5AEWA

Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with biphenyl
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPGINTIRTWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of the Enhanced Pollutant-Degrading Capabilities of an Engineered Biphenyl Dioxygenase.
pubmed doi rcsb
source organism Burkholderia xenovorans lb400
molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
total genus 137
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5aewA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 5aewA01
4H13D 2QPZA 4NBED 1WW9A 1Z03A 3GZYA 1NTZE 2BMQA 1RIEA 2BMRA 1O7NA 2YFJA 3TGUE 2YFLA 3N0QA 2QJYC 1O7MA 5AEWA 4HM1A 4OGQD 1NDOA 3L71E 4P1BH 1EG9A 1L0LE 2E74D 4QURA 3EQQA 1UUWA 2NVGA 4NBAD 1KB9E 1ULJA 3VMID 1FQTA 2NUKA 1UUVA 5AEUA 2E4PA 1G8JB 2JO6A 3D89A 3L75E 3VMHA 1SQXE 3VCAA 2E76D 4NB9D 4PV1D 3GCFA 2A06E 1G8KB 4NBEA 1O7WA 2DE5D 4HM5A 2HMNA 2YVJB 4AAYB 4HJLA 2NVFA 1O7GA 2NVEA 1NU1E 2CKFA 1EZVE 2XRXA 4QDDA 2QJPC 2QJKC 4QCKA 1PPJE 4HM4A 1Z01A 2YFIA 4NBFD 4U3FE 2BCCE 5KLVE 3GL0A 3H1JE 5BOKA 1NYKA 3BCCE 1L0NE 2HMLA 4NBAA 1SQQE 3EN1A 3VMIA 2B24A 1SQPE 2HMMA 4QUPA 3VMGA 1BE3E 2HMJA 4NB9A 2HMKA 4HM6A 3H1IE 4NB8D 2DE5A 4HM0A 2ZYLA 3C0DA 5KKZC 5CXMA 1Q90C 4NBGD 3CWBE 3GB4A 4NBCD 2FYNC 3AZCA 3GKQA 1BCCE 1P84E 4NBHD 4AIVA 4P1CH 2D2CD 2GBWA 1VF5D 1PP9E 5KLIC 4NBFA 4QDCA 2Q3WA 1SQVE 3GTEA 4H44D 4HM2A 4PD4E 4QUQA 3CX5E 2DE6A 2XSOA 3GL2A 3L73E 2DE7A 4NBDD 1JM1A 2YIUC 4NBBD 3VMGD 2JZAA 2IBZE 3H1LE 1WQLA 1NTME 2XSHA 1O7HA 4NB8A 2B1XA 1ZRTE 3GOBA 4EMJB 1VCKA 4QDFA 1VM9A 2HMOA 3L74E 4NBGA 4NBCA 3FOUA 3H1KE 2I7FA 3DQYA 1NTKE 1KYOE 1SJGA 2E4QA 2ZT9D 3CXHE 1Z02A 3VCPA 3GCEA 2E75D 2NUMA 3H1HE 4NBHA 5HL4A 2NWFA 3GKEA 1ULIA 3L72E 4HKVA 3GTSA 3GZXA 2XR8A 4HM3A 4HM7A 1RFSA 2DE6D 2GBXA 4QDFB 3L70E 3VMHD 2DE7D 4NBDA 2FYUE 4NBBA 1O7PA 4HM8A 4H0LD 1SQBE 2BMOA
chains in the Genus database with same CATH superfamily
4H13D 2QPZA 4NBED 1WW9A 1Z03A 3GZYA 1NTZE 2BMQA 1RIEA 2BMRA 1O7NA 2YFJA 3TGUE 2YFLA 3N0QA 2QJYC 1O7MA 5AEWA 4HM1A 4OGQD 1NDOA 3L71E 4P1BH 1EG9A 1L0LE 2E74D 4QURA 3EQQA 1UUWA 2NVGA 4NBAD 1KB9E 1ULJA 3VMID 1FQTA 2NUKA 1UUVA 5AEUA 2E4PA 1G8JB 2JO6A 3D89A 3L75E 3VMHA 1SQXE 3VCAA 2E76D 4NB9D 4PV1D 3GCFA 2A06E 1G8KB 4NBEA 1O7WA 2DE5D 4HM5A 2HMNA 2YVJB 4AAYB 4HJLA 2NVFA 1O7GA 2NVEA 1NU1E 2CKFA 1EZVE 2XRXA 4QDDA 2QJPC 2QJKC 4QCKA 1PPJE 4HM4A 1Z01A 2YFIA 4NBFD 4U3FE 2BCCE 5KLVE 3GL0A 3H1JE 5BOKA 1NYKA 3BCCE 1L0NE 2HMLA 4NBAA 1SQQE 3EN1A 3VMIA 2B24A 1SQPE 2HMMA 4QUPA 3VMGA 1BE3E 2HMJA 4NB9A 2HMKA 4HM6A 3H1IE 4NB8D 2DE5A 4HM0A 2ZYLA 3C0DA 5KKZC 5CXMA 1Q90C 4NBGD 3CWBE 3GB4A 4NBCD 2FYNC 3AZCA 3GKQA 1BCCE 1P84E 4NBHD 4AIVA 4P1CH 2D2CD 2GBWA 1VF5D 1PP9E 5KLIC 4NBFA 4QDCA 2Q3WA 1SQVE 3GTEA 4H44D 4HM2A 4PD4E 4QUQA 3CX5E 2DE6A 2XSOA 3GL2A 3L73E 2DE7A 4NBDD 1JM1A 2YIUC 4NBBD 3VMGD 2JZAA 2IBZE 3H1LE 1WQLA 1NTME 2XSHA 1O7HA 4NB8A 2B1XA 1ZRTE 3GOBA 4EMJB 1VCKA 4QDFA 1VM9A 2HMOA 3L74E 4NBGA 4NBCA 3FOUA 3H1KE 2I7FA 3DQYA 1NTKE 1KYOE 1SJGA 2E4QA 2ZT9D 3CXHE 1Z02A 3VCPA 3GCEA 2E75D 2NUMA 3H1HE 4NBHA 5HL4A 2NWFA 3GKEA 1ULIA 3L72E 4HKVA 3GTSA 3GZXA 2XR8A 4HM3A 4HM7A 1RFSA 2DE6D 2GBXA 4QDFB 3L70E 3VMHD 2DE7D 4NBDA 2FYUE 4NBBA 1O7PA 4HM8A 4H0LD 1SQBE 2BMOA
chains in the Genus database with same CATH topology
4H13D 2QPZA 4NBED 1WW9A 1Z03A 3GZYA 1NTZE 2BMQA 1RIEA 2BMRA 1O7NA 2YFJA 3TGUE 2YFLA 3N0QA 2QJYC 1O7MA 5AEWA 4HM1A 4OGQD 1NDOA 3L71E 4P1BH 1EG9A 1L0LE 2E74D 4QURA 3EQQA 1UUWA 2NVGA 4NBAD 1KB9E 1ULJA 3VMID 1FQTA 2NUKA 1UUVA 5AEUA 2E4PA 1G8JB 2JO6A 3D89A 3L75E 3VMHA 1SQXE 3VCAA 2E76D 4NB9D 4PV1D 3GCFA 2A06E 1G8KB 4NBEA 1O7WA 2DE5D 4HM5A 2HMNA 2YVJB 4AAYB 4HJLA 2NVFA 1O7GA 2NVEA 1NU1E 2CKFA 1EZVE 2XRXA 4QDDA 2QJPC 2QJKC 4QCKA 1PPJE 4HM4A 1Z01A 2YFIA 4NBFD 4U3FE 2BCCE 5KLVE 3GL0A 3H1JE 5BOKA 1NYKA 3BCCE 1L0NE 2HMLA 4NBAA 1SQQE 3EN1A 3VMIA 2B24A 1SQPE 2HMMA 4QUPA 3VMGA 1BE3E 2HMJA 4NB9A 2HMKA 4HM6A 3H1IE 4NB8D 2DE5A 4HM0A 2ZYLA 3C0DA 5KKZC 5CXMA 1Q90C 4NBGD 3CWBE 3GB4A 4NBCD 2FYNC 3AZCA 3GKQA 1BCCE 1P84E 4NBHD 4AIVA 4P1CH 2D2CD 2GBWA 1VF5D 1PP9E 5KLIC 4NBFA 4QDCA 2Q3WA 1SQVE 3GTEA 4H44D 4HM2A 4PD4E 4QUQA 3CX5E 2DE6A 2XSOA 3GL2A 3L73E 2DE7A 4NBDD 1JM1A 2YIUC 4NBBD 3VMGD 2JZAA 2IBZE 3H1LE 1WQLA 1NTME 2XSHA 1O7HA 4NB8A 2B1XA 1ZRTE 3GOBA 4EMJB 1VCKA 4QDFA 1VM9A 2HMOA 3L74E 4NBGA 4NBCA 3FOUA 3H1KE 2I7FA 3DQYA 1NTKE 1KYOE 1SJGA 2E4QA 2ZT9D 3CXHE 1Z02A 3VCPA 3GCEA 2E75D 2NUMA 3H1HE 4NBHA 5HL4A 2NWFA 3GKEA 1ULIA 3L72E 4HKVA 3GTSA 3GZXA 2XR8A 4HM3A 4HM7A 1RFSA 2DE6D 2GBXA 4QDFB 3L70E 3VMHD 2DE7D 4NBDA 2FYUE 4NBBA 1O7PA 4HM8A 4H0LD 1SQBE 2BMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H13 D;  2QPZ A;  4NBE D;  1WW9 A;  1Z03 A;  3GZY A;  1NTZ E;  2BMQ A;  1RIE A;  2BMR A;  1O7N A;  2YFJ A;  3TGU E;  2YFL A;  3N0Q A;  2QJY C;  1O7M A;  5AEW A;  4HM1 A;  4OGQ D;  1NDO A;  3L71 E;  4P1B H;  1EG9 A;  1L0L E;  2E74 D;  4QUR A;  3EQQ A;  1UUW A;  2NVG A;  4NBA D;  1KB9 E;  1ULJ A;  3VMI D;  1FQT A;  2NUK A;  1UUV A;  5AEU A;  2E4P A;  1G8J B;  2JO6 A;  3D89 A;  3L75 E;  3VMH A;  1SQX E;  3VCA A;  2E76 D;  4NB9 D;  4PV1 D;  3GCF A;  2A06 E;  1G8K B;  4NBE A;  1O7W A;  2DE5 D;  4HM5 A;  2HMN A;  2YVJ B;  4AAY B;  4HJL A;  2NVF A;  1O7G A;  2NVE A;  1NU1 E;  2CKF A;  1EZV E;  2XRX A;  4QDD A;  2QJP C;  2QJK C;  4QCK A;  1PPJ E;  4HM4 A;  1Z01 A;  2YFI A;  4NBF D;  4U3F E;  2BCC E;  5KLV E;  3GL0 A;  3H1J E;  5BOK A;  1NYK A;  3BCC E;  1L0N E;  2HML A;  4NBA A;  1SQQ E;  3EN1 A;  3VMI A;  2B24 A;  1SQP E;  2HMM A;  4QUP A;  3VMG A;  1BE3 E;  2HMJ A;  4NB9 A;  2HMK A;  4HM6 A;  3H1I E;  4NB8 D;  2DE5 A;  4HM0 A;  2ZYL A;  3C0D A;  5KKZ C;  5CXM A;  1Q90 C;  4NBG D;  3CWB E;  3GB4 A;  4NBC D;  2FYN C;  3AZC A;  3GKQ A;  1BCC E;  1P84 E;  4NBH D;  4AIV A;  4P1C H;  2D2C D;  2GBW A;  1VF5 D;  1PP9 E;  5KLI C;  4NBF A;  4QDC A;  2Q3W A;  1SQV E;  3GTE A;  4H44 D;  4HM2 A;  4PD4 E;  4QUQ A;  3CX5 E;  2DE6 A;  2XSO A;  3GL2 A;  3L73 E;  2DE7 A;  4NBD D;  1JM1 A;  2YIU C;  4NBB D;  3VMG D;  2JZA A;  2IBZ E;  3H1L E;  1WQL A;  1NTM E;  2XSH A;  1O7H A;  4NB8 A;  2B1X A;  1ZRT E;  3GOB A;  4EMJ B;  1VCK A;  4QDF A;  1VM9 A;  2HMO A;  3L74 E;  4NBG A;  4NBC A;  3FOU A;  3H1K E;  2I7F A;  3DQY A;  1NTK E;  1KYO E;  1SJG A;  2E4Q A;  2ZT9 D;  3CXH E;  1Z02 A;  3VCP A;  3GCE A;  2E75 D;  2NUM A;  3H1H E;  4NBH A;  5HL4 A;  2NWF A;  3GKE A;  1ULI A;  3L72 E;  4HKV A;  3GTS A;  3GZX A;  2XR8 A;  4HM3 A;  4HM7 A;  1RFS A;  2DE6 D;  2GBX A;  4QDF B;  3L70 E;  3VMH D;  2DE7 D;  4NBD A;  2FYU E;  4NBB A;  1O7P A;  4HM8 A;  4H0L D;  1SQB E;  2BMO A; 
#chains in the Genus database with same CATH topology
 4H13 D;  2QPZ A;  4NBE D;  1WW9 A;  1Z03 A;  3GZY A;  1NTZ E;  2BMQ A;  1RIE A;  2BMR A;  1O7N A;  2YFJ A;  3TGU E;  2YFL A;  3N0Q A;  2QJY C;  1O7M A;  5AEW A;  4HM1 A;  4OGQ D;  1NDO A;  3L71 E;  4P1B H;  1EG9 A;  1L0L E;  2E74 D;  4QUR A;  3EQQ A;  1UUW A;  2NVG A;  4NBA D;  1KB9 E;  1ULJ A;  3VMI D;  1FQT A;  2NUK A;  1UUV A;  5AEU A;  2E4P A;  1G8J B;  2JO6 A;  3D89 A;  3L75 E;  3VMH A;  1SQX E;  3VCA A;  2E76 D;  4NB9 D;  4PV1 D;  3GCF A;  2A06 E;  1G8K B;  4NBE A;  1O7W A;  2DE5 D;  4HM5 A;  2HMN A;  2YVJ B;  4AAY B;  4HJL A;  2NVF A;  1O7G A;  2NVE A;  1NU1 E;  2CKF A;  1EZV E;  2XRX A;  4QDD A;  2QJP C;  2QJK C;  4QCK A;  1PPJ E;  4HM4 A;  1Z01 A;  2YFI A;  4NBF D;  4U3F E;  2BCC E;  5KLV E;  3GL0 A;  3H1J E;  5BOK A;  1NYK A;  3BCC E;  1L0N E;  2HML A;  4NBA A;  1SQQ E;  3EN1 A;  3VMI A;  2B24 A;  1SQP E;  2HMM A;  4QUP A;  3VMG A;  1BE3 E;  2HMJ A;  4NB9 A;  2HMK A;  4HM6 A;  3H1I E;  4NB8 D;  2DE5 A;  4HM0 A;  2ZYL A;  3C0D A;  5KKZ C;  5CXM A;  1Q90 C;  4NBG D;  3CWB E;  3GB4 A;  4NBC D;  2FYN C;  3AZC A;  3GKQ A;  1BCC E;  1P84 E;  4NBH D;  4AIV A;  4P1C H;  2D2C D;  2GBW A;  1VF5 D;  1PP9 E;  5KLI C;  4NBF A;  4QDC A;  2Q3W A;  1SQV E;  3GTE A;  4H44 D;  4HM2 A;  4PD4 E;  4QUQ A;  3CX5 E;  2DE6 A;  2XSO A;  3GL2 A;  3L73 E;  2DE7 A;  4NBD D;  1JM1 A;  2YIU C;  4NBB D;  3VMG D;  2JZA A;  2IBZ E;  3H1L E;  1WQL A;  1NTM E;  2XSH A;  1O7H A;  4NB8 A;  2B1X A;  1ZRT E;  3GOB A;  4EMJ B;  1VCK A;  4QDF A;  1VM9 A;  2HMO A;  3L74 E;  4NBG A;  4NBC A;  3FOU A;  3H1K E;  2I7F A;  3DQY A;  1NTK E;  1KYO E;  1SJG A;  2E4Q A;  2ZT9 D;  3CXH E;  1Z02 A;  3VCP A;  3GCE A;  2E75 D;  2NUM A;  3H1H E;  4NBH A;  5HL4 A;  2NWF A;  3GKE A;  1ULI A;  3L72 E;  4HKV A;  3GTS A;  3GZX A;  2XR8 A;  4HM3 A;  4HM7 A;  1RFS A;  2DE6 D;  2GBX A;  4QDF B;  3L70 E;  3VMH D;  2DE7 D;  4NBD A;  2FYU E;  4NBB A;  1O7P A;  4HM8 A;  4H0L D;  1SQB E;  2BMO A; 
#chains in the Genus database with same CATH homology
 4H13 D;  2QPZ A;  4NBE D;  1WW9 A;  1Z03 A;  3GZY A;  1NTZ E;  2BMQ A;  1RIE A;  2BMR A;  1O7N A;  2YFJ A;  3TGU E;  2YFL A;  3N0Q A;  2QJY C;  1O7M A;  5AEW A;  4HM1 A;  4OGQ D;  1NDO A;  3L71 E;  4P1B H;  1EG9 A;  1L0L E;  2E74 D;  4QUR A;  3EQQ A;  1UUW A;  2NVG A;  4NBA D;  1KB9 E;  1ULJ A;  3VMI D;  1FQT A;  2NUK A;  1UUV A;  5AEU A;  2E4P A;  1G8J B;  2JO6 A;  3D89 A;  3L75 E;  3VMH A;  1SQX E;  3VCA A;  2E76 D;  4NB9 D;  4PV1 D;  3GCF A;  2A06 E;  1G8K B;  4NBE A;  1O7W A;  2DE5 D;  4HM5 A;  2HMN A;  2YVJ B;  4AAY B;  4HJL A;  2NVF A;  1O7G A;  2NVE A;  1NU1 E;  2CKF A;  1EZV E;  2XRX A;  4QDD A;  2QJP C;  2QJK C;  4QCK A;  1PPJ E;  4HM4 A;  1Z01 A;  2YFI A;  4NBF D;  4U3F E;  2BCC E;  5KLV E;  3GL0 A;  3H1J E;  5BOK A;  1NYK A;  3BCC E;  1L0N E;  2HML A;  4NBA A;  1SQQ E;  3EN1 A;  3VMI A;  2B24 A;  1SQP E;  2HMM A;  4QUP A;  3VMG A;  1BE3 E;  2HMJ A;  4NB9 A;  2HMK A;  4HM6 A;  3H1I E;  4NB8 D;  2DE5 A;  4HM0 A;  2ZYL A;  3C0D A;  5KKZ C;  5CXM A;  1Q90 C;  4NBG D;  3CWB E;  3GB4 A;  4NBC D;  2FYN C;  3AZC A;  3GKQ A;  1BCC E;  1P84 E;  4NBH D;  4AIV A;  4P1C H;  2D2C D;  2GBW A;  1VF5 D;  1PP9 E;  5KLI C;  4NBF A;  4QDC A;  2Q3W A;  1SQV E;  3GTE A;  4H44 D;  4HM2 A;  4PD4 E;  4QUQ A;  3CX5 E;  2DE6 A;  2XSO A;  3GL2 A;  3L73 E;  2DE7 A;  4NBD D;  1JM1 A;  2YIU C;  4NBB D;  3VMG D;  2JZA A;  2IBZ E;  3H1L E;  1WQL A;  1NTM E;  2XSH A;  1O7H A;  4NB8 A;  2B1X A;  1ZRT E;  3GOB A;  4EMJ B;  1VCK A;  4QDF A;  1VM9 A;  2HMO A;  3L74 E;  4NBG A;  4NBC A;  3FOU A;  3H1K E;  2I7F A;  3DQY A;  1NTK E;  1KYO E;  1SJG A;  2E4Q A;  2ZT9 D;  3CXH E;  1Z02 A;  3VCP A;  3GCE A;  2E75 D;  2NUM A;  3H1H E;  4NBH A;  5HL4 A;  2NWF A;  3GKE A;  1ULI A;  3L72 E;  4HKV A;  3GTS A;  3GZX A;  2XR8 A;  4HM3 A;  4HM7 A;  1RFS A;  2DE6 D;  2GBX A;  4QDF B;  3L70 E;  3VMH D;  2DE7 D;  4NBD A;  2FYU E;  4NBB A;  1O7P A;  4HM8 A;  4H0L D;  1SQB E;  2BMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...