1KYOE

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 46
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1kyoE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1kyoE02
5AEUA 1EG9A 1NYKA 2QPZA 1PPJE 2DE6D 1O7HA 3BCCE 5HL4A 1RFSA 2QJYC 3GCEA 4HM5A 4QURA 1EZVE 2E4PA 4NBHD 4HM1A 4D6TE 4NBED 3H1KE 4QDFB 1FQTA 1NTZE 3H1HE 3TGUE 2CKFA 2BCCE 5KLVE 3L72E 1SQPE 2NWFA 4PV1D 4OGQD 3GTSA 3GKEA 1O7GA 3L74E 1L0NE 3C0DA 2NVGA 2FYNC 3H1LE 2JO6A 2HMJA 3L71E 4HJLA 3L75E 4NBFD 4QCKA 2ZYLA 4NBCD 4H0LD 2HMKA 2HMNA 5BOKA 2HMLA 1Q90C 3VCPA 1BCCE 2DE7D 2YVJB 2QJPC 4H13D 4HM4A 3GL2A 2NVFA 4QUQA 4AAYB 1NTME 3CXHE 5CXMA 2YFLA 2XSHA 5KKZC 5KLIC 2IBZE 1WQLA 3FOUA 4NBDD 2JZAA 2DE5D 2E75D 2A06E 2NUMA 1ZRTE 2NUKA 2FYUE 1KYOE 5AEWA 3GTEA 2GBXA 3VMID 3VCAA 1SQVE 4NBBD 4QDDA 3VMGD 3GZYA 1ULIA 2D2CD 1O7NA 2E4QA 3N0QA 1G8JB 4NBGD 4P1CH 1VCKA 3H1JE 3CWBE 4HM2A 4HM8A 2XR8A 1SQBE 2B1XA 1NTKE 4NBAD 4PD4E 1UUWA 4NB8D 2I7FA 1JM1A 3CX5E 1VM9A 3EQQA 4EMJB 1NU1E 4P1BH 2E74D 3GOBA 3L70E 1L0LE 1PP9E 1VF5D 3EN1A 1SQXE 2HMOA 1SQQE 1O7MA 4HKVA 2YFJA 4HM3A 1P84E 2BMRA 2YFIA 2HMMA 1UUVA 4H44D 2E76D 4HM6A 4U3FE 1SJGA 3GL0A 4AIVA 4HM0A 1O7WA 1G8KB 3D89A 3AZCA 3VMHD 4QUPA 3H1IE 1NDOA 3GB4A 2ZT9D 2XRXA 3GZXA 4NB9D 3L73E 2BMOA 1O7PA 2GBWA 2NVEA 2YIUC 4QDCA 2Q3WA 1RIEA 1ULJA 2BMQA 4HM7A 1KB9E 2XSOA 2B24A 3DQYA 1BGYE 2QJKC 4QDFA 1BE3E
chains in the Genus database with same CATH superfamily
5AEUA 1EG9A 2GUVA 3EQ2A 2POHA 1VQ4P 1L4AC 1GMJA 1N2DC 2FYUG 2ZAEB 1LTJB 2ZFCA 4HM1A 2WSSH 4M3LA 1FQTA 2M3BA 4JYBA 2V4HA 3H1JD 1NTKG 3OJAB 3II6A 3I56P 1A02F 4PD4I 2HLOA 3CXHI 1MFZA 2KZIA 4HKZH 2PRRA 5GTHH 1RF1B 1MV8A 1SQVJ 2IBZE 1GDTA 1BDCA 3LW5J 3AEGC 1SQQK 1FC2C 2XNXA 1K9MQ 2FYUE 3VMGD 3AEFC 4PV1B 2ZVNB 1L0LJ 2YNYA 4NBAD 1LWUC 2B87A 1EDKA 4P1BH 2E76B 1AJYA 1LP1B 4BRYB 4ZKPA 3MZWB 3BVHA 3H1IJ 1NU1K 1YYCA 3CCQP 3WMM0 3S4RA 3L37A 2IZ1A 4U3FE 2Y0CA 2AEFA 1IFJA 4QUPA 1JY2P 2QE7H 4AUWA 2P58A 1GU4A 2QM8A 1BCCG 3GMAA 4DCKA 1W2BO 1CSBA 4PJ0H 4RESB 3KQGA 3F89A 3QWOC 3NTNA 1JB0J 3H1JJ 5TISE 2OYHA 3A3YB 1UIXA 3HE5B 4AYCA 1VQKP 1QVFO 4NBHD 3PH0A 1EXIA 4EI2A 3MIWA 2D2CB 4PD4D 1S5LH 2NPSD 3EWKA 1VF5C 4EDFA 1AV1A 1Y9BA 3H32A 1BCCE 2KB7P 1LT9B 2B9BA 3SFDC 2XSHA 1JY3P 1PPJD 1Q81Q 1LP1A 1GU5A 3VMAA 1M1KQ 2YO3A 3RK2B 3RBZA 2P2UA 5AVQB 4WBAA 2D2CD 1T6AA 1X79B 1G8JB 1HJBA 2NRGA 2E74B 3LIEA 1CI6A 5GTIH 3EQQA 1IK7A 3JSVC 2B87B 4OGQC 1BGYJ 1FOSF 3V4QA 3NMDA 1A02J 4Y99C 2E76C 1R5SA 3GL0A 1G8KB 4LLHA 2OYIA 2XRXA 3L73E 1NTKD 3H1KG 2PP6A 1X0TA 4K3AA 3RK3D 2W83C 1SQXK 3HUSA 3KHUA 2KYVA 1KFNA 1OWAA 3CCUP 2QJYC 1S9KD 4GKGA 4EYYQ 3BRTB 2P7JA 1Q2NA 4Y28J 4PJ0E 2AEJA 2FXOA 1NU1J 2O1JA 2BCCE 4Z1MH 2M8RA 2HMNA 5TISH 1KILA 4IL6H 4H13D 2WSCH 2NVFA 4AAYB 1SQPD 4RJTA 1KTMA 4NBDD 5APXA 3CX5D 3H1KD 2GBXA 1VQNP 3VCAA 2H7HA 1T3UA 1KZUB 4UB8H 3T97B 2OQQA 1E79H 5DJTB 2QEXP 4DT0A 3L75D 2FYUJ 3VYIA 3B5NA 4NB8D 1LTAC 3H1LG 3CCVP 5AW1B 4H13B 2OYHC 3D71A 1RE3A 1L0LK 1GW3A 1YQ4C 1IFNA 4DZOA 5AW6B 5APYA 4H44C 1LGHB 1AFOA 3D89A 2H88C 2Q6QA 3H1IE 1K73Q 2E43A 2YIUC 5AVVB 2C0WA 4RO0A 2JWAA 4IFMA 4QMAA 1NTMD 3L73J 2A45G 1OMIA 1L0LD 1GTWA 2IYPA 1S9KE 4GODA 2IFNA 2WT7B 1L0NJ 1LWUA 1VQ9P 1IFPA 3L72D 3H1JG 3H1HE 2IFMA 3MHVA 3RK3C 4PV1D 1FZCB 1X22A 3G6EP 4H0LD 3H1IG 1YTZI 5AVXB 5CCGC 5AW4B 1YITP 1GL2A 2N1TB 3CXHE 3G9RA 3HE4A 2XKMA 3TSIA 1WQLA 1NTZJ 1BCCJ 5KLVJ 2A06E 5KLVK 2QVAA 3VMID 1KQSO 1G2CB 4P1CH 2HR3A 2W6AA 3H1JE 2K1AA 5CHXA 5AW2B 2AXCA 2Q7CA 1CW5A 3HTKA 3KZIH 2QM7A 3AE5C 2Y0EA 1WT6A 4HJGH 1NU1E 3L70E 3U1CA 5APQA 2FYUK 1L2PA 3CPWO 4IFFA 1NVOA 4H0LC 1FU1A 4D6TD 2CPBA 3SWFA 1NTKK 3GB4A 2R3SA 3BRVB 3L71D 1R5LA 1FZBA 3CWBD 2P1JA 1SQPJ 1VQ6P 1DD3A 4QDFA 2IBZG 1MZ9A 2QJPB 3SFEC 2E74C 3CMEP 3CCEP 2Q3IA 3TGUJ 3L72J 3W67A 2HYNA 1ZMEC 3G3ZA 3L70G 2G3AA 2FYZA 3WUTA 2WMMA 1ZLLA 3CMAP 5KAIE 4DOJA 4BRYA 3BCCG 3RBXA 2KXPB 1S5LE 2KZJA 4JYCA 1JCDA 1HGZA 2FXMA 3GL2A 2JR8A 2JO1A 2WPQA 3D6YA 1SQVK 2KS1A 1OFCX 1ZR2A 3AE2C 3H6PA 3GTEA 1SQPK 3P8CE 2ZJSE 1KQFB 1SFCA 1SQXG 1RF1A 2ZT9B 3A2AA 2O3JA 5AVUB 3TYYA 2FBWC 1SQBD 2KNCA 4WY4B 1VCKA 2FKWB 2XR8A 1NJIQ 4L75A 1NU1D 3AE4C 1YI2P 4W7ZA 1VF5D 3O6QB 3V6IA 3H1LJ 2YFJA 2Z5IA 3E1RA 5CJ4A 1HF9A 4BXLA 2WZ7A 4HM6A 1VQ8P 1ZN5A 2K37A 4HM0A 2YKPA 3JCUE 1KB9D 1ULJA 4HM7A 1YTZT 2KIKA 3HD7A 3LIDA 2N1TC 1R8EA 3KYQA 2Z5HA 1X9VA 2ITAA 1PIXA 2Y0DA 3D6ZA 1RQUA 2FYUD 1MFTA 4R4LA 3L73G 3H1KE 3VOPA 4C46A 1OW7A 1LTJC 1PGOA 3NXSA 1YJWP 3L74E 2Q3EA 1L0NE 1H8AA 1EQ7A 2AXTH 3L75E 1L0LG 2WSCJ 1SQVD 1RE4A 1J1DC 5E79E 2W90A 1IC2A 5KJ7D 3Q5RA 2JJLA 3JC22 1SQQD 1HVVA 2YMKA 2Z4EA 2K88A 3IR9A 3P8CD 2DE5D 1SQBJ 5AEWA 1SQVE 4NPDA 2WWWA 3P32A 3L35A 1G2CA 3B5ND 1RF0C 2M5AB 1N7SB 1BSHA 3C9IA 3KPEA 1ZRTD 1L0LE 1VQ5P 3EFFK 1DD4A 2K9JB 1O7MA 1PV3A 2YFIA 4ZMDA 1P84D 1VPCA 3AEAC 3MUDC 1Q90D 4NB9D 2GBWA 3ITKA 2NVEA 1RY3A 1BCCD 1NTZK 3Q2YA 2ZYDA 2RH0A 2B24A 2HODB 5APTA 1NTZG 5APSA 5KLVG 1NYKA 1M56D 2B89A 1PPJE 2O01J 3B4SA 2WT7A 3PTZA 3PRJA 2CPSA 2LXCB 2WTYA 3V2QA 1G1IA 1KILE 3PHLA 2JWDA 3RK2D 2IPPA 3W68A 3MD0A 4WY4C 3IFMA 3RGUA 3H1LE 2JO6A 1L4AA 1PGQA 2RMZA 3LW5H 1Y47A 3H1ID 2WSFH 4OGQB 2DE7D 1EDLA 3M9HA 1VQ7P 2NPSB 3CCMP 1P84I 5KLIB 3H1HG 3I5CA 1NTME 5KKZC 4C7NB 2R5BA 1HUCA 2J5UA 2C0XA 2H8PD 1WRGA 1N8RQ 5KLVD 3MP7B 3ZDMA 5KKZB 5TJHA 1O7NA 2KNCB 3AEBC 3CC4P 3N0QA 2E75B 3H1HD 1JY3N 3CCSP 2OYIC 1GL2C 4W7YA 1OVVA 2I7FA 2A06G 2E74D 4WWIA 4ASWA 1DEEG 1FS0E 1JTHB 1NKZB 4HKVA 1SFCC 3BCCJ 1P84E 1UUVA 4B86A 3B5NC 1HTLC 1NU1G 1M1JA 1M8OB 4XFJA 2IDBA 1GK6A 3QH9A 1BE3E 1H88A 2YIUB 2HG5D 5GTHE 3K5BA 4A7PA 2HPCA 3A0BE 4L73A 1Q82Q 1RF0A 3H1LD 3L36A 1Y8AA 2W27A 5KAIH 1GK4A 4HJLA 1S2EA 3FWNA 4ZNCA 1JO5A 4OVNF 5K5GB 4N78E 1VQLP 2XU6A 2WPVB 1T2KD 3CWBG 1BE3G 5KAFE 3M0DC 2QSIA 2IBZD 1NTMK 1RE4C 1ZV8A 5CMZA 5H2FH 2BCCD 3P7KA 1YQ3C 4NBGD 3AE7C 3AE9C 3VTPC 1ZOYC 5APVA 1S5LX 2KS1B 3FXDA 3GOBA 3BCCD 4C7RA 1EDIA 4NPEA 4NPFX 5AW8B 3HTKB 1K05A 4BWNA 3A0HE 2E76D 3SWYA 1FZCC 1OIPA 1L4AB 1NTMJ 2L91A 1BE3D 1Z56A 2GM4A 1FOSE 1RF1C 4JQ0D 3N7NA 1P84H 4IL6X 3HE5A 1VL2A 3KXDA 1USDA 1D7MA 3M9BA 1URQD 2WQYC 1JY3O 2LXBA 3G4SP 4QURA 4QDFB 2KSJA 3SWKA 3CL3D 4AQRD 2HMJA 2K3RA 1USEA 4N78D 1SQXD 2YXRB 2FXPA 3CCLP 4H13C 1OW6A 3H25A 2OYOA 1KN7A 1BGYG 2P67A 3HD7B 1NKNA 3VMYA 1IO4A 4I7ZC 1N7SA 2UWJE 1SFCD 4TLFA 1X8YA 5APWA 5KAFH 1RQVA 1FJKA 1L0ND 1UUWA 2E5TA 4KHXA 3EN1A 3HE4B 4GT1A 1L0NK 3TGUG 1LNQA 1XTCC 1GL2B 2W6BA 3H32B 3L75G 1NDOA 1N73A 3C8VA 4YTPC 5AW9B 3A7OA 5AVSB 5BVZA 3TGUD 2QPZA 1QVGO 1N73B 1ZW0A 2D2CC 2A45I 1GZLA 3B8EB 2QJKB 4HYTB 1OXZA 2C9LY 3GCEA 2WSFJ 4D6TE 3MGNA 3TGUE 5KLVE 2Q5UA 4HH2A 3IF4A 3L71E 1CI6B 2N1TD 3GF3A 2R5DA 2I1JA 1KYOD 1NO4A 1EDJA 1Q90C 1M90Q 4HM4A 4OWFA 1JNMA 3MUDA 3A0BH 2KP8A 4W80A 1T8ZA 4HB1A 3CWBJ 2E75D 4I1LA 1BE3J 1KYOE 2SPZA 2QA4P 1QX8A 1YBKA 4D6TG 3N4XA 2XZRA 3CI9A 5AVTB 3SSUA 3AE3C 3CC2P 1JTHA 5CJ0A 2YKOA 1GL2D 5GTIE 1EZVD 2OTLP 4WVZA 3D70A 4U3FD 1N7SC 2BMRA 3VN0A 1OVRA 2V7QJ 1SJGA 2WVRA 2L5GB 1NWQA 4ASVA 2JKVA 1YJ9P 3RK2C 2Q3WA 4EIJA 1K04A 1NTMG 1LT9C 4KJMA 2QJKC 1N7LA 2R3CA 3Q1MA 2HPCB 2DE6D 4GIFA 1J1EC 4HM5A 4YXDC 2JDIH 3HUSB 3FXEA 1FZAA 1PP9G 5KJ7A 4JPZB 4N6JA 4NBED 3GW6A 1IFDA 1FZCA 2R32A 3RL0C 3L72E 1SQPE 1KYOH 3A5TA 4TT3H 2NVGA 2LKMA 1FZEA 2OYHB 2OYIB 2ZYLA 3Q5SA 4IFDK 5AW7B 2HMKA 2OTKE 5E79H 3L71J 1M57D 1BDDA 3WU2E 5AW3B 2YO2A 1KILC 5CCHD 3G71P 3HD7D 2QG4A 1KD1Q 3KDPB 1Q7YQ 4MN4C 2Q9IA 4U7JA 3BASA 2G8YA 2FFDB 1NH4A 1FAVA 1SQPG 2Y9ZA 1KYOI 3VMZA 1ZR4A 1AQ5A 3CX5E 2E5YA 2WPSA 3M0AA 1KILD 5CCHC 5CBNA 3PJSK 1SQQE 2JEEA 1URQC 2FFDA 4HM3A 3GLMA 3M91A 3OA7A 1O7WA 1IK9A 1QGKB 2DW3A 3GZXA 3EFGA 2W6JH 2BMOA 3CCJP 2BMQA 3GF7A 1KB9I 2OTJP 3IAOA 2ZXEB 1KQLA 5AW0B 3GHGA 3E1IA 1LTTC 1FDOA 1W5CE 3R4YA 2CKFA 2NWFA 1LTBC 2NZ2A 3GKEA 3C0DA 1AA0A 4QCKA 1MUUA 2QIWA 5EFWB 2PFXA 3RL0B 4L74A 3CLQA 2AXTE 2HMLA 5B5EH 4UB8E 1SLQA 2W8ZA 1U7MA 3TF5A 1IZNB 2V7QH 1HGVA 2K9JA 4GOFA 4XA4A 1KFMA 4Y99B 3L74J 1NTKJ 5APUA 3HD7C 1ULIA 2XDJA 4CPGA 2K9YA 3UIAA 2O1KA 1KMIZ 1YHQP 1SQBE 4H0LB 3USSA 4R4MA 1JY2O 1QLED 2WITA 3VP8A 2A06D 1LTSC 1SQXE 1FE6A 2BEZF 1VQPP 4O9BA 2NPSA 4UB6H 3FGAD 3AZCA 1N86A 2CK3H 3M0DA 1SQQJ 1SS1A 3L70D 1N73C 3ABVC 1KB9E 2PGDA 1M7LA 3A0HH 1BGYE 3AE8C 2I1KA 1LT9A 3M9QA 2AEMA 5B5EE 1M1JC 1WMKA 1PZQA 2E4PA 1CZQA 3S9OA 1LT1A 2O01N 4OGQD 1FBMA 2E75C 1M1JB 4YPCA 2E42A 2KLUA 2RKLA 4NBFD 3C1LA 3FX0A 4NBCD 1FZFA 3VCPA 1XTGB 2QJPC 3RL0g 5L8RJ 3TNUA 4LC1A 1YJNP 5CXMA 4PV1C 2B88A 1L0NG 1KQGB 2MJZA 2KOGA 2BCCJ 3L71G 3O8ZA 2IBZI 2NUMA 2XV5A 2NUKA 3L4FA 4UB6E 2N1TA 5CBOA 3L73D 5AVRB 4HM8A 1NTKE 4PD4E 1SFCB 1JOCA 1NHLA 3IN6A 2KK7A 2LR2A 3RK3E 1VQOP 1JM1A 3CXHH 2KLVA 4EMJB 2NPSC 4GDOA 3P8MC 1EZVG 3CX5H 3WU2H 3MTUE 3OW2O 1JMMA 1YIJP 4H44D 3AEDC 3GHGB 5DJUB 1LTJA 4AIVA 4I7ZB 2ZT9D 3E7KA 5M1BA 2IZ0A 3PLNA 1FZGA 2M0BA 1NTZD 4C7NA 1J2JB 1NGMB 3L74D 5AVZB 1LJ2A 1LTIC 1O7HA 3BCCE 2XNDH 3H1HJ 1KC8Q 4K35A 1H0TA 1EZVE 1DIPA 4H44B 2IYOA 1J1DB 1SVFA 1NTZE 2JP3A 1URQB 1KORA 3GTSA 1PPJG 4U3FG 1EZVI 4RKUJ 1N7SD 5C39A 1T3JA 5BOKA 1AQTA 1DX7A 1PGJA 2YKQA 2ZVOB 1U57A 2WSEH 2OGUA 3T97A 4IL6E 1EC5A 1Q86Q 2YFLA 3L72G 2ZT9C 1NYHA 3L70J 2JZAA 3V4WA 1ZRTE 1JMBA 1JY2N 4WY4A 3AEEC 2H43A 1VF5B 4EOTA 4YXWH 1T2KC 1IJDB 4XE5B 1AVYA 2P10A 5AVYB 1PP9E 1URQA 2FFDC 3CX5I 1S4XA 1E5WA 5CCHA 3WUVA 1HJ0A 3TNUB 4JBZA 2HMMA 2A45H 3HRNA 1JUNA 1OVUA 1SQXJ 2GA1A 1LTGC 4QDCA 1PP9D 1DEBA 1NAFA 1SQQG 1KB9H 3DQYA 3Q3DA 2VRSA 3L74G 1H89A 1AVOA 2WSEJ 2ZXXA 5HL4A 3CXHD 1MKMA 2FYNB 3RK3B 3CD6P 2YXQB 1OZHA 3TDKA 2ZYGA 2I8DA 1FDMA 3Q5PA 1O7GA 1GW4A 1NOHA 3FWLA 2FYNC 2KI7B 4OH8B 1RH5B 3V2PA 4D6TJ 4WB4A 1SQVG 1JCCA 2H89C 2HFED 4I2LC 1HBWA 1PFIA 3VP9A 4GOEA 3FOUA 2MKVA 1S3JA 2BASA 3HUSC 4KT0J 4N3YB 4IOIH 1S1CX 3B5NB 5BU8B 4NBBD 4QDDA 2J58A 4L76A 4ZKUA 3CWBE 3KZIE 1VDFA 2B1XA 2WPRA 3WUUA 3RL0D 1BGYD 1W2EA 3O6QA 3AE6C 1EXJA 3V2RA 2Q1KA 5BU5A 5B66H 3R2PA 2IX7C 1SQBG 4JF7A 1FDIA 1KILB 1PP9J 5B66E 2N9BA 1SQBK 2O01H 1UIIA 1HH0A 4LGDE 1O7PA 2XSOA 2RN0A 3F5HA 1SP4A 1JEKA 2GUSA 5KLIC 3I55P 1QL1A 2BCCG 1K8AQ 1LWUB 3CC7P 1H0TB 1NAYA 2Y9YA 3U59A 1RFSA 1OW8A 2QRXA 1QEXA 1DH3A 3AECC 1PGPA 1BSNA 3CCRP 3S1KA 1U7JA 1IFIA 1ZP0C 1RE3C 2KUBA 5AVWB 1GD2E 3PP5A 2M5AA 1PL5A 3BATA 4U3FJ 1G1JA 2YVJB 3AE1C 2C9NY 4QUQA 2FY8A 2M3EA 3B71A 3VMXA 1JM0A 3H1KJ 2HODA 1QL2A 1RHZB 3V2NA 4WY4D 2OARA 1OX3A 2R44A 5CCGD 3L75J 3TK1A 3GZYA 3NFQA 3U1AA 1L4AD 2E4QA 5H2FE 4HM2A 3V5BA 1FJPA 2J59M 1ZXGA 1VM9A 2N9YB 1IFMA 4PD4H 2KSEA 5AW5B 5KTBA 2ZYAA 4DJGA 2HMOA 2YMYA 1J1EB 3GG2A 3M06A 1TU3F 3JCUH 5KJ7C 3VMHD 1HWTC 2PAJA 3OAKA 1KV4A 4I6MC 3GHGC 2QJYB 1S72P 1RIEA 1VQMP 2BEQD 5CCGA
chains in the Genus database with same CATH topology
5AEUA 1EG9A 1NYKA 2QPZA 1PPJE 2DE6D 1O7HA 3BCCE 5HL4A 1RFSA 2QJYC 3GCEA 4HM5A 4QURA 1EZVE 2E4PA 4NBHD 4HM1A 4D6TE 4NBED 3H1KE 4QDFB 1FQTA 1NTZE 3H1HE 3TGUE 2CKFA 2BCCE 5KLVE 3L72E 1SQPE 2NWFA 4PV1D 4OGQD 3GTSA 3GKEA 1O7GA 3L74E 1L0NE 3C0DA 2NVGA 2FYNC 3H1LE 2JO6A 2HMJA 3L71E 4HJLA 3L75E 4NBFD 4QCKA 2ZYLA 4NBCD 4H0LD 2HMKA 2HMNA 5BOKA 2HMLA 1Q90C 3VCPA 1BCCE 2DE7D 2YVJB 2QJPC 4H13D 4HM4A 3GL2A 2NVFA 4QUQA 4AAYB 1NTME 3CXHE 5CXMA 2YFLA 2XSHA 5KKZC 5KLIC 2IBZE 1WQLA 3FOUA 4NBDD 2JZAA 2DE5D 2E75D 2A06E 2NUMA 1ZRTE 2NUKA 2FYUE 1KYOE 5AEWA 3GTEA 2GBXA 3VMID 3VCAA 1SQVE 4NBBD 4QDDA 3VMGD 3GZYA 1ULIA 2D2CD 1O7NA 2E4QA 3N0QA 1G8JB 4NBGD 4P1CH 1VCKA 3H1JE 3CWBE 4HM2A 4HM8A 2XR8A 1SQBE 2B1XA 1NTKE 4NBAD 4PD4E 1UUWA 4NB8D 2I7FA 1JM1A 3CX5E 1VM9A 3EQQA 4EMJB 1NU1E 4P1BH 2E74D 3GOBA 3L70E 1L0LE 1PP9E 1VF5D 3EN1A 1SQXE 2HMOA 1SQQE 1O7MA 4HKVA 2YFJA 4HM3A 1P84E 2BMRA 2YFIA 2HMMA 1UUVA 4H44D 2E76D 4HM6A 4U3FE 1SJGA 3GL0A 4AIVA 4HM0A 1O7WA 1G8KB 3D89A 3AZCA 3VMHD 4QUPA 3H1IE 1NDOA 3GB4A 2ZT9D 2XRXA 3GZXA 4NB9D 3L73E 2BMOA 1O7PA 2GBWA 2NVEA 2YIUC 4QDCA 2Q3WA 1RIEA 1ULJA 2BMQA 4HM7A 1KB9E 2XSOA 2B24A 3DQYA 1BGYE 2QJKC 4QDFA 1BE3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEU A;  1EG9 A;  1NYK A;  2QPZ A;  1PPJ E;  2DE6 D;  1O7H A;  3BCC E;  5HL4 A;  1RFS A;  2QJY C;  3GCE A;  4HM5 A;  4QUR A;  1EZV E;  2E4P A;  4NBH D;  4HM1 A;  4D6T E;  4NBE D;  3H1K E;  4QDF B;  1FQT A;  1NTZ E;  3H1H E;  3TGU E;  2CKF A;  2BCC E;  5KLV E;  3L72 E;  1SQP E;  2NWF A;  4PV1 D;  4OGQ D;  3GTS A;  3GKE A;  1O7G A;  3L74 E;  1L0N E;  3C0D A;  2NVG A;  2FYN C;  3H1L E;  2JO6 A;  2HMJ A;  3L71 E;  4HJL A;  3L75 E;  4NBF D;  4QCK A;  2ZYL A;  4NBC D;  4H0L D;  2HMK A;  2HMN A;  5BOK A;  2HML A;  1Q90 C;  3VCP A;  1BCC E;  2DE7 D;  2YVJ B;  2QJP C;  4H13 D;  4HM4 A;  3GL2 A;  2NVF A;  4QUQ A;  4AAY B;  1NTM E;  3CXH E;  5CXM A;  2YFL A;  2XSH A;  5KKZ C;  5KLI C;  2IBZ E;  1WQL A;  3FOU A;  4NBD D;  2JZA A;  2DE5 D;  2E75 D;  2A06 E;  2NUM A;  1ZRT E;  2NUK A;  2FYU E;  1KYO E;  5AEW A;  3GTE A;  2GBX A;  3VMI D;  3VCA A;  1SQV E;  4NBB D;  4QDD A;  3VMG D;  3GZY A;  1ULI A;  2D2C D;  1O7N A;  2E4Q A;  3N0Q A;  1G8J B;  4NBG D;  4P1C H;  1VCK A;  3H1J E;  3CWB E;  4HM2 A;  4HM8 A;  2XR8 A;  1SQB E;  2B1X A;  1NTK E;  4NBA D;  4PD4 E;  1UUW A;  4NB8 D;  2I7F A;  1JM1 A;  3CX5 E;  1VM9 A;  3EQQ A;  4EMJ B;  1NU1 E;  4P1B H;  2E74 D;  3GOB A;  3L70 E;  1L0L E;  1PP9 E;  1VF5 D;  3EN1 A;  1SQX E;  2HMO A;  1SQQ E;  1O7M A;  4HKV A;  2YFJ A;  4HM3 A;  1P84 E;  2BMR A;  2YFI A;  2HMM A;  1UUV A;  4H44 D;  2E76 D;  4HM6 A;  4U3F E;  1SJG A;  3GL0 A;  4AIV A;  4HM0 A;  1O7W A;  1G8K B;  3D89 A;  3AZC A;  3VMH D;  4QUP A;  3H1I E;  1NDO A;  3GB4 A;  2ZT9 D;  2XRX A;  3GZX A;  4NB9 D;  3L73 E;  2BMO A;  1O7P A;  2GBW A;  2NVE A;  2YIU C;  4QDC A;  2Q3W A;  1RIE A;  1ULJ A;  2BMQ A;  4HM7 A;  1KB9 E;  2XSO A;  2B24 A;  3DQY A;  1BGY E;  2QJK C;  4QDF A;  1BE3 E; 
#chains in the Genus database with same CATH topology
 5AEU A;  1EG9 A;  2GUV A;  3EQ2 A;  2POH A;  1VQ4 P;  1L4A C;  1GMJ A;  1N2D C;  2FYU G;  2ZAE B;  1LTJ B;  2ZFC A;  4HM1 A;  2WSS H;  4M3L A;  1FQT A;  2M3B A;  4JYB A;  2V4H A;  3H1J D;  1NTK G;  3OJA B;  3II6 A;  3I56 P;  1A02 F;  4PD4 I;  2HLO A;  3CXH I;  1MFZ A;  2KZI A;  4HKZ H;  2PRR A;  5GTH H;  1RF1 B;  1MV8 A;  1SQV J;  2IBZ E;  1GDT A;  1BDC A;  3LW5 J;  3AEG C;  1SQQ K;  1FC2 C;  2XNX A;  1K9M Q;  2FYU E;  3VMG D;  3AEF C;  4PV1 B;  2ZVN B;  1L0L J;  2YNY A;  4NBA D;  1LWU C;  2B87 A;  1EDK A;  4P1B H;  2E76 B;  1AJY A;  1LP1 B;  4BRY B;  4ZKP A;  3MZW B;  3BVH A;  3H1I J;  1NU1 K;  1YYC A;  3CCQ P;  3WMM 0;  3S4R A;  3L37 A;  2IZ1 A;  4U3F E;  2Y0C A;  2AEF A;  1IFJ A;  4QUP A;  1JY2 P;  2QE7 H;  4AUW A;  2P58 A;  1GU4 A;  2QM8 A;  1BCC G;  3GMA A;  4DCK A;  1W2B O;  1CSB A;  4PJ0 H;  4RES B;  3KQG A;  3F89 A;  3QWO C;  3NTN A;  1JB0 J;  3H1J J;  5TIS E;  2OYH A;  3A3Y B;  1UIX A;  3HE5 B;  4AYC A;  1VQK P;  1QVF O;  4NBH D;  3PH0 A;  1EXI A;  4EI2 A;  3MIW A;  2D2C B;  4PD4 D;  1S5L H;  2NPS D;  3EWK A;  1VF5 C;  4EDF A;  1AV1 A;  1Y9B A;  3H32 A;  1BCC E;  2KB7 P;  1LT9 B;  2B9B A;  3SFD C;  2XSH A;  1JY3 P;  1PPJ D;  1Q81 Q;  1LP1 A;  1GU5 A;  3VMA A;  1M1K Q;  2YO3 A;  3RK2 B;  3RBZ A;  2P2U A;  5AVQ B;  4WBA A;  2D2C D;  1T6A A;  1X79 B;  1G8J B;  1HJB A;  2NRG A;  2E74 B;  3LIE A;  1CI6 A;  5GTI H;  3EQQ A;  1IK7 A;  3JSV C;  2B87 B;  4OGQ C;  1BGY J;  1FOS F;  3V4Q A;  3NMD A;  1A02 J;  4Y99 C;  2E76 C;  1R5S A;  3GL0 A;  1G8K B;  4LLH A;  2OYI A;  2XRX A;  3L73 E;  1NTK D;  3H1K G;  2PP6 A;  1X0T A;  4K3A A;  3RK3 D;  2W83 C;  1SQX K;  3HUS A;  3KHU A;  2KYV A;  1KFN A;  1OWA A;  3CCU P;  2QJY C;  1S9K D;  4GKG A;  4EYY Q;  3BRT B;  2P7J A;  1Q2N A;  4Y28 J;  4PJ0 E;  2AEJ A;  2FXO A;  1NU1 J;  2O1J A;  2BCC E;  4Z1M H;  2M8R A;  2HMN A;  5TIS H;  1KIL A;  4IL6 H;  4H13 D;  2WSC H;  2NVF A;  4AAY B;  1SQP D;  4RJT A;  1KTM A;  4NBD D;  5APX A;  3CX5 D;  3H1K D;  2GBX A;  1VQN P;  3VCA A;  2H7H A;  1T3U A;  1KZU B;  4UB8 H;  3T97 B;  2OQQ A;  1E79 H;  5DJT B;  2QEX P;  4DT0 A;  3L75 D;  2FYU J;  3VYI A;  3B5N A;  4NB8 D;  1LTA C;  3H1L G;  3CCV P;  5AW1 B;  4H13 B;  2OYH C;  3D71 A;  1RE3 A;  1L0L K;  1GW3 A;  1YQ4 C;  1IFN A;  4DZO A;  5AW6 B;  5APY A;  4H44 C;  1LGH B;  1AFO A;  3D89 A;  2H88 C;  2Q6Q A;  3H1I E;  1K73 Q;  2E43 A;  2YIU C;  5AVV B;  2C0W A;  4RO0 A;  2JWA A;  4IFM A;  4QMA A;  1NTM D;  3L73 J;  2A45 G;  1OMI A;  1L0L D;  1GTW A;  2IYP A;  1S9K E;  4GOD A;  2IFN A;  2WT7 B;  1L0N J;  1LWU A;  1VQ9 P;  1IFP A;  3L72 D;  3H1J G;  3H1H E;  2IFM A;  3MHV A;  3RK3 C;  4PV1 D;  1FZC B;  1X22 A;  3G6E P;  4H0L D;  3H1I G;  1YTZ I;  5AVX B;  5CCG C;  5AW4 B;  1YIT P;  1GL2 A;  2N1T B;  3CXH E;  3G9R A;  3HE4 A;  2XKM A;  3TSI A;  1WQL A;  1NTZ J;  1BCC J;  5KLV J;  2A06 E;  5KLV K;  2QVA A;  3VMI D;  1KQS O;  1G2C B;  4P1C H;  2HR3 A;  2W6A A;  3H1J E;  2K1A A;  5CHX A;  5AW2 B;  2AXC A;  2Q7C A;  1CW5 A;  3HTK A;  3KZI H;  2QM7 A;  3AE5 C;  2Y0E A;  1WT6 A;  4HJG H;  1NU1 E;  3L70 E;  3U1C A;  5APQ A;  2FYU K;  1L2P A;  3CPW O;  4IFF A;  1NVO A;  4H0L C;  1FU1 A;  4D6T D;  2CPB A;  3SWF A;  1NTK K;  3GB4 A;  2R3S A;  3BRV B;  3L71 D;  1R5L A;  1FZB A;  3CWB D;  2P1J A;  1SQP J;  1VQ6 P;  1DD3 A;  4QDF A;  2IBZ G;  1MZ9 A;  2QJP B;  3SFE C;  2E74 C;  3CME P;  3CCE P;  2Q3I A;  3TGU J;  3L72 J;  3W67 A;  2HYN A;  1ZME C;  3G3Z A;  3L70 G;  2G3A A;  2FYZ A;  3WUT A;  2WMM A;  1ZLL A;  3CMA P;  5KAI E;  4DOJ A;  4BRY A;  3BCC G;  3RBX A;  2KXP B;  1S5L E;  2KZJ A;  4JYC A;  1JCD A;  1HGZ A;  2FXM A;  3GL2 A;  2JR8 A;  2JO1 A;  2WPQ A;  3D6Y A;  1SQV K;  2KS1 A;  1OFC X;  1ZR2 A;  3AE2 C;  3H6P A;  3GTE A;  1SQP K;  3P8C E;  2ZJS E;  1KQF B;  1SFC A;  1SQX G;  1RF1 A;  2ZT9 B;  3A2A A;  2O3J A;  5AVU B;  3TYY A;  2FBW C;  1SQB D;  2KNC A;  4WY4 B;  1VCK A;  2FKW B;  2XR8 A;  1NJI Q;  4L75 A;  1NU1 D;  3AE4 C;  1YI2 P;  4W7Z A;  1VF5 D;  3O6Q B;  3V6I A;  3H1L J;  2YFJ A;  2Z5I A;  3E1R A;  5CJ4 A;  1HF9 A;  4BXL A;  2WZ7 A;  4HM6 A;  1VQ8 P;  1ZN5 A;  2K37 A;  4HM0 A;  2YKP A;  3JCU E;  1KB9 D;  1ULJ A;  4HM7 A;  1YTZ T;  2KIK A;  3HD7 A;  3LID A;  2N1T C;  1R8E A;  3KYQ A;  2Z5H A;  1X9V A;  2ITA A;  1PIX A;  2Y0D A;  3D6Z A;  1RQU A;  2FYU D;  1MFT A;  4R4L A;  3L73 G;  3H1K E;  3VOP A;  4C46 A;  1OW7 A;  1LTJ C;  1PGO A;  3NXS A;  1YJW P;  3L74 E;  2Q3E A;  1L0N E;  1H8A A;  1EQ7 A;  2AXT H;  3L75 E;  1L0L G;  2WSC J;  1SQV D;  1RE4 A;  1J1D C;  5E79 E;  2W90 A;  1IC2 A;  5KJ7 D;  3Q5R A;  2JJL A;  3JC2 2;  1SQQ D;  1HVV A;  2YMK A;  2Z4E A;  2K88 A;  3IR9 A;  3P8C D;  2DE5 D;  1SQB J;  5AEW A;  1SQV E;  4NPD A;  2WWW A;  3P32 A;  3L35 A;  1G2C A;  3B5N D;  1RF0 C;  2M5A B;  1N7S B;  1BSH A;  3C9I A;  3KPE A;  1ZRT D;  1L0L E;  1VQ5 P;  3EFF K;  1DD4 A;  2K9J B;  1O7M A;  1PV3 A;  2YFI A;  4ZMD A;  1P84 D;  1VPC A;  3AEA C;  3MUD C;  1Q90 D;  4NB9 D;  2GBW A;  3ITK A;  2NVE A;  1RY3 A;  1BCC D;  1NTZ K;  3Q2Y A;  2ZYD A;  2RH0 A;  2B24 A;  2HOD B;  5APT A;  1NTZ G;  5APS A;  5KLV G;  1NYK A;  1M56 D;  2B89 A;  1PPJ E;  2O01 J;  3B4S A;  2WT7 A;  3PTZ A;  3PRJ A;  2CPS A;  2LXC B;  2WTY A;  3V2Q A;  1G1I A;  1KIL E;  3PHL A;  2JWD A;  3RK2 D;  2IPP A;  3W68 A;  3MD0 A;  4WY4 C;  3IFM A;  3RGU A;  3H1L E;  2JO6 A;  1L4A A;  1PGQ A;  2RMZ A;  3LW5 H;  1Y47 A;  3H1I D;  2WSF H;  4OGQ B;  2DE7 D;  1EDL A;  3M9H A;  1VQ7 P;  2NPS B;  3CCM P;  1P84 I;  5KLI B;  3H1H G;  3I5C A;  1NTM E;  5KKZ C;  4C7N B;  2R5B A;  1HUC A;  2J5U A;  2C0X A;  2H8P D;  1WRG A;  1N8R Q;  5KLV D;  3MP7 B;  3ZDM A;  5KKZ B;  5TJH A;  1O7N A;  2KNC B;  3AEB C;  3CC4 P;  3N0Q A;  2E75 B;  3H1H D;  1JY3 N;  3CCS P;  2OYI C;  1GL2 C;  4W7Y A;  1OVV A;  2I7F A;  2A06 G;  2E74 D;  4WWI A;  4ASW A;  1DEE G;  1FS0 E;  1JTH B;  1NKZ B;  4HKV A;  1SFC C;  3BCC J;  1P84 E;  1UUV A;  4B86 A;  3B5N C;  1HTL C;  1NU1 G;  1M1J A;  1M8O B;  4XFJ A;  2IDB A;  1GK6 A;  3QH9 A;  1BE3 E;  1H88 A;  2YIU B;  2HG5 D;  5GTH E;  3K5B A;  4A7P A;  2HPC A;  3A0B E;  4L73 A;  1Q82 Q;  1RF0 A;  3H1L D;  3L36 A;  1Y8A A;  2W27 A;  5KAI H;  1GK4 A;  4HJL A;  1S2E A;  3FWN A;  4ZNC A;  1JO5 A;  4OVN F;  5K5G B;  4N78 E;  1VQL P;  2XU6 A;  2WPV B;  1T2K D;  3CWB G;  1BE3 G;  5KAF E;  3M0D C;  2QSI A;  2IBZ D;  1NTM K;  1RE4 C;  1ZV8 A;  5CMZ A;  5H2F H;  2BCC D;  3P7K A;  1YQ3 C;  4NBG D;  3AE7 C;  3AE9 C;  3VTP C;  1ZOY C;  5APV A;  1S5L X;  2KS1 B;  3FXD A;  3GOB A;  3BCC D;  4C7R A;  1EDI A;  4NPE A;  4NPF X;  5AW8 B;  3HTK B;  1K05 A;  4BWN A;  3A0H E;  2E76 D;  3SWY A;  1FZC C;  1OIP A;  1L4A B;  1NTM J;  2L91 A;  1BE3 D;  1Z56 A;  2GM4 A;  1FOS E;  1RF1 C;  4JQ0 D;  3N7N A;  1P84 H;  4IL6 X;  3HE5 A;  1VL2 A;  3KXD A;  1USD A;  1D7M A;  3M9B A;  1URQ D;  2WQY C;  1JY3 O;  2LXB A;  3G4S P;  4QUR A;  4QDF B;  2KSJ A;  3SWK A;  3CL3 D;  4AQR D;  2HMJ A;  2K3R A;  1USE A;  4N78 D;  1SQX D;  2YXR B;  2FXP A;  3CCL P;  4H13 C;  1OW6 A;  3H25 A;  2OYO A;  1KN7 A;  1BGY G;  2P67 A;  3HD7 B;  1NKN A;  3VMY A;  1IO4 A;  4I7Z C;  1N7S A;  2UWJ E;  1SFC D;  4TLF A;  1X8Y A;  5APW A;  5KAF H;  1RQV A;  1FJK A;  1L0N D;  1UUW A;  2E5T A;  4KHX A;  3EN1 A;  3HE4 B;  4GT1 A;  1L0N K;  3TGU G;  1LNQ A;  1XTC C;  1GL2 B;  2W6B A;  3H32 B;  3L75 G;  1NDO A;  1N73 A;  3C8V A;  4YTP C;  5AW9 B;  3A7O A;  5AVS B;  5BVZ A;  3TGU D;  2QPZ A;  1QVG O;  1N73 B;  1ZW0 A;  2D2C C;  2A45 I;  1GZL A;  3B8E B;  2QJK B;  4HYT B;  1OXZ A;  2C9L Y;  3GCE A;  2WSF J;  4D6T E;  3MGN A;  3TGU E;  5KLV E;  2Q5U A;  4HH2 A;  3IF4 A;  3L71 E;  1CI6 B;  2N1T D;  3GF3 A;  2R5D A;  2I1J A;  1KYO D;  1NO4 A;  1EDJ A;  1Q90 C;  1M90 Q;  4HM4 A;  4OWF A;  1JNM A;  3MUD A;  3A0B H;  2KP8 A;  4W80 A;  1T8Z A;  4HB1 A;  3CWB J;  2E75 D;  4I1L A;  1BE3 J;  1KYO E;  2SPZ A;  2QA4 P;  1QX8 A;  1YBK A;  4D6T G;  3N4X A;  2XZR A;  3CI9 A;  5AVT B;  3SSU A;  3AE3 C;  3CC2 P;  1JTH A;  5CJ0 A;  2YKO A;  1GL2 D;  5GTI E;  1EZV D;  2OTL P;  4WVZ A;  3D70 A;  4U3F D;  1N7S C;  2BMR A;  3VN0 A;  1OVR A;  2V7Q J;  1SJG A;  2WVR A;  2L5G B;  1NWQ A;  4ASV A;  2JKV A;  1YJ9 P;  3RK2 C;  2Q3W A;  4EIJ A;  1K04 A;  1NTM G;  1LT9 C;  4KJM A;  2QJK C;  1N7L A;  2R3C A;  3Q1M A;  2HPC B;  2DE6 D;  4GIF A;  1J1E C;  4HM5 A;  4YXD C;  2JDI H;  3HUS B;  3FXE A;  1FZA A;  1PP9 G;  5KJ7 A;  4JPZ B;  4N6J A;  4NBE D;  3GW6 A;  1IFD A;  1FZC A;  2R32 A;  3RL0 C;  3L72 E;  1SQP E;  1KYO H;  3A5T A;  4TT3 H;  2NVG A;  2LKM A;  1FZE A;  2OYH B;  2OYI B;  2ZYL A;  3Q5S A;  4IFD K;  5AW7 B;  2HMK A;  2OTK E;  5E79 H;  3L71 J;  1M57 D;  1BDD A;  3WU2 E;  5AW3 B;  2YO2 A;  1KIL C;  5CCH D;  3G71 P;  3HD7 D;  2QG4 A;  1KD1 Q;  3KDP B;  1Q7Y Q;  4MN4 C;  2Q9I A;  4U7J A;  3BAS A;  2G8Y A;  2FFD B;  1NH4 A;  1FAV A;  1SQP G;  2Y9Z A;  1KYO I;  3VMZ A;  1ZR4 A;  1AQ5 A;  3CX5 E;  2E5Y A;  2WPS A;  3M0A A;  1KIL D;  5CCH C;  5CBN A;  3PJS K;  1SQQ E;  2JEE A;  1URQ C;  2FFD A;  4HM3 A;  3GLM A;  3M91 A;  3OA7 A;  1O7W A;  1IK9 A;  1QGK B;  2DW3 A;  3GZX A;  3EFG A;  2W6J H;  2BMO A;  3CCJ P;  2BMQ A;  3GF7 A;  1KB9 I;  2OTJ P;  3IAO A;  2ZXE B;  1KQL A;  5AW0 B;  3GHG A;  3E1I A;  1LTT C;  1FDO A;  1W5C E;  3R4Y A;  2CKF A;  2NWF A;  1LTB C;  2NZ2 A;  3GKE A;  3C0D A;  1AA0 A;  4QCK A;  1MUU A;  2QIW A;  5EFW B;  2PFX A;  3RL0 B;  4L74 A;  3CLQ A;  2AXT E;  2HML A;  5B5E H;  4UB8 E;  1SLQ A;  2W8Z A;  1U7M A;  3TF5 A;  1IZN B;  2V7Q H;  1HGV A;  2K9J A;  4GOF A;  4XA4 A;  1KFM A;  4Y99 B;  3L74 J;  1NTK J;  5APU A;  3HD7 C;  1ULI A;  2XDJ A;  4CPG A;  2K9Y A;  3UIA A;  2O1K A;  1KMI Z;  1YHQ P;  1SQB E;  4H0L B;  3USS A;  4R4M A;  1JY2 O;  1QLE D;  2WIT A;  3VP8 A;  2A06 D;  1LTS C;  1SQX E;  1FE6 A;  2BEZ F;  1VQP P;  4O9B A;  2NPS A;  4UB6 H;  3FGA D;  3AZC A;  1N86 A;  2CK3 H;  3M0D A;  1SQQ J;  1SS1 A;  3L70 D;  1N73 C;  3ABV C;  1KB9 E;  2PGD A;  1M7L A;  3A0H H;  1BGY E;  3AE8 C;  2I1K A;  1LT9 A;  3M9Q A;  2AEM A;  5B5E E;  1M1J C;  1WMK A;  1PZQ A;  2E4P A;  1CZQ A;  3S9O A;  1LT1 A;  2O01 N;  4OGQ D;  1FBM A;  2E75 C;  1M1J B;  4YPC A;  2E42 A;  2KLU A;  2RKL A;  4NBF D;  3C1L A;  3FX0 A;  4NBC D;  1FZF A;  3VCP A;  1XTG B;  2QJP C;  3RL0 g;  5L8R J;  3TNU A;  4LC1 A;  1YJN P;  5CXM A;  4PV1 C;  2B88 A;  1L0N G;  1KQG B;  2MJZ A;  2KOG A;  2BCC J;  3L71 G;  3O8Z A;  2IBZ I;  2NUM A;  2XV5 A;  2NUK A;  3L4F A;  4UB6 E;  2N1T A;  5CBO A;  3L73 D;  5AVR B;  4HM8 A;  1NTK E;  4PD4 E;  1SFC B;  1JOC A;  1NHL A;  3IN6 A;  2KK7 A;  2LR2 A;  3RK3 E;  1VQO P;  1JM1 A;  3CXH H;  2KLV A;  4EMJ B;  2NPS C;  4GDO A;  3P8M C;  1EZV G;  3CX5 H;  3WU2 H;  3MTU E;  3OW2 O;  1JMM A;  1YIJ P;  4H44 D;  3AED C;  3GHG B;  5DJU B;  1LTJ A;  4AIV A;  4I7Z B;  2ZT9 D;  3E7K A;  5M1B A;  2IZ0 A;  3PLN A;  1FZG A;  2M0B A;  1NTZ D;  4C7N A;  1J2J B;  1NGM B;  3L74 D;  5AVZ B;  1LJ2 A;  1LTI C;  1O7H A;  3BCC E;  2XND H;  3H1H J;  1KC8 Q;  4K35 A;  1H0T A;  1EZV E;  1DIP A;  4H44 B;  2IYO A;  1J1D B;  1SVF A;  1NTZ E;  2JP3 A;  1URQ B;  1KOR A;  3GTS A;  1PPJ G;  4U3F G;  1EZV I;  4RKU J;  1N7S D;  5C39 A;  1T3J A;  5BOK A;  1AQT A;  1DX7 A;  1PGJ A;  2YKQ A;  2ZVO B;  1U57 A;  2WSE H;  2OGU A;  3T97 A;  4IL6 E;  1EC5 A;  1Q86 Q;  2YFL A;  3L72 G;  2ZT9 C;  1NYH A;  3L70 J;  2JZA A;  3V4W A;  1ZRT E;  1JMB A;  1JY2 N;  4WY4 A;  3AEE C;  2H43 A;  1VF5 B;  4EOT A;  4YXW H;  1T2K C;  1IJD B;  4XE5 B;  1AVY A;  2P10 A;  5AVY B;  1PP9 E;  1URQ A;  2FFD C;  3CX5 I;  1S4X A;  1E5W A;  5CCH A;  3WUV A;  1HJ0 A;  3TNU B;  4JBZ A;  2HMM A;  2A45 H;  3HRN A;  1JUN A;  1OVU A;  1SQX J;  2GA1 A;  1LTG C;  4QDC A;  1PP9 D;  1DEB A;  1NAF A;  1SQQ G;  1KB9 H;  3DQY A;  3Q3D A;  2VRS A;  3L74 G;  1H89 A;  1AVO A;  2WSE J;  2ZXX A;  5HL4 A;  3CXH D;  1MKM A;  2FYN B;  3RK3 B;  3CD6 P;  2YXQ B;  1OZH A;  3TDK A;  2ZYG A;  2I8D A;  1FDM A;  3Q5P A;  1O7G A;  1GW4 A;  1NOH A;  3FWL A;  2FYN C;  2KI7 B;  4OH8 B;  1RH5 B;  3V2P A;  4D6T J;  4WB4 A;  1SQV G;  1JCC A;  2H89 C;  2HFE D;  4I2L C;  1HBW A;  1PFI A;  3VP9 A;  4GOE A;  3FOU A;  2MKV A;  1S3J A;  2BAS A;  3HUS C;  4KT0 J;  4N3Y B;  4IOI H;  1S1C X;  3B5N B;  5BU8 B;  4NBB D;  4QDD A;  2J58 A;  4L76 A;  4ZKU A;  3CWB E;  3KZI E;  1VDF A;  2B1X A;  2WPR A;  3WUU A;  3RL0 D;  1BGY D;  1W2E A;  3O6Q A;  3AE6 C;  1EXJ A;  3V2R A;  2Q1K A;  5BU5 A;  5B66 H;  3R2P A;  2IX7 C;  1SQB G;  4JF7 A;  1FDI A;  1KIL B;  1PP9 J;  5B66 E;  2N9B A;  1SQB K;  2O01 H;  1UII A;  1HH0 A;  4LGD E;  1O7P A;  2XSO A;  2RN0 A;  3F5H A;  1SP4 A;  1JEK A;  2GUS A;  5KLI C;  3I55 P;  1QL1 A;  2BCC G;  1K8A Q;  1LWU B;  3CC7 P;  1H0T B;  1NAY A;  2Y9Y A;  3U59 A;  1RFS A;  1OW8 A;  2QRX A;  1QEX A;  1DH3 A;  3AEC C;  1PGP A;  1BSN A;  3CCR P;  3S1K A;  1U7J A;  1IFI A;  1ZP0 C;  1RE3 C;  2KUB A;  5AVW B;  1GD2 E;  3PP5 A;  2M5A A;  1PL5 A;  3BAT A;  4U3F J;  1G1J A;  2YVJ B;  3AE1 C;  2C9N Y;  4QUQ A;  2FY8 A;  2M3E A;  3B71 A;  3VMX A;  1JM0 A;  3H1K J;  2HOD A;  1QL2 A;  1RHZ B;  3V2N A;  4WY4 D;  2OAR A;  1OX3 A;  2R44 A;  5CCG D;  3L75 J;  3TK1 A;  3GZY A;  3NFQ A;  3U1A A;  1L4A D;  2E4Q A;  5H2F E;  4HM2 A;  3V5B A;  1FJP A;  2J59 M;  1ZXG A;  1VM9 A;  2N9Y B;  1IFM A;  4PD4 H;  2KSE A;  5AW5 B;  5KTB A;  2ZYA A;  4DJG A;  2HMO A;  2YMY A;  1J1E B;  3GG2 A;  3M06 A;  1TU3 F;  3JCU H;  5KJ7 C;  3VMH D;  1HWT C;  2PAJ A;  3OAK A;  1KV4 A;  4I6M C;  3GHG C;  2QJY B;  1S72 P;  1RIE A;  1VQM P;  2BEQ D;  5CCG A; 
#chains in the Genus database with same CATH homology
 5AEU A;  1EG9 A;  1NYK A;  2QPZ A;  1PPJ E;  2DE6 D;  1O7H A;  3BCC E;  5HL4 A;  1RFS A;  2QJY C;  3GCE A;  4HM5 A;  4QUR A;  1EZV E;  2E4P A;  4NBH D;  4HM1 A;  4D6T E;  4NBE D;  3H1K E;  4QDF B;  1FQT A;  1NTZ E;  3H1H E;  3TGU E;  2CKF A;  2BCC E;  5KLV E;  3L72 E;  1SQP E;  2NWF A;  4PV1 D;  4OGQ D;  3GTS A;  3GKE A;  1O7G A;  3L74 E;  1L0N E;  3C0D A;  2NVG A;  2FYN C;  3H1L E;  2JO6 A;  2HMJ A;  3L71 E;  4HJL A;  3L75 E;  4NBF D;  4QCK A;  2ZYL A;  4NBC D;  4H0L D;  2HMK A;  2HMN A;  5BOK A;  2HML A;  1Q90 C;  3VCP A;  1BCC E;  2DE7 D;  2YVJ B;  2QJP C;  4H13 D;  4HM4 A;  3GL2 A;  2NVF A;  4QUQ A;  4AAY B;  1NTM E;  3CXH E;  5CXM A;  2YFL A;  2XSH A;  5KKZ C;  5KLI C;  2IBZ E;  1WQL A;  3FOU A;  4NBD D;  2JZA A;  2DE5 D;  2E75 D;  2A06 E;  2NUM A;  1ZRT E;  2NUK A;  2FYU E;  1KYO E;  5AEW A;  3GTE A;  2GBX A;  3VMI D;  3VCA A;  1SQV E;  4NBB D;  4QDD A;  3VMG D;  3GZY A;  1ULI A;  2D2C D;  1O7N A;  2E4Q A;  3N0Q A;  1G8J B;  4NBG D;  4P1C H;  1VCK A;  3H1J E;  3CWB E;  4HM2 A;  4HM8 A;  2XR8 A;  1SQB E;  2B1X A;  1NTK E;  4NBA D;  4PD4 E;  1UUW A;  4NB8 D;  2I7F A;  1JM1 A;  3CX5 E;  1VM9 A;  3EQQ A;  4EMJ B;  1NU1 E;  4P1B H;  2E74 D;  3GOB A;  3L70 E;  1L0L E;  1PP9 E;  1VF5 D;  3EN1 A;  1SQX E;  2HMO A;  1SQQ E;  1O7M A;  4HKV A;  2YFJ A;  4HM3 A;  1P84 E;  2BMR A;  2YFI A;  2HMM A;  1UUV A;  4H44 D;  2E76 D;  4HM6 A;  4U3F E;  1SJG A;  3GL0 A;  4AIV A;  4HM0 A;  1O7W A;  1G8K B;  3D89 A;  3AZC A;  3VMH D;  4QUP A;  3H1I E;  1NDO A;  3GB4 A;  2ZT9 D;  2XRX A;  3GZX A;  4NB9 D;  3L73 E;  2BMO A;  1O7P A;  2GBW A;  2NVE A;  2YIU C;  4QDC A;  2Q3W A;  1RIE A;  1ULJ A;  2BMQ A;  4HM7 A;  1KB9 E;  2XSO A;  2B24 A;  3DQY A;  1BGY E;  2QJK C;  4QDF A;  1BE3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...