1KYOE

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1kyoE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1kyoE02
2CKFA 4NBCD 2JO6A 1SQPE 1SQXE 4H13D 1O7HA 3VCPA 1SQBE 2DE6D 2E4QA 2HMMA 5KKZC 4P1BH 1FQTA 4QUPA 2XSHA 3GZYA 4NBHD 2Q3WA 2NUMA 1NU1E 1ZRTE 4AAYB 2ZYLA 3H1LE 2BMRA 4QDDA 3H1HE 2I7FA 1SJGA 4HM5A 4H0LD 2BCCE 1VM9A 2HMKA 3D89A 2QJYC 1O7PA 2BMQA 1EZVE 2NUKA 4AIVA 4HM7A 5BOKA 1O7MA 1L0NE 2B1XA 1NTME 3CX5E 2NVFA 4NBAD 3C0DA 1BE3E 2QJKC 1PPJE 2B24A 2E74D 2XR8A 2HMOA 4HM6A 1BCCE 3GZXA 2HMJA 1O7NA 1BGYE 2JZAA 2YVJB 3CWBE 2D2CD 2ZT9D 3L71E 3GTEA 1UUVA 3AZCA 4NBFD 4QCKA 4P1CH 4D6TE 2GBXA 2DE7D 1G8JB 2HMNA 3L72E 1PP9E 1O7WA 2E75D 2YFJA 3GL0A 4NBGD 3L74E 1L0LE 1Q90C 3GTSA 4HM0A 4QDFA 3EQQA 1VCKA 4OGQD 2YFLA 3N0QA 3L75E 5AEWA 1G8KB 2NWFA 2QJPC 2XSOA 4QUQA 3DQYA 3GB4A 3H1KE 4HM1A 2E76D 2FYNC 1KB9E 3H1JE 1SQVE 3TGUE 1NTZE 1UUWA 5KLIC 3VCAA 5CXMA 3FOUA 5KLVE 4NBDD 2XRXA 2NVEA 1EG9A 4HM8A 4HJLA 1ULIA 2YIUC 3H1IE 4QDCA 2NVGA 2QPZA 4U3FE 2FYUE 5HL4A 2A06E 3GL2A 1VF5D 3L73E 4H44D 4HM4A 2IBZE 3GOBA 3VMHD 3CXHE 4EMJB 1JM1A 1NDOA 3EN1A 1NTKE 4QDFB 5AEUA 3L70E 3GCEA 1NYKA 1O7GA 4HKVA 2YFIA 2HMLA 2DE5D 4HM3A 1SQQE 4PV1D 4PD4E 2E4PA 4QURA 2GBWA 3GKEA 1KYOE 3BCCE 4NB9D 1RFSA 1P84E 3VMID 3VMGD 2BMOA 1RIEA 4NBED 4NB8D 4NBBD 1ULJA 4HM2A 1WQLA
chains in the Genus database with same CATH superfamily
2YXQB 4N78D 2FYZA 2HMMA 1X8YA 2Q1KA 3FX0A 3MGNA 1PIXA 4HKZH 1YIJP 4NBHD 2FYNB 4ZKPA 1FJKA 4RKUJ 1SQXK 2FYUK 2IZ0A 1RF1A 1BCCG 1NTME 3IN6A 3B5NC 3N4XA 3AECC 3VMZA 1GZLA 1MFTA 3L71G 3A2AA 5KAFE 1LT9C 1AA0A 1KILD 1SS1A 2WSCH 3V4WA 4D6TD 3U59A 3ZDMA 2E74B 3WU2E 2H7HA 3NTNA 2GBXA 4JF7A 3M0DA 3IR9A 3NXSA 3CXHI 4QDFA 2IDBA 2KOGA 4BRYB 3RK3C 4PJ0H 2WPQA 3SFEC 5CCGD 2HODB 2R44A 4GKGA 1SQXD 1NKZB 3VN0A 2FYUD 4R4LA 2A06D 1Q81Q 3H1IE 2IBZG 4XA4A 2Q3EA 2B89A 4WB4A 3KPEA 2D2CC 3K5BA 2V7QH 1UIIA 2OYHA 2O1KA 2W6BA 1FBMA 2G3AA 1JY2N 4HM3A 1U7JA 3CX5I 3S1KA 1GW3A 3GMAA 2E4PA 2UWJE 4HB1A 1P84E 1KTMA 1RQUA 4WBAA 2E75D 4NBCD 5APWA 4YPCA 3HD7D 2E4QA 3M9BA 1KV4A 4OVNF 3H1HG 1ZRTD 1HJ0A 3TNUB 2Q3WA 4RJTA 1PGQA 5APXA 1X0TA 3G6EP 4YTPC 4H13B 5H2FE 1KILA 3H1LJ 1RHZB 2OARA 2C0XA 1PPJD 3L75G 4W80A 1IK7A 1J1DC 3AE5C 3L36A 4ASVA 2YKPA 5AW2B 4L75A 2Y0DA 2WWWA 1HWTC 5GTHE 3H1JJ 4WY4D 5CCGA 3KZIE 2OYIA 3USSA 5KKZB 3TYYA 5KAIE 3L70D 1VCKA 3B5ND 4PV1C 3N0QA 1J1EB 5AVTB 2GUSA 3RK2C 1AQ5A 1Y9BA 4OGQB 1SLQA 1EG9A 1LTAC 1VQOP 4K35A 4EOTA 1FZCC 1URQC 4C7NA 3HD7A 4XFJA 4WVZA 3BCCD 3C9IA 3FGAD 3RK3D 1X79B 1ZR2A 2L91A 3VMGD 3A0HH 1SQPE 3P8CE 2ZVNB 4H0LB 2H89C 2Z5HA 4Y99C 2NPSC 1N7SB 1QGKB 1L0NG 1VDFA 2OTLP 2WPVB 3ITKA 1DH3A 1O7PA 2IYPA 4JPZB 2POHA 4WY4A 1FZBA 1IZNB 3AE7C 4BWNA 1BCCJ 3CWBD 3U1CA 2B87B 3R4YA 3B5NA 1PP9G 1L4AC 1EDJA 1VQLP 4NBFD 3L71J 1H88A 2HMNA 2IFMA 3L72E 3AEBC 1LT9A 1UIXA 2IBZI 1L0LE 2R5BA 3GTSA 2Q6QA 1G8KB 3TGUD 4QUQA 3JCUE 3A7OA 2FYNC 1KB9E 2YKOA 1SQVE 1NTZE 4U3FD 3FXEA 3CC7P 4QDCA 1MKMA 1GDTA 1H0TB 1CW5A 2JJLA 1ZW0A 1LP1A 3BVHA 1NTMG 2R3SA 2YFIA 3GLMA 1SQQE 4PV1D 4PD4E 2E74C 3QH9A 1FE6A 4IFMA 5CBOA 2KXPB 1RIEA 2BMOA 3E7KA 3G3ZA 2P67A 3RK2D 1S72P 2I1JA 1ZOYC 4N78E 1JY2P 2ZFCA 4O9BA 2W8ZA 1EDLA 2BMRA 4GDOA 3H1HJ 1TU3F 5CCHC 2XNDH 2B1XA 2HLOA 3CMAP 2ZT9B 1NTKK 2HMOA 5B5EE 3L75J 2H43A 1VPCA 3IF4A 3H1IG 3HE5B 2NPSD 2QG4A 4D6TE 3VTPC 2QE7H 2DE7D 1Y8AA 2JKVA 1Q82Q 1N73B 3SSUA 4HM0A 2KSJA 4OH8B 2YFLA 1AJYA 2NWFA 2AXTE 1KQFB 2E76D 3Q1MA 4H13C 2BEQD 1JTHB 2ZYGA 3CCLP 1JY2O 2Y0CA 1L4AD 2QJKB 3CXHH 2FYUE 2A06E 3CXHD 2OGUA 1NTKD 1W2EA 1OW7A 1FAVA 3GW6A 1LTIC 2HG5D 1GL2B 4JYBA 1DX7A 5BU8B 1ZMEC 4GOEA 3V2PA 1Z56A 1VL2A 4HH2A 3VCPA 2DE6D 5APQA 1RH5B 5KKZC 4P1BH 4QUPA 2QM7A 3H1LD 2BCCD 1J1EC 3CX5H 2GUVA 1ZRTE 1EDIA 1JY3O 3O8ZA 3CX5D 2NPSA 4OGQC 1L0NJ 4C7RA 1PPJE 2E74D 1BGYG 1AVYA 1KFNA 5APSA 2M3EA 1R5LA 3EQ2A 2P58A 3BASA 1S2EA 2Q5UA 2P1JA 2M3BA 4M3LA 3L74G 3M9HA 1AQTA 1IO4A 5K5GB 1U7MA 1JB0J 1O7WA 1QL1A 1PP9J 1U57A 3CCQP 1PGOA 1L4AA 3AEAC 3S9OA 4H0LC 3V4QA 1NAFA 1N7SC 1RF0A 2XSOA 1KYOI 1R5SA 3DQYA 3H1KE 1SQPG 4HM1A 1ZLLA 1UUWA 4NBDD 1PV3A 2ZJSE 1YJ9P 2HYNA 3GL2A 3VMHD 2WT7A 2N9YB 1NGMB 2K1AA 4EIJA 1KFMA 1K04A 3BCCE 4NPEA 1AVOA 1GU5A 1NTMJ 3RK3E 3ABVC 2E43A 1A02F 4MN4C 4BXLA 4H13D 1LGHB 4AUWA 3CCJP 3PRJA 2ITAA 1LT1A 3T97A 1T3UA 2Q7CA 3GF7A 1M8OB 1HGVA 1YJNP 1L0LG 3D89A 2HMKA 1BE3D 4HM7A 1OW6A 1USEA 2KZJA 1BCCD 2JEEA 3VMYA 1YJWP 1JCCA 1NTZG 1NHLA 5CCHA 2HPCB 2HODA 3L71D 3I55P 4DOJA 5KTBA 2YVJB 3CWBE 2N1TB 1WMKA 2PGDA 5E79E 1NKNA 1YTZT 2RMZA 3H25A 3FXDA 3C1LA 3H1IJ 1S5LX 1G2CA 1EDKA 3RBZA 4OGQD 2W6AA 1M1JB 3TGUE 3VYIA 5AW9B 4RESB 4U3FE 1NOHA 3TNUA 2K3RA 3AE3C 2KB7P 2IBZD 1OZHA 2ZT9C 4RO0A 1LTSC 1FOSF 3GHGB 4GODA 1DEEG 3HUSB 4N6JA 3GCEA 4HYTB 2HMLA 5CMZA 5L8RJ 1N7SD 1EQ7A 4KT0J 5TISE 3B8EB 1N73C 4W7ZA 1QVFO 2GM4A 3TF5A 2QJPB 4D6TG 2V4HA 1IK9A 1T3JA 4A7PA 3H1HD 2LKMA 1VQ5P 1VM9A 2BMQA 2NUKA 1CZQA 2PAJA 1WT6A 2QJKC 2FXOA 1USDA 1QL2A 3CI9A 3AE4C 1FOSE 1BGYJ 1LTJB 3AE2C 2FYUG 1GL2C 3AZCA 2OQQA 5CJ0A 3QWOC 3P8MC 1T2KC 1LNQA 4UB6H 2YFJA 2E5YA 2M5AB 3L74J 1S9KE 1FZEA 5AEWA 2JO1A 1JY3N 2YKQA 4GT1A 2KZIA 3IFMA 1QEXA 1L0NK 1CSBA 3PLNA 2C9NY 5AW7B 1ZV8A 4DT0A 1FZFA 1SQPJ 1N7SA 2DW3A 4LLHA 5HL4A 1LTTC 3Q5PA 1XTCC 2AEFA 2AEJA 3GOBA 3CXHE 1JM1A 1NTKE 4UB8E 1FDOA 2OYHB 1Q7YQ 5B66H 2FKWB 3SWYA 3VOPA 1QVGO 2AXCA 4LGDE 2RN0A 3W68A 1DIPA 2JDIH 3FWLA 3A5TA 1OMIA 2LXBA 2R5DA 5KLVK 1NU1E 1EZVD 2WSFJ 4KJMA 2ZYLA 3H1LE 1L0ND 1SJGA 2BCCE 5EFWB 3VMAA 3L72J 3CX5E 3CC4P 5CHXA 3H32B 2O01N 1L0LJ 3H1KG 3LIDA 5BU5A 4OWFA 2AEMA 4PD4I 1G1IA 2RH0A 5AVQB 3CCMP 1W5CE 5GTIE 2WZ7A 2D2CD 1PP9D 3A3YB 1NTZJ 5C39A 3AEGC 2FFDB 4IL6E 1G8JB 1H0TA 3I56P 4NBGD 2JR8A 1H89A 1DD3A 4W7YA 2P10A 4I6MC 3E1IA 3GB4A 5KLVD 1XTGB 2Z4EA 3MIWA 2K9JB 4L76A 3L73G 1DD4A 5DJUB 2R3CA 1N2DC 1T2KD 3Q2YA 1ZR4A 3NMDA 1OWAA 3RL0g 1KYOH 2E75B 3MTUE 4C7NB 4HKVA 1KYOD 1KORA 3A0BE 2A45G 2N1TC 2YO3A 2CPBA 1MV8A 1M56D 1ULJA 2CKFA 1W2BO 3FWNA 4EI2A 1SQBE 3CWBG 3GF3A 2WQYC 3WU2H 1ZP0C 2VRSA 1VQNP 2W83C 3V2RA 1RE3C 3V2QA 2O1JA 5KLIB 1M1JC 2H88C 1N73A 4D6TJ 1O7MA 2WTYA 4NBAD 1BE3E 3B71A 1K9MQ 4WY4B 1BCCE 3TGUG 2LR2A 3GHGC 3OA7A 2QIWA 1E79H 1JTHA 1CI6B 2W90A 3HUSC 4TLFA 1URQD 4U3FG 1YHQP 2E5TA 3L71E 3WUUA 2M8RA 3V2NA 5AVWB 5AVRB 2FXMA 4AYCA 2WPRA 4N3YB 1YI2P 5APVA 2FYUJ 1M7LA 1Q90C 5BVZA 3VP9A 3OAKA 2QJPC 3PH0A 3TDKA 1MUUA 1KILE 5CXMA 2NRGA 2XRXA 1IFJA 3AEFC 2FXPA 2N9BA 1AV1A 3BRTB 5H2FH 1JY3P 3L35A 2IBZE 1FC2C 2ZYAA 2MJZA 1RE4C 3KDPB 1LP1B 1LTJC 2KK7A 3JC22 3PJSK 4NB8D 4PJ0E 2KLVA 2O01J 5GTHH 1SQXE 1EXIA 3M9QA 1M57D 1NJIQ 1OIPA 1FU1A 4DJGA 1Y47A 3KZIH 3HE4B 2IYOA 2K88A 2NUMA 2B88A 1EXJA 3BATA 3H1HE 1QLED 4L73A 3CCSP 1FZCA 1URQA 3U1AA 4IFFA 5AVSB 2C9LY 2N1TD 2B24A 1PGPA 4C46A 1FJPA 2R32A 1BGYD 1JEKA 1IFMA 4TT3H 2XZRA 1NVOA 1HH0A 3H1KJ 5CBNA 1VQ6P 2K9YA 5AVXB 1IC2A 1PFIA 1KZUB 2OYHC 3HTKB 2KNCA 2QRXA 5AVYB 3L74D 1VQKP 4DCKA 1NTKG 3RGUA 2OTKE 4YXDC 3OW2O 1J2JB 3H1JD 1HGZA 1KQLA 2QJYB 2A45I 3BCCJ 3P8CD 3CCEP 5AVZB 1NU1G 5CCHD 1JOCA 3VMXA 2BCCG 3L73J 2ZXEB 3L70E 1YQ3C 1O7GA 1X9VA 1MZ9A 1M1KQ 3CC2P 3KQGA 2GBWA 1VF5B 3VMID 4H44B 1OX3A 2FFDC 2OYOA 3O6QB 2B9BA 2HPCA 2WSFH 1S3JA 3TK1A 5CCGC 1FQTA 2Z5IA 2N1TA 1PZQA 3L37A 1NO4A 1JO5A 1WRGA 3CWBJ 5DJTB 4QDDA 4EDFA 2J59M 4LC1A 2CPSA 3WMM0 5APTA 1YBKA 1EZVE 2YIUB 5BOKA 2NZ2A 1L0NE 4QMAA 1RE3A 3UIAA 3CPWO 3JCUH 2XR8A 5AW1B 4HM6A 1M1JA 4GIFA 1IFDA 1A02J 3KXDA 1T8ZA 1T6AA 3A0HE 4WWIA 3L72G 2E75C 2JZAA 3GTEA 3TGUJ 4P1CH 4YXWH 1KN7A 1PP9E 3GHGA 4BRYA 4U3FJ 2E76B 2WSEJ 3HUSA 1SFCB 4PD4H 2RKLA 1SQVG 2YMKA 2YNYA 3F89A 1P84I 2KLUA 4JQ0D 1SQBG 3D6ZA 5KLIC 5KLVE 2H8PD 2WITA 2IPPA 3KHUA 1HJBA 2I1KA 1BSHA 4L74A 3V5BA 3SWKA 2L5GB 1SQQG 4HM4A 2KS1B 4WY4C 2I8DA 1BE3G 3SFDC 2WT7B 5B5EH 3GKEA 1KYOE 4NB9D 5AVUB 1M90Q 3CL3D 1HUCA 2KSEA 1O7HA 3L4FA 1RE4A 1LTJA 3D71A 5AW8B 1MFZA 4HJGH 3EWKA 2GA1A 4KHXA 2BEZF 2IX7C 2YO2A 2I7FA 3T97B 2O3JA 4H0LD 1LWUB 2M5AA 4U7JA 1AFOA 4NPFX 3AEEC 2AXTH 3RL0B 1YITP 2XKMA 4JYCA 3GZXA 2HMJA 1OVVA 5AW3B 1ZXGA 4I7ZB 4QCKA 3W67A 3D70A 1NWQA 1BDDA 3G71P 1OW8A 2KUBA 2M0BA 1FDMA 3L75D 1VQPP 1RF1B 1QX8A 1JM0A 1G2CB 1EC5A 1NTKJ 4ZNCA 3LW5J 1SQXG 1SP4A 2KIKA 3RBXA 2A06G 1FS0E 1ULIA 1VQ4P 4IOIH 2HR3A 4Y28J 5AW4B 3M06A 1JUNA 1FZGA 4EMJB 3N7NA 3LIEA 4QDFB 1NU1J 1YQ4C 2O01H 2BCCJ 4QURA 3H32A 1JMBA 3AE6C 4HM2A 1RQVA 3MZWB 1JNMA 2Q3IA 3V6IA 2WSSH 3GZYA 2YXRB 2FFDA 3AEDC 4AAYB 1PPJG 1K73Q 3D6YA 2QJYC 3NFQA 2QEXP 3C0DA 1DEBA 1Q2NA 2B87A 1NAYA 3H1KD 1BDCA 1KB9I 1IJDB 2G8YA 1BGYE 2J58A 2K9JA 4K3AA 2ZT9D 1UUVA 1HF9A 1H8AA 3TSIA 1VF5C 1KILB 4H44C 3MD0A 1N8RQ 1KQSO 3L70G 5M1BA 3L74E 3GG2A 1VQ9P 3KYQA 2W6JH 3CLQA 3R2PA 1NTMK 1S5LH 3H1JE 2J5UA 1SQVJ 1SVFA 2YIUC 2PP6A 5KJ7C 3H6PA 2NVGA 1SQBJ 3L73D 3CMEP 2OYIB 4JBZA 1EZVG 1OVRA 3BCCG 3MUDC 2A45H 1PL5A 1SQQJ 2Y0EA 3JSVC 1VQMP 5AEUA 3AE1C 1BE3J 4IFDK 1GD2E 1GL2D 1CI6A 2E76C 5E79H 1SFCC 2P2UA 2XSHA 2JP3A 1NH4A 3CCUP 3AE9C 3HD7B 3PP5A 3Q3DA 4HM5A 1NTMD 4AIVA 4IL6X 1RF0C 5KAFH 1Q86Q 2NVFA 4AQRD 1S4XA 1K8AQ 1KMIZ 4B86A 3Q5SA 1HBWA 5KLVG 3HE5A 5AW0B 1LTBC 1O7NA 3CCVP 3SWFA 1FDIA 1IFPA 2WSEH 3HRNA 2WSCJ 3GL0A 1OVUA 2K37A 2JWAA 4EYYQ 3EQQA 5TJHA 3B4SA 3MP7B 2XDJA 1E5WA 5TISH 1JMMA 3H1ID 3VCAA 2Y9YA 3B5NB 1R8EA 1LWUC 2NVEA 2FBWC 3P7KA 3AE8C 1GK4A 1SQXJ 3HE4A 1LT9B 1VF5D 1GL2A 4H44D 3RL0C 1BSNA 1P84H 1NDOA 2LXCB 2C0WA 5AW6B 2YMYA 3BRVB 1P84D 1K05A 1GTWA 2V7QJ 4I7ZC 4NBED 2PFXA 1WQLA 2JO6A 5APYA 5APUA 2ZXXA 3G9RA 4ZKUA 3RK3B 5KJ7D 1HVVA 1RF1C 2W27A 3HTKA 1OXZA 4DZOA 1N86A 1S9KD 3CD6P 2XU6A 3WUVA 2D2CB 3WUTA 1YTZI 2QVAA 1NU1K 1KQGB 1GU4A 1NYHA 3M0DC 2SPZA 1SFCD 5KAIH 1SQPK 2FY8A 1IFNA 2WMMA 4UB8H 3LW5H 4NPDA 3IAOA 2IZ1A 2QSIA 2MKVA 2WPSA 3L75E 2BASA 1EZVI 3L70J 1X22A 3O6QA 2Q9IA 1J1DB 2Y9ZA 5AVVB 1JCDA 2QPZA 3EFFK 3OJAB 1NU1D 4GOFA 1OFCX 4R4MA 2IFNA 1GMJA 1N7LA 3EN1A 4UB6E 5KJ7A 1LTGC 5AW5B 3CCRP 2ZAEB 4XE5B 1IFIA 2DE5D 4ZMDA 2ZYDA 3S4RA 2JWDA 1SQPD 1L0LK 5GTIH 1D7MA 2XNXA 3MUDA 1KILC 1LJ2A 4PV1B 5CJ4A 1RY3A 3H1LG 4Z1MH 4IL6H 1SQVK 3I5CA 2KP8A 1NTZK 3E1RA 3RK2B 1KD1Q 2E42A 2CK3H 1Q90D 2XV5A 2ZVOB 4CPGA 3RL0D 1SQBK 1SFCA 1FZCB 1URQB 3PHLA 4ASWA 5B66E 3H1JG 1YYCA 1SQQK 1VQ8P 3F5HA 2OYIC 1FZAA 1HTLC 3EFGA 3L72D 2QA4P 4I1LA 5KLVJ 3P32A 1L0LD 3VP8A 2KNCB 2KS1A 4I2LC 1GW4A 3A0BH 4Y99B 2NPSB 1KB9H 3C8VA 1L2PA 1KB9D 1SQVD 1NTZD 3M91A 3II6A 3PTZA 1VQ7P 3HD7C 1G1JA 3FOUA 1GK6A 1SQBD 4HM8A 4HJLA 2HFED 2OTJP 1S5LE 2QM8A 3Q5RA 3MHVA 2P7JA 1S1CX 1KC8Q 3L73E 2WVRA 1LWUA 2PRRA 1L4AB 1SQQD 4PD4D 1NYKA 2KI7B 3G4SP 1PGJA 2KYVA 1RFSA 3M0AA 4NBBD 1ZN5A
chains in the Genus database with same CATH topology
2CKFA 4NBCD 2JO6A 1SQPE 1SQXE 4H13D 1O7HA 3VCPA 1SQBE 2DE6D 2E4QA 2HMMA 5KKZC 4P1BH 1FQTA 4QUPA 2XSHA 3GZYA 4NBHD 2Q3WA 2NUMA 1NU1E 1ZRTE 4AAYB 2ZYLA 3H1LE 2BMRA 4QDDA 3H1HE 2I7FA 1SJGA 4HM5A 4H0LD 2BCCE 1VM9A 2HMKA 3D89A 2QJYC 1O7PA 2BMQA 1EZVE 2NUKA 4AIVA 4HM7A 5BOKA 1O7MA 1L0NE 2B1XA 1NTME 3CX5E 2NVFA 4NBAD 3C0DA 1BE3E 2QJKC 1PPJE 2B24A 2E74D 2XR8A 2HMOA 4HM6A 1BCCE 3GZXA 2HMJA 1O7NA 1BGYE 2JZAA 2YVJB 3CWBE 2D2CD 2ZT9D 3L71E 3GTEA 1UUVA 3AZCA 4NBFD 4QCKA 4P1CH 4D6TE 2GBXA 2DE7D 1G8JB 2HMNA 3L72E 1PP9E 1O7WA 2E75D 2YFJA 3GL0A 4NBGD 3L74E 1L0LE 1Q90C 3GTSA 4HM0A 4QDFA 3EQQA 1VCKA 4OGQD 2YFLA 3N0QA 3L75E 5AEWA 1G8KB 2NWFA 2QJPC 2XSOA 4QUQA 3DQYA 3GB4A 3H1KE 4HM1A 2E76D 2FYNC 1KB9E 3H1JE 1SQVE 3TGUE 1NTZE 1UUWA 5KLIC 3VCAA 5CXMA 3FOUA 5KLVE 4NBDD 2XRXA 2NVEA 1EG9A 4HM8A 4HJLA 1ULIA 2YIUC 3H1IE 4QDCA 2NVGA 2QPZA 4U3FE 2FYUE 5HL4A 2A06E 3GL2A 1VF5D 3L73E 4H44D 4HM4A 2IBZE 3GOBA 3VMHD 3CXHE 4EMJB 1JM1A 1NDOA 3EN1A 1NTKE 4QDFB 5AEUA 3L70E 3GCEA 1NYKA 1O7GA 4HKVA 2YFIA 2HMLA 2DE5D 4HM3A 1SQQE 4PV1D 4PD4E 2E4PA 4QURA 2GBWA 3GKEA 1KYOE 3BCCE 4NB9D 1RFSA 1P84E 3VMID 3VMGD 2BMOA 1RIEA 4NBED 4NB8D 4NBBD 1ULJA 4HM2A 1WQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKF A;  4NBC D;  2JO6 A;  1SQP E;  1SQX E;  4H13 D;  1O7H A;  3VCP A;  1SQB E;  2DE6 D;  2E4Q A;  2HMM A;  5KKZ C;  4P1B H;  1FQT A;  4QUP A;  2XSH A;  3GZY A;  4NBH D;  2Q3W A;  2NUM A;  1NU1 E;  1ZRT E;  4AAY B;  2ZYL A;  3H1L E;  2BMR A;  4QDD A;  3H1H E;  2I7F A;  1SJG A;  4HM5 A;  4H0L D;  2BCC E;  1VM9 A;  2HMK A;  3D89 A;  2QJY C;  1O7P A;  2BMQ A;  1EZV E;  2NUK A;  4AIV A;  4HM7 A;  5BOK A;  1O7M A;  1L0N E;  2B1X A;  1NTM E;  3CX5 E;  2NVF A;  4NBA D;  3C0D A;  1BE3 E;  2QJK C;  1PPJ E;  2B24 A;  2E74 D;  2XR8 A;  2HMO A;  4HM6 A;  1BCC E;  3GZX A;  2HMJ A;  1O7N A;  1BGY E;  2JZA A;  2YVJ B;  3CWB E;  2D2C D;  2ZT9 D;  3L71 E;  3GTE A;  1UUV A;  3AZC A;  4NBF D;  4QCK A;  4P1C H;  4D6T E;  2GBX A;  2DE7 D;  1G8J B;  2HMN A;  3L72 E;  1PP9 E;  1O7W A;  2E75 D;  2YFJ A;  3GL0 A;  4NBG D;  3L74 E;  1L0L E;  1Q90 C;  3GTS A;  4HM0 A;  4QDF A;  3EQQ A;  1VCK A;  4OGQ D;  2YFL A;  3N0Q A;  3L75 E;  5AEW A;  1G8K B;  2NWF A;  2QJP C;  2XSO A;  4QUQ A;  3DQY A;  3GB4 A;  3H1K E;  4HM1 A;  2E76 D;  2FYN C;  1KB9 E;  3H1J E;  1SQV E;  3TGU E;  1NTZ E;  1UUW A;  5KLI C;  3VCA A;  5CXM A;  3FOU A;  5KLV E;  4NBD D;  2XRX A;  2NVE A;  1EG9 A;  4HM8 A;  4HJL A;  1ULI A;  2YIU C;  3H1I E;  4QDC A;  2NVG A;  2QPZ A;  4U3F E;  2FYU E;  5HL4 A;  2A06 E;  3GL2 A;  1VF5 D;  3L73 E;  4H44 D;  4HM4 A;  2IBZ E;  3GOB A;  3VMH D;  3CXH E;  4EMJ B;  1JM1 A;  1NDO A;  3EN1 A;  1NTK E;  4QDF B;  5AEU A;  3L70 E;  3GCE A;  1NYK A;  1O7G A;  4HKV A;  2YFI A;  2HML A;  2DE5 D;  4HM3 A;  1SQQ E;  4PV1 D;  4PD4 E;  2E4P A;  4QUR A;  2GBW A;  3GKE A;  1KYO E;  3BCC E;  4NB9 D;  1RFS A;  1P84 E;  3VMI D;  3VMG D;  2BMO A;  1RIE A;  4NBE D;  4NB8 D;  4NBB D;  1ULJ A;  4HM2 A;  1WQL A; 
#chains in the Genus database with same CATH topology
 2YXQ B;  4N78 D;  2FYZ A;  2HMM A;  1X8Y A;  2Q1K A;  3FX0 A;  3MGN A;  1PIX A;  4HKZ H;  1YIJ P;  4NBH D;  2FYN B;  4ZKP A;  1FJK A;  4RKU J;  1SQX K;  2FYU K;  2IZ0 A;  1RF1 A;  1BCC G;  1NTM E;  3IN6 A;  3B5N C;  3N4X A;  3AEC C;  3VMZ A;  1GZL A;  1MFT A;  3L71 G;  3A2A A;  5KAF E;  1LT9 C;  1AA0 A;  1KIL D;  1SS1 A;  2WSC H;  3V4W A;  4D6T D;  3U59 A;  3ZDM A;  2E74 B;  3WU2 E;  2H7H A;  3NTN A;  2GBX A;  4JF7 A;  3M0D A;  3IR9 A;  3NXS A;  3CXH I;  4QDF A;  2IDB A;  2KOG A;  4BRY B;  3RK3 C;  4PJ0 H;  2WPQ A;  3SFE C;  5CCG D;  2HOD B;  2R44 A;  4GKG A;  1SQX D;  1NKZ B;  3VN0 A;  2FYU D;  4R4L A;  2A06 D;  1Q81 Q;  3H1I E;  2IBZ G;  4XA4 A;  2Q3E A;  2B89 A;  4WB4 A;  3KPE A;  2D2C C;  3K5B A;  2V7Q H;  1UII A;  2OYH A;  2O1K A;  2W6B A;  1FBM A;  2G3A A;  1JY2 N;  4HM3 A;  1U7J A;  3CX5 I;  3S1K A;  1GW3 A;  3GMA A;  2E4P A;  2UWJ E;  4HB1 A;  1P84 E;  1KTM A;  1RQU A;  4WBA A;  2E75 D;  4NBC D;  5APW A;  4YPC A;  3HD7 D;  2E4Q A;  3M9B A;  1KV4 A;  4OVN F;  3H1H G;  1ZRT D;  1HJ0 A;  3TNU B;  2Q3W A;  4RJT A;  1PGQ A;  5APX A;  1X0T A;  3G6E P;  4YTP C;  4H13 B;  5H2F E;  1KIL A;  3H1L J;  1RHZ B;  2OAR A;  2C0X A;  1PPJ D;  3L75 G;  4W80 A;  1IK7 A;  1J1D C;  3AE5 C;  3L36 A;  4ASV A;  2YKP A;  5AW2 B;  4L75 A;  2Y0D A;  2WWW A;  1HWT C;  5GTH E;  3H1J J;  4WY4 D;  5CCG A;  3KZI E;  2OYI A;  3USS A;  5KKZ B;  3TYY A;  5KAI E;  3L70 D;  1VCK A;  3B5N D;  4PV1 C;  3N0Q A;  1J1E B;  5AVT B;  2GUS A;  3RK2 C;  1AQ5 A;  1Y9B A;  4OGQ B;  1SLQ A;  1EG9 A;  1LTA C;  1VQO P;  4K35 A;  4EOT A;  1FZC C;  1URQ C;  4C7N A;  3HD7 A;  4XFJ A;  4WVZ A;  3BCC D;  3C9I A;  3FGA D;  3RK3 D;  1X79 B;  1ZR2 A;  2L91 A;  3VMG D;  3A0H H;  1SQP E;  3P8C E;  2ZVN B;  4H0L B;  2H89 C;  2Z5H A;  4Y99 C;  2NPS C;  1N7S B;  1QGK B;  1L0N G;  1VDF A;  2OTL P;  2WPV B;  3ITK A;  1DH3 A;  1O7P A;  2IYP A;  4JPZ B;  2POH A;  4WY4 A;  1FZB A;  1IZN B;  3AE7 C;  4BWN A;  1BCC J;  3CWB D;  3U1C A;  2B87 B;  3R4Y A;  3B5N A;  1PP9 G;  1L4A C;  1EDJ A;  1VQL P;  4NBF D;  3L71 J;  1H88 A;  2HMN A;  2IFM A;  3L72 E;  3AEB C;  1LT9 A;  1UIX A;  2IBZ I;  1L0L E;  2R5B A;  3GTS A;  2Q6Q A;  1G8K B;  3TGU D;  4QUQ A;  3JCU E;  3A7O A;  2FYN C;  1KB9 E;  2YKO A;  1SQV E;  1NTZ E;  4U3F D;  3FXE A;  3CC7 P;  4QDC A;  1MKM A;  1GDT A;  1H0T B;  1CW5 A;  2JJL A;  1ZW0 A;  1LP1 A;  3BVH A;  1NTM G;  2R3S A;  2YFI A;  3GLM A;  1SQQ E;  4PV1 D;  4PD4 E;  2E74 C;  3QH9 A;  1FE6 A;  4IFM A;  5CBO A;  2KXP B;  1RIE A;  2BMO A;  3E7K A;  3G3Z A;  2P67 A;  3RK2 D;  1S72 P;  2I1J A;  1ZOY C;  4N78 E;  1JY2 P;  2ZFC A;  4O9B A;  2W8Z A;  1EDL A;  2BMR A;  4GDO A;  3H1H J;  1TU3 F;  5CCH C;  2XND H;  2B1X A;  2HLO A;  3CMA P;  2ZT9 B;  1NTK K;  2HMO A;  5B5E E;  3L75 J;  2H43 A;  1VPC A;  3IF4 A;  3H1I G;  3HE5 B;  2NPS D;  2QG4 A;  4D6T E;  3VTP C;  2QE7 H;  2DE7 D;  1Y8A A;  2JKV A;  1Q82 Q;  1N73 B;  3SSU A;  4HM0 A;  2KSJ A;  4OH8 B;  2YFL A;  1AJY A;  2NWF A;  2AXT E;  1KQF B;  2E76 D;  3Q1M A;  4H13 C;  2BEQ D;  1JTH B;  2ZYG A;  3CCL P;  1JY2 O;  2Y0C A;  1L4A D;  2QJK B;  3CXH H;  2FYU E;  2A06 E;  3CXH D;  2OGU A;  1NTK D;  1W2E A;  1OW7 A;  1FAV A;  3GW6 A;  1LTI C;  2HG5 D;  1GL2 B;  4JYB A;  1DX7 A;  5BU8 B;  1ZME C;  4GOE A;  3V2P A;  1Z56 A;  1VL2 A;  4HH2 A;  3VCP A;  2DE6 D;  5APQ A;  1RH5 B;  5KKZ C;  4P1B H;  4QUP A;  2QM7 A;  3H1L D;  2BCC D;  1J1E C;  3CX5 H;  2GUV A;  1ZRT E;  1EDI A;  1JY3 O;  3O8Z A;  3CX5 D;  2NPS A;  4OGQ C;  1L0N J;  4C7R A;  1PPJ E;  2E74 D;  1BGY G;  1AVY A;  1KFN A;  5APS A;  2M3E A;  1R5L A;  3EQ2 A;  2P58 A;  3BAS A;  1S2E A;  2Q5U A;  2P1J A;  2M3B A;  4M3L A;  3L74 G;  3M9H A;  1AQT A;  1IO4 A;  5K5G B;  1U7M A;  1JB0 J;  1O7W A;  1QL1 A;  1PP9 J;  1U57 A;  3CCQ P;  1PGO A;  1L4A A;  3AEA C;  3S9O A;  4H0L C;  3V4Q A;  1NAF A;  1N7S C;  1RF0 A;  2XSO A;  1KYO I;  1R5S A;  3DQY A;  3H1K E;  1SQP G;  4HM1 A;  1ZLL A;  1UUW A;  4NBD D;  1PV3 A;  2ZJS E;  1YJ9 P;  2HYN A;  3GL2 A;  3VMH D;  2WT7 A;  2N9Y B;  1NGM B;  2K1A A;  4EIJ A;  1KFM A;  1K04 A;  3BCC E;  4NPE A;  1AVO A;  1GU5 A;  1NTM J;  3RK3 E;  3ABV C;  2E43 A;  1A02 F;  4MN4 C;  4BXL A;  4H13 D;  1LGH B;  4AUW A;  3CCJ P;  3PRJ A;  2ITA A;  1LT1 A;  3T97 A;  1T3U A;  2Q7C A;  3GF7 A;  1M8O B;  1HGV A;  1YJN P;  1L0L G;  3D89 A;  2HMK A;  1BE3 D;  4HM7 A;  1OW6 A;  1USE A;  2KZJ A;  1BCC D;  2JEE A;  3VMY A;  1YJW P;  1JCC A;  1NTZ G;  1NHL A;  5CCH A;  2HPC B;  2HOD A;  3L71 D;  3I55 P;  4DOJ A;  5KTB A;  2YVJ B;  3CWB E;  2N1T B;  1WMK A;  2PGD A;  5E79 E;  1NKN A;  1YTZ T;  2RMZ A;  3H25 A;  3FXD A;  3C1L A;  3H1I J;  1S5L X;  1G2C A;  1EDK A;  3RBZ A;  4OGQ D;  2W6A A;  1M1J B;  3TGU E;  3VYI A;  5AW9 B;  4RES B;  4U3F E;  1NOH A;  3TNU A;  2K3R A;  3AE3 C;  2KB7 P;  2IBZ D;  1OZH A;  2ZT9 C;  4RO0 A;  1LTS C;  1FOS F;  3GHG B;  4GOD A;  1DEE G;  3HUS B;  4N6J A;  3GCE A;  4HYT B;  2HML A;  5CMZ A;  5L8R J;  1N7S D;  1EQ7 A;  4KT0 J;  5TIS E;  3B8E B;  1N73 C;  4W7Z A;  1QVF O;  2GM4 A;  3TF5 A;  2QJP B;  4D6T G;  2V4H A;  1IK9 A;  1T3J A;  4A7P A;  3H1H D;  2LKM A;  1VQ5 P;  1VM9 A;  2BMQ A;  2NUK A;  1CZQ A;  2PAJ A;  1WT6 A;  2QJK C;  2FXO A;  1USD A;  1QL2 A;  3CI9 A;  3AE4 C;  1FOS E;  1BGY J;  1LTJ B;  3AE2 C;  2FYU G;  1GL2 C;  3AZC A;  2OQQ A;  5CJ0 A;  3QWO C;  3P8M C;  1T2K C;  1LNQ A;  4UB6 H;  2YFJ A;  2E5Y A;  2M5A B;  3L74 J;  1S9K E;  1FZE A;  5AEW A;  2JO1 A;  1JY3 N;  2YKQ A;  4GT1 A;  2KZI A;  3IFM A;  1QEX A;  1L0N K;  1CSB A;  3PLN A;  2C9N Y;  5AW7 B;  1ZV8 A;  4DT0 A;  1FZF A;  1SQP J;  1N7S A;  2DW3 A;  4LLH A;  5HL4 A;  1LTT C;  3Q5P A;  1XTC C;  2AEF A;  2AEJ A;  3GOB A;  3CXH E;  1JM1 A;  1NTK E;  4UB8 E;  1FDO A;  2OYH B;  1Q7Y Q;  5B66 H;  2FKW B;  3SWY A;  3VOP A;  1QVG O;  2AXC A;  4LGD E;  2RN0 A;  3W68 A;  1DIP A;  2JDI H;  3FWL A;  3A5T A;  1OMI A;  2LXB A;  2R5D A;  5KLV K;  1NU1 E;  1EZV D;  2WSF J;  4KJM A;  2ZYL A;  3H1L E;  1L0N D;  1SJG A;  2BCC E;  5EFW B;  3VMA A;  3L72 J;  3CX5 E;  3CC4 P;  5CHX A;  3H32 B;  2O01 N;  1L0L J;  3H1K G;  3LID A;  5BU5 A;  4OWF A;  2AEM A;  4PD4 I;  1G1I A;  2RH0 A;  5AVQ B;  3CCM P;  1W5C E;  5GTI E;  2WZ7 A;  2D2C D;  1PP9 D;  3A3Y B;  1NTZ J;  5C39 A;  3AEG C;  2FFD B;  4IL6 E;  1G8J B;  1H0T A;  3I56 P;  4NBG D;  2JR8 A;  1H89 A;  1DD3 A;  4W7Y A;  2P10 A;  4I6M C;  3E1I A;  3GB4 A;  5KLV D;  1XTG B;  2Z4E A;  3MIW A;  2K9J B;  4L76 A;  3L73 G;  1DD4 A;  5DJU B;  2R3C A;  1N2D C;  1T2K D;  3Q2Y A;  1ZR4 A;  3NMD A;  1OWA A;  3RL0 g;  1KYO H;  2E75 B;  3MTU E;  4C7N B;  4HKV A;  1KYO D;  1KOR A;  3A0B E;  2A45 G;  2N1T C;  2YO3 A;  2CPB A;  1MV8 A;  1M56 D;  1ULJ A;  2CKF A;  1W2B O;  3FWN A;  4EI2 A;  1SQB E;  3CWB G;  3GF3 A;  2WQY C;  3WU2 H;  1ZP0 C;  2VRS A;  1VQN P;  2W83 C;  3V2R A;  1RE3 C;  3V2Q A;  2O1J A;  5KLI B;  1M1J C;  2H88 C;  1N73 A;  4D6T J;  1O7M A;  2WTY A;  4NBA D;  1BE3 E;  3B71 A;  1K9M Q;  4WY4 B;  1BCC E;  3TGU G;  2LR2 A;  3GHG C;  3OA7 A;  2QIW A;  1E79 H;  1JTH A;  1CI6 B;  2W90 A;  3HUS C;  4TLF A;  1URQ D;  4U3F G;  1YHQ P;  2E5T A;  3L71 E;  3WUU A;  2M8R A;  3V2N A;  5AVW B;  5AVR B;  2FXM A;  4AYC A;  2WPR A;  4N3Y B;  1YI2 P;  5APV A;  2FYU J;  1M7L A;  1Q90 C;  5BVZ A;  3VP9 A;  3OAK A;  2QJP C;  3PH0 A;  3TDK A;  1MUU A;  1KIL E;  5CXM A;  2NRG A;  2XRX A;  1IFJ A;  3AEF C;  2FXP A;  2N9B A;  1AV1 A;  3BRT B;  5H2F H;  1JY3 P;  3L35 A;  2IBZ E;  1FC2 C;  2ZYA A;  2MJZ A;  1RE4 C;  3KDP B;  1LP1 B;  1LTJ C;  2KK7 A;  3JC2 2;  3PJS K;  4NB8 D;  4PJ0 E;  2KLV A;  2O01 J;  5GTH H;  1SQX E;  1EXI A;  3M9Q A;  1M57 D;  1NJI Q;  1OIP A;  1FU1 A;  4DJG A;  1Y47 A;  3KZI H;  3HE4 B;  2IYO A;  2K88 A;  2NUM A;  2B88 A;  1EXJ A;  3BAT A;  3H1H E;  1QLE D;  4L73 A;  3CCS P;  1FZC A;  1URQ A;  3U1A A;  4IFF A;  5AVS B;  2C9L Y;  2N1T D;  2B24 A;  1PGP A;  4C46 A;  1FJP A;  2R32 A;  1BGY D;  1JEK A;  1IFM A;  4TT3 H;  2XZR A;  1NVO A;  1HH0 A;  3H1K J;  5CBN A;  1VQ6 P;  2K9Y A;  5AVX B;  1IC2 A;  1PFI A;  1KZU B;  2OYH C;  3HTK B;  2KNC A;  2QRX A;  5AVY B;  3L74 D;  1VQK P;  4DCK A;  1NTK G;  3RGU A;  2OTK E;  4YXD C;  3OW2 O;  1J2J B;  3H1J D;  1HGZ A;  1KQL A;  2QJY B;  2A45 I;  3BCC J;  3P8C D;  3CCE P;  5AVZ B;  1NU1 G;  5CCH D;  1JOC A;  3VMX A;  2BCC G;  3L73 J;  2ZXE B;  3L70 E;  1YQ3 C;  1O7G A;  1X9V A;  1MZ9 A;  1M1K Q;  3CC2 P;  3KQG A;  2GBW A;  1VF5 B;  3VMI D;  4H44 B;  1OX3 A;  2FFD C;  2OYO A;  3O6Q B;  2B9B A;  2HPC A;  2WSF H;  1S3J A;  3TK1 A;  5CCG C;  1FQT A;  2Z5I A;  2N1T A;  1PZQ A;  3L37 A;  1NO4 A;  1JO5 A;  1WRG A;  3CWB J;  5DJT B;  4QDD A;  4EDF A;  2J59 M;  4LC1 A;  2CPS A;  3WMM 0;  5APT A;  1YBK A;  1EZV E;  2YIU B;  5BOK A;  2NZ2 A;  1L0N E;  4QMA A;  1RE3 A;  3UIA A;  3CPW O;  3JCU H;  2XR8 A;  5AW1 B;  4HM6 A;  1M1J A;  4GIF A;  1IFD A;  1A02 J;  3KXD A;  1T8Z A;  1T6A A;  3A0H E;  4WWI A;  3L72 G;  2E75 C;  2JZA A;  3GTE A;  3TGU J;  4P1C H;  4YXW H;  1KN7 A;  1PP9 E;  3GHG A;  4BRY A;  4U3F J;  2E76 B;  2WSE J;  3HUS A;  1SFC B;  4PD4 H;  2RKL A;  1SQV G;  2YMK A;  2YNY A;  3F89 A;  1P84 I;  2KLU A;  4JQ0 D;  1SQB G;  3D6Z A;  5KLI C;  5KLV E;  2H8P D;  2WIT A;  2IPP A;  3KHU A;  1HJB A;  2I1K A;  1BSH A;  4L74 A;  3V5B A;  3SWK A;  2L5G B;  1SQQ G;  4HM4 A;  2KS1 B;  4WY4 C;  2I8D A;  1BE3 G;  3SFD C;  2WT7 B;  5B5E H;  3GKE A;  1KYO E;  4NB9 D;  5AVU B;  1M90 Q;  3CL3 D;  1HUC A;  2KSE A;  1O7H A;  3L4F A;  1RE4 A;  1LTJ A;  3D71 A;  5AW8 B;  1MFZ A;  4HJG H;  3EWK A;  2GA1 A;  4KHX A;  2BEZ F;  2IX7 C;  2YO2 A;  2I7F A;  3T97 B;  2O3J A;  4H0L D;  1LWU B;  2M5A A;  4U7J A;  1AFO A;  4NPF X;  3AEE C;  2AXT H;  3RL0 B;  1YIT P;  2XKM A;  4JYC A;  3GZX A;  2HMJ A;  1OVV A;  5AW3 B;  1ZXG A;  4I7Z B;  4QCK A;  3W67 A;  3D70 A;  1NWQ A;  1BDD A;  3G71 P;  1OW8 A;  2KUB A;  2M0B A;  1FDM A;  3L75 D;  1VQP P;  1RF1 B;  1QX8 A;  1JM0 A;  1G2C B;  1EC5 A;  1NTK J;  4ZNC A;  3LW5 J;  1SQX G;  1SP4 A;  2KIK A;  3RBX A;  2A06 G;  1FS0 E;  1ULI A;  1VQ4 P;  4IOI H;  2HR3 A;  4Y28 J;  5AW4 B;  3M06 A;  1JUN A;  1FZG A;  4EMJ B;  3N7N A;  3LIE A;  4QDF B;  1NU1 J;  1YQ4 C;  2O01 H;  2BCC J;  4QUR A;  3H32 A;  1JMB A;  3AE6 C;  4HM2 A;  1RQV A;  3MZW B;  1JNM A;  2Q3I A;  3V6I A;  2WSS H;  3GZY A;  2YXR B;  2FFD A;  3AED C;  4AAY B;  1PPJ G;  1K73 Q;  3D6Y A;  2QJY C;  3NFQ A;  2QEX P;  3C0D A;  1DEB A;  1Q2N A;  2B87 A;  1NAY A;  3H1K D;  1BDC A;  1KB9 I;  1IJD B;  2G8Y A;  1BGY E;  2J58 A;  2K9J A;  4K3A A;  2ZT9 D;  1UUV A;  1HF9 A;  1H8A A;  3TSI A;  1VF5 C;  1KIL B;  4H44 C;  3MD0 A;  1N8R Q;  1KQS O;  3L70 G;  5M1B A;  3L74 E;  3GG2 A;  1VQ9 P;  3KYQ A;  2W6J H;  3CLQ A;  3R2P A;  1NTM K;  1S5L H;  3H1J E;  2J5U A;  1SQV J;  1SVF A;  2YIU C;  2PP6 A;  5KJ7 C;  3H6P A;  2NVG A;  1SQB J;  3L73 D;  3CME P;  2OYI B;  4JBZ A;  1EZV G;  1OVR A;  3BCC G;  3MUD C;  2A45 H;  1PL5 A;  1SQQ J;  2Y0E A;  3JSV C;  1VQM P;  5AEU A;  3AE1 C;  1BE3 J;  4IFD K;  1GD2 E;  1GL2 D;  1CI6 A;  2E76 C;  5E79 H;  1SFC C;  2P2U A;  2XSH A;  2JP3 A;  1NH4 A;  3CCU P;  3AE9 C;  3HD7 B;  3PP5 A;  3Q3D A;  4HM5 A;  1NTM D;  4AIV A;  4IL6 X;  1RF0 C;  5KAF H;  1Q86 Q;  2NVF A;  4AQR D;  1S4X A;  1K8A Q;  1KMI Z;  4B86 A;  3Q5S A;  1HBW A;  5KLV G;  3HE5 A;  5AW0 B;  1LTB C;  1O7N A;  3CCV P;  3SWF A;  1FDI A;  1IFP A;  2WSE H;  3HRN A;  2WSC J;  3GL0 A;  1OVU A;  2K37 A;  2JWA A;  4EYY Q;  3EQQ A;  5TJH A;  3B4S A;  3MP7 B;  2XDJ A;  1E5W A;  5TIS H;  1JMM A;  3H1I D;  3VCA A;  2Y9Y A;  3B5N B;  1R8E A;  1LWU C;  2NVE A;  2FBW C;  3P7K A;  3AE8 C;  1GK4 A;  1SQX J;  3HE4 A;  1LT9 B;  1VF5 D;  1GL2 A;  4H44 D;  3RL0 C;  1BSN A;  1P84 H;  1NDO A;  2LXC B;  2C0W A;  5AW6 B;  2YMY A;  3BRV B;  1P84 D;  1K05 A;  1GTW A;  2V7Q J;  4I7Z C;  4NBE D;  2PFX A;  1WQL A;  2JO6 A;  5APY A;  5APU A;  2ZXX A;  3G9R A;  4ZKU A;  3RK3 B;  5KJ7 D;  1HVV A;  1RF1 C;  2W27 A;  3HTK A;  1OXZ A;  4DZO A;  1N86 A;  1S9K D;  3CD6 P;  2XU6 A;  3WUV A;  2D2C B;  3WUT A;  1YTZ I;  2QVA A;  1NU1 K;  1KQG B;  1GU4 A;  1NYH A;  3M0D C;  2SPZ A;  1SFC D;  5KAI H;  1SQP K;  2FY8 A;  1IFN A;  2WMM A;  4UB8 H;  3LW5 H;  4NPD A;  3IAO A;  2IZ1 A;  2QSI A;  2MKV A;  2WPS A;  3L75 E;  2BAS A;  1EZV I;  3L70 J;  1X22 A;  3O6Q A;  2Q9I A;  1J1D B;  2Y9Z A;  5AVV B;  1JCD A;  2QPZ A;  3EFF K;  3OJA B;  1NU1 D;  4GOF A;  1OFC X;  4R4M A;  2IFN A;  1GMJ A;  1N7L A;  3EN1 A;  4UB6 E;  5KJ7 A;  1LTG C;  5AW5 B;  3CCR P;  2ZAE B;  4XE5 B;  1IFI A;  2DE5 D;  4ZMD A;  2ZYD A;  3S4R A;  2JWD A;  1SQP D;  1L0L K;  5GTI H;  1D7M A;  2XNX A;  3MUD A;  1KIL C;  1LJ2 A;  4PV1 B;  5CJ4 A;  1RY3 A;  3H1L G;  4Z1M H;  4IL6 H;  1SQV K;  3I5C A;  2KP8 A;  1NTZ K;  3E1R A;  3RK2 B;  1KD1 Q;  2E42 A;  2CK3 H;  1Q90 D;  2XV5 A;  2ZVO B;  4CPG A;  3RL0 D;  1SQB K;  1SFC A;  1FZC B;  1URQ B;  3PHL A;  4ASW A;  5B66 E;  3H1J G;  1YYC A;  1SQQ K;  1VQ8 P;  3F5H A;  2OYI C;  1FZA A;  1HTL C;  3EFG A;  3L72 D;  2QA4 P;  4I1L A;  5KLV J;  3P32 A;  1L0L D;  3VP8 A;  2KNC B;  2KS1 A;  4I2L C;  1GW4 A;  3A0B H;  4Y99 B;  2NPS B;  1KB9 H;  3C8V A;  1L2P A;  1KB9 D;  1SQV D;  1NTZ D;  3M91 A;  3II6 A;  3PTZ A;  1VQ7 P;  3HD7 C;  1G1J A;  3FOU A;  1GK6 A;  1SQB D;  4HM8 A;  4HJL A;  2HFE D;  2OTJ P;  1S5L E;  2QM8 A;  3Q5R A;  3MHV A;  2P7J A;  1S1C X;  1KC8 Q;  3L73 E;  2WVR A;  1LWU A;  2PRR A;  1L4A B;  1SQQ D;  4PD4 D;  1NYK A;  2KI7 B;  3G4S P;  1PGJ A;  2KYV A;  1RFS A;  3M0A A;  4NBB D;  1ZN5 A; 
#chains in the Genus database with same CATH homology
 2CKF A;  4NBC D;  2JO6 A;  1SQP E;  1SQX E;  4H13 D;  1O7H A;  3VCP A;  1SQB E;  2DE6 D;  2E4Q A;  2HMM A;  5KKZ C;  4P1B H;  1FQT A;  4QUP A;  2XSH A;  3GZY A;  4NBH D;  2Q3W A;  2NUM A;  1NU1 E;  1ZRT E;  4AAY B;  2ZYL A;  3H1L E;  2BMR A;  4QDD A;  3H1H E;  2I7F A;  1SJG A;  4HM5 A;  4H0L D;  2BCC E;  1VM9 A;  2HMK A;  3D89 A;  2QJY C;  1O7P A;  2BMQ A;  1EZV E;  2NUK A;  4AIV A;  4HM7 A;  5BOK A;  1O7M A;  1L0N E;  2B1X A;  1NTM E;  3CX5 E;  2NVF A;  4NBA D;  3C0D A;  1BE3 E;  2QJK C;  1PPJ E;  2B24 A;  2E74 D;  2XR8 A;  2HMO A;  4HM6 A;  1BCC E;  3GZX A;  2HMJ A;  1O7N A;  1BGY E;  2JZA A;  2YVJ B;  3CWB E;  2D2C D;  2ZT9 D;  3L71 E;  3GTE A;  1UUV A;  3AZC A;  4NBF D;  4QCK A;  4P1C H;  4D6T E;  2GBX A;  2DE7 D;  1G8J B;  2HMN A;  3L72 E;  1PP9 E;  1O7W A;  2E75 D;  2YFJ A;  3GL0 A;  4NBG D;  3L74 E;  1L0L E;  1Q90 C;  3GTS A;  4HM0 A;  4QDF A;  3EQQ A;  1VCK A;  4OGQ D;  2YFL A;  3N0Q A;  3L75 E;  5AEW A;  1G8K B;  2NWF A;  2QJP C;  2XSO A;  4QUQ A;  3DQY A;  3GB4 A;  3H1K E;  4HM1 A;  2E76 D;  2FYN C;  1KB9 E;  3H1J E;  1SQV E;  3TGU E;  1NTZ E;  1UUW A;  5KLI C;  3VCA A;  5CXM A;  3FOU A;  5KLV E;  4NBD D;  2XRX A;  2NVE A;  1EG9 A;  4HM8 A;  4HJL A;  1ULI A;  2YIU C;  3H1I E;  4QDC A;  2NVG A;  2QPZ A;  4U3F E;  2FYU E;  5HL4 A;  2A06 E;  3GL2 A;  1VF5 D;  3L73 E;  4H44 D;  4HM4 A;  2IBZ E;  3GOB A;  3VMH D;  3CXH E;  4EMJ B;  1JM1 A;  1NDO A;  3EN1 A;  1NTK E;  4QDF B;  5AEU A;  3L70 E;  3GCE A;  1NYK A;  1O7G A;  4HKV A;  2YFI A;  2HML A;  2DE5 D;  4HM3 A;  1SQQ E;  4PV1 D;  4PD4 E;  2E4P A;  4QUR A;  2GBW A;  3GKE A;  1KYO E;  3BCC E;  4NB9 D;  1RFS A;  1P84 E;  3VMI D;  3VMG D;  2BMO A;  1RIE A;  4NBE D;  4NB8 D;  4NBB D;  1ULJ A;  4HM2 A;  1WQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...