S1CX 5CCHD 3C0DA 3RL0C 2QJKB 2H43A 3GKEA 3M0DA 3L72J 3D6YA 1BCCD 4R4LA 3BCCE 1RY3A 2M5AA 3A0BE 4KHXA 2HFED 1YIJP 3SFEC 2CPBA 1JUNA 2OYIA 3I56P 2JP3A 1EXJA 5AVUB 3PHLA 2E75C 4IL6E 2KYVA 3JCUE 1HBWA 4GIFA 1OVRA 2HMLA 1PPJG 3U1CA 2C9LY 3CXHE 3IAOA 2OGUA 2I1JA 1VDFA 4NBCD 4LGDE 3GOBA 1GZLA 1YYCA 1RF1C 2H7HA 1SQPD 4I1LA 2J58A 3CWBJ 3EN1A 1Q82Q 3T97A 1BGYD 5B66H 3G3ZA 2FXMA 3AEBC 3VOPA 1P84D 2IZ1A 5KLVD 3WMM0 2KP8A 2FYNB 1NTKE 1RF1A 2E74B 2Y9ZA 2NVEA 1HF9A 3NMDA 3EQQA 2N9BA 4DCKA 2XNDH 1FOSF 2WPSA 2D2CD 5APWA 2DE7D 1P84H 3H1LE 2FYUJ 1VQPP 1L4AB 1M8OB 3CXHI 3L75J 3VCPA 1T3UA 3CCJP 2QJYB 1KD1Q 4H44D 2A06E 3SWYA 1SQQD 2Q3EA 2OARA 2ZAEB 2O1JA 5KAIH 3C9IA 1ULJA 1FZCA 1OW8A 1SQVG 1PP9J 1L0NG 3H1JJ 2H88C 3TGUG 2C0XA 2JR8A 3IR9A 5CCHC 3KHUA 2P67A 4UB8E 3H1HG 3AE1C 3R4YA 1EC5A 2YNYA 1Q7YQ 1OMIA 3TDKA 1FJPA 5CCHA 1M1KQ 4EOTA 1Z56A 4KJMA 3RK3C 3VP8A 1BE3G 4WY4D 2Y9YA 1IFPA 2PGDA 1NKNA 1LTAC 3RK3E 2UWJE 3H1KJ 2QJKC 3TNUA 5KJ7A 4QCKA 3VMXA 1MUUA 2M0BA 4IL6X 3HE5B 1GU4A 3AZCA 1JY3N 1NTMJ 1SVFA 3ABVC 1YJWP 3H1IE
chains in the Genus database with same CATH topology
1RIEA 1NTKE 1G8JB 2IBZE 4HM1A 2NVFA 3N0QA 2NVEA 4QDFA 1SQXE 3EQQA 1FQTA 2NWFA 3GTEA 3H1HE 4HM2A 1SQQE 4NBBD 1EG9A 2E74D 2B24A 2DE5D 2Q3WA 1BCCE 4EMJB 2D2CD 1PPJE 3D89A 2DE7D 2XSOA 2NVGA 2QJPC 1KB9E 2NUMA 1VM9A 1O7HA 4QUPA 3CWBE 3C0DA 1L0LE 4AAYB 3H1LE 2I7FA 2E75D 4PV1D 3GL0A 3H1KE 3GL2A 1VF5D 4P1CH 3GKEA 5BOKA 1ZRTE 5KLIC 1SQBE 1KYOE 1BE3E 3VCPA 2YFIA 1NTME 3CX5E 4NB9D 3VMHD 4H44D 1O7WA 1RFSA 2A06E 2E76D 2ZT9D 4NBFD 3DQYA 1O7NA 2DE6D 2BMRA 4QDFB 4H13D 5AEUA 2HMOA 2XSHA 4NBHD 2JZAA 2YVJB 2BMQA 1Q90C 3BCCE 1NYKA 1ULJA 1VCKA 2E4QA 2FYNC 3GZXA 4P1BH 1O7GA 4QUQA 4HM3A 2HMMA 4PD4E 4NBAD 5HL4A 1SQPE 1NTZE 2FYUE 2ZYLA 4HM0A 4NBGD 1O7PA 2XRXA 2YFJA 1BGYE 3GZYA 4HKVA 1O7MA 3L75E 2HMNA 3GCEA 3GB4A 1WQLA 4H0LD 4D6TE 3VMGD 4NBED 1G8KB 1P84E 3L72E 2HMLA 4NBDD 3L73E 4OGQD 3CXHE 2NUKA 5KKZC 2HMKA 1L0NE 1NU1E 5KLVE 4QDCA 2YFLA 2CKFA 3L70E 5AEWA 2QJYC 4HJLA 3L71E 4NB8D 4NBCD 4QURA 4AIVA 4HM7A 4HM4A 3GOBA 3VCAA 4HM5A 2YIUC 2GBWA 3GTSA 1PP9E 3H1JE 3L74E 2QPZA 3EN1A 1ULIA 2HMJA 2E4PA 1UUVA 5CXMA 4HM6A 2B1XA 2JO6A 1SJGA 2BMOA 2XR8A 2BCCE 2GBXA 1NDOA 2QJKC 4QDDA 4QCKA 1SQVE 3FOUA 3VMID 1UUWA 3AZCA 3TGUE 4HM8A 1EZVE 4U3FE 3H1IE 1JM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIE A;  1NTK E;  1G8J B;  2IBZ E;  4HM1 A;  2NVF A;  3N0Q A;  2NVE A;  4QDF A;  1SQX E;  3EQQ A;  1FQT A;  2NWF A;  3GTE A;  3H1H E;  4HM2 A;  1SQQ E;  4NBB D;  1EG9 A;  2E74 D;  2B24 A;  2DE5 D;  2Q3W A;  1BCC E;  4EMJ B;  2D2C D;  1PPJ E;  3D89 A;  2DE7 D;  2XSO A;  2NVG A;  2QJP C;  1KB9 E;  2NUM A;  1VM9 A;  1O7H A;  4QUP A;  3CWB E;  3C0D A;  1L0L E;  4AAY B;  3H1L E;  2I7F A;  2E75 D;  4PV1 D;  3GL0 A;  3H1K E;  3GL2 A;  1VF5 D;  4P1C H;  3GKE A;  5BOK A;  1ZRT E;  5KLI C;  1SQB E;  1KYO E;  1BE3 E;  3VCP A;  2YFI A;  1NTM E;  3CX5 E;  4NB9 D;  3VMH D;  4H44 D;  1O7W A;  1RFS A;  2A06 E;  2E76 D;  2ZT9 D;  4NBF D;  3DQY A;  1O7N A;  2DE6 D;  2BMR A;  4QDF B;  4H13 D;  5AEU A;  2HMO A;  2XSH A;  4NBH D;  2JZA A;  2YVJ B;  2BMQ A;  1Q90 C;  3BCC E;  1NYK A;  1ULJ A;  1VCK A;  2E4Q A;  2FYN C;  3GZX A;  4P1B H;  1O7G A;  4QUQ A;  4HM3 A;  2HMM A;  4PD4 E;  4NBA D;  5HL4 A;  1SQP E;  1NTZ E;  2FYU E;  2ZYL A;  4HM0 A;  4NBG D;  1O7P A;  2XRX A;  2YFJ A;  1BGY E;  3GZY A;  4HKV A;  1O7M A;  3L75 E;  2HMN A;  3GCE A;  3GB4 A;  1WQL A;  4H0L D;  4D6T E;  3VMG D;  4NBE D;  1G8K B;  1P84 E;  3L72 E;  2HML A;  4NBD D;  3L73 E;  4OGQ D;  3CXH E;  2NUK A;  5KKZ C;  2HMK A;  1L0N E;  1NU1 E;  5KLV E;  4QDC A;  2YFL A;  2CKF A;  3L70 E;  5AEW A;  2QJY C;  4HJL A;  3L71 E;  4NB8 D;  4NBC D;  4QUR A;  4AIV A;  4HM7 A;  4HM4 A;  3GOB A;  3VCA A;  4HM5 A;  2YIU C;  2GBW A;  3GTS A;  1PP9 E;  3H1J E;  3L74 E;  2QPZ A;  3EN1 A;  1ULI A;  2HMJ A;  2E4P A;  1UUV A;  5CXM A;  4HM6 A;  2B1X A;  2JO6 A;  1SJG A;  2BMO A;  2XR8 A;  2BCC E;  2GBX A;  1NDO A;  2QJK C;  4QDD A;  4QCK A;  1SQV E;  3FOU A;  3VMI D;  1UUW A;  3AZC A;  3TGU E;  4HM8 A;  1EZV E;  4U3F E;  3H1I E;  1JM1 A; 
#chains in the Genus database with same CATH topology
 1RIE A;  5AW5 B;  4BRY A;  3W68 A;  1N73 C;  2WVR A;  1AV1 A;  2ZYD A;  1KB9 E;  2G8Y A;  1FS0 E;  1G1I A;  3OJA B;  2FYU K;  1W5C E;  3E1I A;  1N73 A;  2KNC B;  2OYH A;  2Z5H A;  2LKM A;  3VMH D;  1M7L A;  3L73 J;  1KN7 A;  1N7L A;  2HPC B;  2MJZ A;  3BCC J;  1FZG A;  4LLH A;  1KQG B;  3L4F A;  1USD A;  2HMO A;  3L71 J;  1YQ3 C;  3SSU A;  1T3J A;  2D2C C;  1GK6 A;  5GTH E;  3OA7 A;  1USE A;  1RQV A;  3K5B A;  2K9J A;  2FKW B;  5APX A;  4NBD D;  4WB4 A;  2QJP B;  1KB9 I;  1GL2 D;  2E74 C;  1BSN A;  2XDJ A;  3E7K A;  4HM4 A;  2FXP A;  2WSF J;  1H88 A;  1IFN A;  1NTZ D;  4N78 D;  5TJH A;  2JEE A;  4HM6 A;  3CLQ A;  1L4A C;  3HE4 B;  2BCC E;  2WZ7 A;  4C7N A;  2QRX A;  1VQ6 P;  1NTM K;  5KKZ B;  1L0N D;  1BDD A;  1KFN A;  1LTI C;  3L70 D;  2A45 H;  1ZME C;  2DE5 D;  1E5W A;  2KUB A;  1N86 A;  2Q5U A;  4XFJ A;  1VF5 B;  5EFW B;  5AVZ B;  2ZXE B;  3USS A;  1OVV A;  3S9O A;  3M0A A;  2RN0 A;  1HJB A;  2KOG A;  1OFC X;  3CI9 A;  1HH0 A;  1KYO E;  1KZU B;  2E76 B;  3JSV C;  2W90 A;  4L74 A;  5APQ A;  5B5E E;  1LWU C;  4C7R A;  4H13 D;  5AEU A;  3Q1M A;  1VCK A;  4WY4 A;  3IFM A;  2QM7 A;  2BEZ F;  1L0L D;  3SFD C;  4WWI A;  3M06 A;  1NTK G;  1O7P A;  1KFM A;  1LWU A;  3MGN A;  1WQL A;  4H0L D;  4NBE D;  1K05 A;  3AEF C;  3L72 E;  3CCS P;  1VQ9 P;  4BWN A;  2HMK A;  4IFM A;  3H1L G;  3RL0 B;  4QUR A;  2XNX A;  2W6A A;  1BCC J;  2M5A B;  3FX0 A;  3SWK A;  1N7S D;  4HM5 A;  2YIU C;  3LW5 H;  1KYO I;  3L74 E;  1Y9B A;  2HMJ A;  3ZDM A;  2GUS A;  3CX5 D;  2OYI B;  1PV3 A;  1SJG A;  3BVH A;  3H1I J;  3FOU A;  1HUC A;  3AEG C;  1M1J C;  2ZFC A;  3PH0 A;  1AVY A;  3A7O A;  1EG9 A;  1SQB G;  1SS1 A;  4EMJ B;  1JY2 P;  4ASV A;  1J2J B;  1Q2N A;  2G3A A;  3WU2 H;  3RBZ A;  3U59 A;  2E75 B;  3CWB E;  1SQP J;  3UIA A;  2ITA A;  1NWQ A;  3G9R A;  1J1E B;  1M1J A;  3CD6 P;  1DD3 A;  1URQ D;  4P1C H;  1BGY J;  1ZRT E;  3P8M C;  5C39 A;  3AE7 C;  1GL2 A;  4UB6 E;  5BU5 A;  2HYN A;  1RF1 B;  2ZT9 D;  5KLV J;  1X79 B;  5AVY B;  2BMR A;  1M90 Q;  1RHZ B;  2BMQ A;  2JKV A;  4D6T G;  5BU8 B;  3KQG A;  1DEB A;  1IZN B;  2E43 A;  2FYU E;  2ZYL A;  1IFM A;  2XRX A;  3L75 E;  1JY3 P;  3GCE A;  1AQT A;  3KDP B;  2M8R A;  3AE3 C;  1PZQ A;  3CCL P;  1ZW0 A;  2ZVN B;  5KKZ C;  2W8Z A;  4K3A A;  5AVS B;  2YMK A;  1ZOY C;  1SQQ J;  4AIV A;  3P32 A;  4YPC A;  4H13 C;  1FZC B;  2OYO A;  1RE4 C;  4U3F G;  1PP9 E;  3H1J E;  2W83 C;  2BCC J;  1T8Z A;  2GUV A;  1VF5 C;  5AW8 B;  1N8R Q;  1H89 A;  1HJ0 A;  1S9K D;  3VMZ A;  1HGZ A;  2OTJ P;  1SFC D;  2IFM A;  2V7Q J;  1EZV E;  1GDT A;  1LTS C;  1NU1 D;  2E76 C;  3I55 P;  2YXR B;  5AVT B;  1KIL D;  1FU1 A;  4QDF A;  3MZW B;  3VTP C;  1FZA A;  1J1D B;  2Q3W A;  3P8C D;  1VQ4 P;  4NPE A;  3BRV B;  2PP6 A;  1O7H A;  3H32 A;  1SQP K;  2R44 A;  1OVU A;  3H1K E;  5AW0 B;  1NTM E;  3CX5 E;  4W80 A;  1AA0 A;  1MFZ A;  3GHG A;  1O7W A;  4BRY B;  1N7S A;  3RK3 B;  5AVV B;  1FZE A;  2WPR A;  2FBW C;  4QUQ A;  4HM3 A;  2M3E A;  5DJU B;  2MKV A;  2B9B A;  1EZV I;  2XV5 A;  4JF7 A;  2OYI C;  1SQB D;  3A0H E;  5KJ7 D;  2NZ2 A;  1N73 B;  1JMM A;  1BSH A;  2W6B A;  4N3Y B;  3L73 E;  4OGQ D;  2N1T D;  1VQM P;  2ZT9 C;  3L71 E;  1GU5 A;  1SQQ K;  3GMA A;  4ASW A;  2ZYG A;  2AEM A;  1Q90 D;  3L74 J;  2FY8 A;  2CK3 H;  1URQ A;  3V4Q A;  1X8Y A;  2KLV A;  3QWO C;  4PJ0 H;  2XR8 A;  3PJS K;  1J1E C;  1GK4 A;  3P7K A;  2YKP A;  2K9Y A;  2K9J B;  1LGH B;  2J59 M;  1EDK A;  1VPC A;  2IBZ E;  2WIT A;  2Q9I A;  1HWT C;  2FFD A;  1NYH A;  1T6A A;  2D2C B;  2NWF A;  3KXD A;  3FWN A;  4HYT B;  3HTK A;  3V2N A;  4C46 A;  5TIS H;  1G2C A;  1S5L H;  1NTZ J;  3L72 G;  4GOF A;  1OWA A;  1H8A A;  2KS1 A;  4JYC A;  4C7N B;  3CCM P;  2QG4 A;  4H44 B;  4BXL A;  2PFX A;  1LT9 C;  1SQX D;  3EQ2 A;  5E79 E;  2KK7 A;  3DQY A;  2DE6 D;  2AXT E;  3U1A A;  3L70 J;  1FC2 C;  2R5D A;  2YVJ B;  2O01 J;  1UII A;  2KZJ A;  1WMK A;  2WMM A;  3GZX A;  1FZC C;  1SP4 A;  1LT9 A;  1SFC A;  4NBG D;  2IBZ I;  5H2F E;  2N9Y B;  3GB4 A;  4I7Z C;  3HRN A;  1KIL A;  2L5G B;  3KPE A;  2YFL A;  3GF3 A;  3TF5 A;  3M9Q A;  5AW9 B;  3CWB G;  3H25 A;  1JY2 N;  3AE4 C;  4NB8 D;  1J1D C;  3II6 A;  2LXB A;  4WY4 B;  1KQF B;  3RGU A;  4U7J A;  1YIT P;  3CC2 P;  1JNM A;  2GBW A;  1FJK A;  1JY2 O;  1KTM A;  1L0L J;  1ULI A;  1CI6 B;  2O1K A;  4O9B A;  1LWU B;  3AEE C;  2E5Y A;  2P58 A;  5KJ7 C;  1NO4 A;  1X9V A;  4XE5 B;  3N0Q A;  2Q3I A;  3CL3 D;  2N1T C;  2FYU G;  4ZNC A;  5KTB A;  3Q5P A;  1BCC E;  2QIW A;  5GTI H;  3GW6 A;  3L75 G;  1IO4 A;  2I7F A;  5AVQ B;  1AFO A;  1EDI A;  1IFJ A;  1LJ2 A;  4IFF A;  1QVG O;  2YFI A;  2DW3 A;  2N1T A;  1OW6 A;  2OYH C;  4N6J A;  1JY3 O;  1FE6 A;  2Y0D A;  5DJT B;  5CBN A;  5B66 E;  1S4X A;  1A02 J;  2YIU B;  1PP9 G;  3H1J G;  1PGP A;  1Y8A A;  1AVO A;  1PPJ D;  2XSH A;  5AW2 B;  3I5C A;  1U7M A;  2WT7 A;  1SQP E;  4OWF A;  1EZV G;  2POH A;  1M1J B;  1BGY E;  2QM8 A;  1Q86 Q;  1P84 E;  1EQ7 A;  3O8Z A;  1GL2 B;  3IF4 A;  4DOJ A;  3R2P A;  5KLV E;  4QDC A;  1IC2 A;  5AEW A;  2SPZ A;  4HH2 A;  2I1K A;  3H1K G;  3NTN A;  3LID A;  3KZI H;  1NTM G;  1L0L K;  1UUV A;  5KAI E;  1IK7 A;  1R8E A;  3O6Q A;  2WWW A;  1NDO A;  4H44 C;  2WSE J;  4DT0 A;  1MZ9 A;  5CJ0 A;  1OX3 A;  5CMZ A;  4HM2 A;  3N4X A;  1SQQ E;  4NBB D;  1NJI Q;  2IDB A;  1ZR4 A;  3B5N D;  1L2P A;  1M56 D;  2NVG A;  1VM9 A;  3L73 G;  1QL1 A;  3EFG A;  1M57 D;  3BCC G;  1LP1 A;  1SQV D;  3VN0 A;  1KOR A;  3G71 P;  3TGU D;  2IFN A;  3L71 G;  2K37 A;  2WSS H;  4H13 B;  2NPS D;  3H1H D;  1KQS O;  4NBF D;  1NU1 J;  1AJY A;  4QDF B;  3HD7 D;  2WPQ A;  2C9N Y;  1YHQ P;  5AVR B;  4WY4 C;  3D6Z A;  2HMM A;  2Q1K A;  2JWA A;  2H8P D;  3H32 B;  5AVW B;  2KB7 P;  4H0L B;  2IBZ G;  2YFJ A;  5KAF H;  1BE3 D;  2HMN A;  4MN4 C;  4JPZ B;  1H0T A;  1VQL P;  3PTZ A;  2IYO A;  3GHG B;  2AEF A;  1ZXG A;  2LXC B;  4JBZ A;  4PD4 D;  1N2D C;  3G4S P;  3EFF K;  3WUU A;  3A2A A;  1JM1 A;  2WPV B;  4PD4 H;  1YJN P;  1OIP A;  1LNQ A;  4M3L A;  2XSO A;  1QVF O;  2A06 G;  1MKM A;  2QEX P;  4WVZ A;  1URQ B;  1OXZ A;  1LTJ A;  4Y99 C;  4CPG A;  3V2P A;  1UIX A;  1MV8 A;  1RE3 C;  1RF0 A;  2ZXX A;  2WSC H;  2ZVO B;  2ZT9 B;  2K3R A;  1S2E A;  1GL2 C;  2FFD B;  2XU6 A;  4L73 A;  4I2L C;  4Y28 J;  1JCD A;  2B89 A;  3HTK B;  1RE3 A;  3WUT A;  3CC4 P;  3T97 B;  1QL2 A;  3B5N C;  1G2C B;  1DIP A;  3VMY A;  3M91 A;  1NTZ E;  2JO1 A;  5APU A;  3HUS A;  4N78 E;  1FZF A;  5AW6 B;  1Q81 Q;  3GZY A;  2KS1 B;  2HOD A;  1BCC G;  2H89 C;  3B4S A;  3Q5R A;  1L0N E;  4NPD A;  3B5N A;  1SQX J;  3BCC D;  3L70 E;  4EDF A;  2NPS C;  3MTU E;  4L76 A;  3N7N A;  2J5U A;  2E42 A;  1KC8 Q;  3H1I G;  1FDI A;  2E4P A;  1TU3 F;  1LT9 B;  1SFC B;  5AW4 B;  1A02 F;  3C8V A;  3LIE A;  3A0B H;  2KIK A;  2NPS A;  1KIL B;  3CXH D;  1IJD B;  3HD7 A;  3VYI A;  3IN6 A;  3AE6 C;  3CPW O;  1S72 P;  1SQP G;  3GTE A;  2A45 I;  3MUD C;  2IYP A;  4IL6 H;  1BGY G;  3JCU H;  3L36 A;  1ZV8 A;  1YJ9 P;  2PAJ A;  4I7Z B;  1LT1 A;  1EXI A;  1L0L E;  3CXH H;  5CCG A;  3W67 A;  3EWK A;  5KLV G;  3A3Y B;  4H0L C;  1JTH A;  3MUD A;  1NTK D;  2IZ0 A;  3MD0 A;  1EDL A;  1KQL A;  3GHG C;  4NBH D;  1S3J A;  2JZA A;  1N7S C;  3H1L D;  1PGJ A;  1VQN P;  3TNU B;  3WUV A;  1WRG A;  2I8D A;  4OGQ B;  4W7Z A;  1SQQ G;  5KLV K;  2A06 D;  2N1T B;  3AE9 C;  4HJG H;  2OTL P;  2BCC G;  3RK2 D;  2BEQ D;  4Z1M H;  1NH4 A;  2WT7 B;  1DD4 A;  3AE5 C;  2B87 A;  3G6E P;  1R5S A;  4ZMD A;  1URQ C;  2OYH B;  4GT1 A;  1VQK P;  3V4W A;  2VRS A;  4YXD C;  1UUW A;  3CCE P;  4JYB A;  2QSI A;  5KLI C;  2Q6Q A;  4IFD K;  4HM1 A;  2KXP B;  2FFD C;  4XA4 A;  1JCC A;  3QH9 A;  3D89 A;  1YQ4 C;  2KI7 B;  4UB8 H;  3CX5 I;  1U57 A;  4QUP A;  1Y47 A;  4D6T D;  2NRG A;  3RK3 D;  4PV1 D;  1CSB A;  2E5T A;  3GL2 A;  4QMA A;  4A7P A;  3O6Q B;  2JDI H;  1NVO A;  2P7J A;  3H1I D;  4K35 A;  1O7N A;  3AEA C;  3FXE A;  1KB9 D;  3TYY A;  1O7G A;  4P1B H;  2LR2 A;  3H6P A;  2YXQ B;  4U3F D;  2R32 A;  3BAT A;  1LP1 B;  1SFC C;  3S1K A;  1SQV J;  1L0N J;  1S9K E;  1G8K B;  3TGU J;  3TK1 A;  4ZKU A;  3L74 G;  1KIL C;  1KB9 H;  1NU1 E;  1NAF A;  2HLO A;  1KIL E;  3H1H J;  2R5B A;  1JB0 J;  4GOD A;  2KSJ A;  1GW3 A;  2K88 A;  3P8C E;  5CJ4 A;  2YO2 A;  1VQ7 P;  1OZH A;  1IK9 A;  2IPP A;  5CXM A;  1YBK A;  4HKZ H;  2BMO A;  5CBO A;  3D70 A;  4QDD A;  4L75 A;  2JWD A;  3E1R A;  2ZYA A;  1BE3 J;  3VMI D;  3CCQ P;  4OVN F;  3AEC C;  1H0T B;  3CC7 P;  2NVF A;  3CCR P;  5GTH H;  1NTZ G;  2A45 G;  2E74 D;  3RK2 C;  1LTG C;  2C0W A;  5APY A;  2NUM A;  4AAY B;  5AW3 B;  1NGM B;  2WQY C;  1CW5 A;  2BCC D;  2IX7 C;  4GDO A;  3LW5 J;  5BOK A;  3L70 G;  4EIJ A;  1L4A D;  1SQB E;  4OGQ C;  1JMB A;  4NB9 D;  4AYC A;  3NFQ A;  5AW1 B;  1QEX A;  4PJ0 E;  2P10 A;  2WSC J;  1Q90 C;  1NYK A;  1JM0 A;  5M1B A;  1PL5 A;  1NTZ K;  1BDC A;  2AXC A;  3VP9 A;  4DZO A;  5HL4 A;  1GTW A;  3GLM A;  1LTJ B;  2V7Q H;  4EYY Q;  1WT6 A;  4PV1 C;  1KYO D;  5CHX A;  1NKZ B;  1FOS E;  1SQV K;  4D6T E;  3FGA D;  1L0N K;  4RKU J;  5TIS E;  1S5L E;  3CME P;  1XTC C;  1FBM A;  2QE7 H;  1L0L G;  3JC2 2;  4AQR D;  4KT0 J;  2GM4 A;  4Y99 B;  1KYO H;  3A5T A;  1PIX A;  5B5E H;  3OW2 O;  4EI2 A;  3HUS B;  2B1X A;  4TLF A;  3CCU P;  3L72 D;  2FYZ A;  2M3B A;  2HOD B;  4HM8 A;  4U3F E;  2KLU A;  1IFD A;  2P2U A;  3M9H A;  1SQX E;  1D7M A;  1FQT A;  3B5N B;  2Y0E A;  2B24 A;  1FDO A;  3V6I A;  1NHL A;  2Z4E A;  3L74 D;  1K73 Q;  2XZR A;  1W2E A;  3GL0 A;  2HG5 D;  1XTG B;  1YTZ T;  3PP5 A;  3V5B A;  2NPS B;  1KV4 A;  3S4R A;  1ZR2 A;  3HD7 B;  2R3S A;  3MP7 B;  5APS A;  1QGK B;  1FZB A;  2E4Q A;  4ZKP A;  5BVZ A;  2FYN C;  1FAV A;  1P84 I;  4TT3 H;  3CWB D;  4RES B;  3L37 A;  4NBA D;  2QA4 P;  2KSE A;  4HM0 A;  1ZRT D;  3AED C;  5GTI E;  3VMG D;  1JTH B;  1MFT A;  2NUK A;  3C1L A;  1NTK J;  2CKF A;  3F89 A;  3V2R A;  3MHV A;  1VQO P;  2QJY C;  1AQ5 A;  2Z5I A;  4HB1 A;  3B71 A;  5AW7 B;  1T2K D;  2B88 A;  2V4H A;  1G1J A;  1QX8 A;  2FYU D;  4UB6 H;  1PFI A;  2L91 A;  2FXO A;  3H1L J;  1L4A A;  5CCG D;  3L75 D;  2JO6 A;  2RMZ A;  1K8A Q;  1JOC A;  3D71 A;  3PLN A;  3RBX A;  1PGQ A;  4B86 A;  2O01 H;  1DX7 A;  1N7S B;  1GD2 E;  1S5L X;  4OH8 B;  4YTP C;  2OTK E;  1R5L A;  1PPJ E;  3FXD A;  4RO0 A;  1PP9 D;  4R4M A;  1JO5 A;  3H1J D;  2P1J A;  2RKL A;  3PRJ A;  2WTY A;  1QLE D;  2B87 B;  1SQB J;  1LTJ C;  1K04 A;  1VF5 D;  1NU1 G;  1GW4 A;  1CI6 A;  1YI2 P;  1EZV D;  1RF0 C;  3KZI E;  1KMI Z;  1VL2 A;  3AE8 C;  1X22 A;  1SLQ A;  2E76 D;  3Q2Y A;  4YXW H;  3Q5S A;  3AE2 C;  3OAK A;  4W7Y A;  3KYQ A;  2PRR A;  2R3C A;  3H1K D;  4D6T J;  5KLI B;  1ZN5 A;  3HUS C;  1O7M A;  1NTM D;  1ZP0 C;  1HGV A;  3HE5 A;  1NU1 K;  3BAS A;  1VQ5 P;  3FWL A;  3CCV P;  2CPS A;  2YKO A;  1NTK K;  4WBA A;  1VQ8 P;  1NOH A;  4JQ0 D;  4LC1 A;  3RL0 D;  3CX5 H;  3GTS A;  1W2B O;  5AVX B;  2Y0C A;  4DJG A;  2W27 A;  1E79 H;  2YKQ A;  4U3F J;  2KNC A;  1NAY A;  3BRT B;  1SQV E;  1DH3 A;  3L73 D;  3TGU E;  2HPC A;  2XKM A;  3HD7 C;  3F5H A;  1IFI A;  3L71 D;  3H1H E;  5KAF E;  1EDJ A;  3A0H H;  2QJP C;  4AUW A;  3V2Q A;  1T2K C;  1PGO A;  2GA1 A;  2O3J A;  2E75 D;  1K9M Q;  1GMJ A;  1SQB K;  3CMA P;  2K1A A;  5L8R J;  5CCG C;  2AEJ A;  1BE3 E;  3SWF A;  3MIW A;  2IBZ D;  3VMA A;  1RFS A;  1U7J A;  2QVA A;  1LTB C;  2YMY A;  4PD4 E;  4GOE A;  1YTZ I;  2WSE H;  2OQQ A;  2Q7C A;  3HE4 A;  3Q3D A;  1OW7 A;  3M9B A;  4HKV A;  2JJL A;  1SQX G;  2WSF H;  3ITK A;  5K5G B;  4NPF X;  2W6J H;  1RQU A;  3TSI A;  4I6M C;  2HR3 A;  3RK2 B;  1HTL C;  2RH0 A;  4HJL A;  1RE4 A;  4HM7 A;  3L35 A;  2O01 N;  5APT A;  1LTT C;  3VCA A;  3GF7 A;  2QPZ A;  1X0T A;  3B8E B;  5E79 H;  5APV A;  3WU2 E;  1ZLL A;  3GG2 A;  2AXT H;  2ZJS E;  2GBX A;  1RH5 B;  1SQX K;  4RJT A;  4GKG A;  1CZQ A;  3RL0 g;  1JEK A;  3NXS A;  1G8J B;  1FDM A;  4PD4 I;  2KZI A;  1HVV A;  2BAS A;  3M0D C;  2YO3 A;  5H2F H;  1DEE G;  4PV1 B;  4IOI H;  1S1C X;  5CCH D;  3C0D A;  3RL0 C;  2QJK B;  2H43 A;  3GKE A;  3M0D A;  3L72 J;  3D6Y A;  1BCC D;  4R4L A;  3BCC E;  1RY3 A;  2M5A A;  3A0B E;  4KHX A;  2HFE D;  1YIJ P;  3SFE C;  2CPB A;  1JUN A;  2OYI A;  3I56 P;  2JP3 A;  1EXJ A;  5AVU B;  3PHL A;  2E75 C;  4IL6 E;  2KYV A;  3JCU E;  1HBW A;  4GIF A;  1OVR A;  2HML A;  1PPJ G;  3U1C A;  2C9L Y;  3CXH E;  3IAO A;  2OGU A;  2I1J A;  1VDF A;  4NBC D;  4LGD E;  3GOB A;  1GZL A;  1YYC A;  1RF1 C;  2H7H A;  1SQP D;  4I1L A;  2J58 A;  3CWB J;  3EN1 A;  1Q82 Q;  3T97 A;  1BGY D;  5B66 H;  3G3Z A;  2FXM A;  3AEB C;  3VOP A;  1P84 D;  2IZ1 A;  5KLV D;  3WMM 0;  2KP8 A;  2FYN B;  1NTK E;  1RF1 A;  2E74 B;  2Y9Z A;  2NVE A;  1HF9 A;  3NMD A;  3EQQ A;  2N9B A;  4DCK A;  2XND H;  1FOS F;  2WPS A;  2D2C D;  5APW A;  2DE7 D;  1P84 H;  3H1L E;  2FYU J;  1VQP P;  1L4A B;  1M8O B;  3CXH I;  3L75 J;  3VCP A;  1T3U A;  3CCJ P;  2QJY B;  1KD1 Q;  4H44 D;  2A06 E;  3SWY A;  1SQQ D;  2Q3E A;  2OAR A;  2ZAE B;  2O1J A;  5KAI H;  3C9I A;  1ULJ A;  1FZC A;  1OW8 A;  1SQV G;  1PP9 J;  1L0N G;  3H1J J;  2H88 C;  3TGU G;  2C0X A;  2JR8 A;  3IR9 A;  5CCH C;  3KHU A;  2P67 A;  4UB8 E;  3H1H G;  3AE1 C;  3R4Y A;  1EC5 A;  2YNY A;  1Q7Y Q;  1OMI A;  3TDK A;  1FJP A;  5CCH A;  1M1K Q;  4EOT A;  1Z56 A;  4KJM A;  3RK3 C;  3VP8 A;  1BE3 G;  4WY4 D;  2Y9Y A;  1IFP A;  2PGD A;  1NKN A;  1LTA C;  3RK3 E;  2UWJ E;  3H1K J;  2QJK C;  3TNU A;  5KJ7 A;  4QCK A;  3VMX A;  1MUU A;  2M0B A;  4IL6 X;  3HE5 B;  1GU4 A;  3AZC A;  1JY3 N;  1NTM J;  1SVF A;  3ABV C;  1YJW P;  3H1I E; 
#chains in the Genus database with same CATH homology
 1RIE A;  1NTK E;  1G8J B;  2IBZ E;  4HM1 A;  2NVF A;  3N0Q A;  2NVE A;  4QDF A;  1SQX E;  3EQQ A;  1FQT A;  2NWF A;  3GTE A;  3H1H E;  4HM2 A;  1SQQ E;  4NBB D;  1EG9 A;  2E74 D;  2B24 A;  2DE5 D;  2Q3W A;  1BCC E;  4EMJ B;  2D2C D;  1PPJ E;  3D89 A;  2DE7 D;  2XSO A;  2NVG A;  2QJP C;  1KB9 E;  2NUM A;  1VM9 A;  1O7H A;  4QUP A;  3CWB E;  3C0D A;  1L0L E;  4AAY B;  3H1L E;  2I7F A;  2E75 D;  4PV1 D;  3GL0 A;  3H1K E;  3GL2 A;  1VF5 D;  4P1C H;  3GKE A;  5BOK A;  1ZRT E;  5KLI C;  1SQB E;  1KYO E;  1BE3 E;  3VCP A;  2YFI A;  1NTM E;  3CX5 E;  4NB9 D;  3VMH D;  4H44 D;  1O7W A;  1RFS A;  2A06 E;  2E76 D;  2ZT9 D;  4NBF D;  3DQY A;  1O7N A;  2DE6 D;  2BMR A;  4QDF B;  4H13 D;  5AEU A;  2HMO A;  2XSH A;  4NBH D;  2JZA A;  2YVJ B;  2BMQ A;  1Q90 C;  3BCC E;  1NYK A;  1ULJ A;  1VCK A;  2E4Q A;  2FYN C;  3GZX A;  4P1B H;  1O7G A;  4QUQ A;  4HM3 A;  2HMM A;  4PD4 E;  4NBA D;  5HL4 A;  1SQP E;  1NTZ E;  2FYU E;  2ZYL A;  4HM0 A;  4NBG D;  1O7P A;  2XRX A;  2YFJ A;  1BGY E;  3GZY A;  4HKV A;  1O7M A;  3L75 E;  2HMN A;  3GCE A;  3GB4 A;  1WQL A;  4H0L D;  4D6T E;  3VMG D;  4NBE D;  1G8K B;  1P84 E;  3L72 E;  2HML A;  4NBD D;  3L73 E;  4OGQ D;  3CXH E;  2NUK A;  5KKZ C;  2HMK A;  1L0N E;  1NU1 E;  5KLV E;  4QDC A;  2YFL A;  2CKF A;  3L70 E;  5AEW A;  2QJY C;  4HJL A;  3L71 E;  4NB8 D;  4NBC D;  4QUR A;  4AIV A;  4HM7 A;  4HM4 A;  3GOB A;  3VCA A;  4HM5 A;  2YIU C;  2GBW A;  3GTS A;  1PP9 E;  3H1J E;  3L74 E;  2QPZ A;  3EN1 A;  1ULI A;  2HMJ A;  2E4P A;  1UUV A;  5CXM A;  4HM6 A;  2B1X A;  2JO6 A;  1SJG A;  2BMO A;  2XR8 A;  2BCC E;  2GBX A;  1NDO A;  2QJK C;  4QDD A;  4QCK A;  1SQV E;  3FOU A;  3VMI D;  1UUW A;  3AZC A;  3TGU E;  4HM8 A;  1EZV E;  4U3F E;  3H1I E;  1JM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...