5AEWA

Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with biphenyl
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPGINTIRTWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Basis of the Enhanced Pollutant-Degrading Capabilities of an Engineered Biphenyl Dioxygenase.
pubmed doi rcsb
source organism Burkholderia xenovorans lb400
total genus 137
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5aewA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 5aewA01
3GKEA 4NBDA 5HL4A 2NUKA 4NB8D 3GZXA 1G8KB 1EG9A 1NTKE 2DE5A 2YVJB 4QUQA 4P1CH 3H1JE 4H44D 1NU1E 3L70E 1SJGA 2YIUC 2HMMA 1Q90C 3BCCE 3GTEA 3VCAA 1O7GA 1SQXE 1L0LE 3L72E 2B1XA 2E74D 2XR8A 3CWBE 2XSHA 3VMHD 5AEUA 4QCKA 2QJYC 3VMGD 1WW9A 1O7MA 1ZRTE 2NWFA 1Z03A 4P1BH 3VCPA 4NB8A 4H0LD 2HMKA 2D2CD 2HMNA 1NTME 2HMLA 2I7FA 5KLVE 1SQVE 2QPZA 3H1HE 3N0QA 2DE6D 2FYNC 4HM8A 1PPJE 4HM1A 4NBCD 4HM3A 4NBED 3AZCA 1ULIA 4QURA 2XRXA 3GCFA 2YFJA 2E4PA 3GB4A 3VMHA 3VMGA 4QDFB 3DQYA 1VF5D 3GZYA 1NTZE 1KB9E 1O7NA 2E75D 2JZAA 1NDOA 2NVFA 1ULJA 1EZVE 3CX5E 4HJLA 2NVEA 2JO6A 2NUMA 3L75E 4NBAD 4NBBD 2HMJA 2ZYLA 5AEWA 3L74E 4QDCA 1G8JB 1L0NE 3GL2A 1VM9A 3H1IE 1JM1A 4NB9D 4U3FE 2DE6A 4NBCA 1O7WA 1KYOE 2QJKC 4NBHD 1WQLA 4NBEA 2IBZE 2YFLA 4OGQD 3GL0A 3EQQA 3D89A 1Z01A 2CKFA 2E76D 3GTSA 2BMRA 4EMJB 2DE7D 4NBGD 1UUVA 4HM4A 2Q3WA 3H1LE 3CXHE 4HM5A 4HKVA 3VMID 4HM6A 3EN1A 2FYUE 3C0DA 4NBAA 4NBBA 4AIVA 1Z02A 2YFIA 1NYKA 2XSOA 4NB9A 4PD4E 4HM2A 4HM7A 1FQTA 3H1KE 2HMOA 4NBFD 2BMQA 4NBHA 2ZT9D 5CXMA 4QUPA 3L71E 4AAYB 1RIEA 2A06E 4NBDD 2BMOA 3GCEA 2DE7A 3GKQA 4NBGA 1PP9E 1O7HA 2E4QA 4HM0A 2DE5D 5KKZC 5BOKA 3VMIA 1O7PA 3TGUE 4QDFA 1SQQE 2BCCE 1UUWA 1P84E 2GBWA 2QJPC 1BCCE 2B24A 1SQBE 1RFSA 4PV1D 4QDDA 4NBFA 3GOBA 2NVGA 2GBXA 1SQPE 4H13D 1BE3E 3FOUA 3L73E 1VCKA 5KLIC
chains in the Genus database with same CATH superfamily
3GKEA 4NBDA 5HL4A 2NUKA 4NB8D 3GZXA 1G8KB 1EG9A 1NTKE 2DE5A 2YVJB 4QUQA 4P1CH 3H1JE 4H44D 1NU1E 3L70E 1SJGA 2YIUC 2HMMA 1Q90C 3BCCE 3GTEA 3VCAA 1O7GA 1SQXE 1L0LE 3L72E 2B1XA 2E74D 2XR8A 3CWBE 2XSHA 3VMHD 5AEUA 4QCKA 2QJYC 3VMGD 1WW9A 1O7MA 1ZRTE 2NWFA 1Z03A 4P1BH 3VCPA 4NB8A 4H0LD 2HMKA 2D2CD 2HMNA 1NTME 2HMLA 2I7FA 5KLVE 1SQVE 2QPZA 3H1HE 3N0QA 2DE6D 2FYNC 4HM8A 1PPJE 4HM1A 4NBCD 4HM3A 4NBED 3AZCA 1ULIA 4QURA 2XRXA 3GCFA 2YFJA 2E4PA 3GB4A 3VMHA 3VMGA 4QDFB 3DQYA 1VF5D 3GZYA 1NTZE 1KB9E 1O7NA 2E75D 2JZAA 1NDOA 2NVFA 1ULJA 1EZVE 3CX5E 4HJLA 2NVEA 2JO6A 2NUMA 3L75E 4NBAD 4NBBD 2HMJA 2ZYLA 5AEWA 3L74E 4QDCA 1G8JB 1L0NE 3GL2A 1VM9A 3H1IE 1JM1A 4NB9D 4U3FE 2DE6A 4NBCA 1O7WA 1KYOE 2QJKC 4NBHD 1WQLA 4NBEA 2IBZE 2YFLA 4OGQD 3GL0A 3EQQA 3D89A 1Z01A 2CKFA 2E76D 3GTSA 2BMRA 4EMJB 2DE7D 4NBGD 1UUVA 4HM4A 2Q3WA 3H1LE 3CXHE 4HM5A 4HKVA 3VMID 4HM6A 3EN1A 2FYUE 3C0DA 4NBAA 4NBBA 4AIVA 1Z02A 2YFIA 1NYKA 2XSOA 4NB9A 4PD4E 4HM2A 4HM7A 1FQTA 3H1KE 2HMOA 4NBFD 2BMQA 4NBHA 2ZT9D 5CXMA 4QUPA 3L71E 4AAYB 1RIEA 2A06E 4NBDD 2BMOA 3GCEA 2DE7A 3GKQA 4NBGA 1PP9E 1O7HA 2E4QA 4HM0A 2DE5D 5KKZC 5BOKA 3VMIA 1O7PA 3TGUE 4QDFA 1SQQE 2BCCE 1UUWA 1P84E 2GBWA 2QJPC 1BCCE 2B24A 1SQBE 1RFSA 4PV1D 4QDDA 4NBFA 3GOBA 2NVGA 2GBXA 1SQPE 4H13D 1BE3E 3FOUA 3L73E 1VCKA 5KLIC
chains in the Genus database with same CATH topology
3GKEA 4NBDA 5HL4A 2NUKA 4NB8D 3GZXA 1G8KB 1EG9A 1NTKE 2DE5A 2YVJB 4QUQA 4P1CH 3H1JE 4H44D 1NU1E 3L70E 1SJGA 2YIUC 2HMMA 1Q90C 3BCCE 3GTEA 3VCAA 1O7GA 1SQXE 1L0LE 3L72E 2B1XA 2E74D 2XR8A 3CWBE 2XSHA 3VMHD 5AEUA 4QCKA 2QJYC 3VMGD 1WW9A 1O7MA 1ZRTE 2NWFA 1Z03A 4P1BH 3VCPA 4NB8A 4H0LD 2HMKA 2D2CD 2HMNA 1NTME 2HMLA 2I7FA 5KLVE 1SQVE 2QPZA 3H1HE 3N0QA 2DE6D 2FYNC 4HM8A 1PPJE 4HM1A 4NBCD 4HM3A 4NBED 3AZCA 1ULIA 4QURA 2XRXA 3GCFA 2YFJA 2E4PA 3GB4A 3VMHA 3VMGA 4QDFB 3DQYA 1VF5D 3GZYA 1NTZE 1KB9E 1O7NA 2E75D 2JZAA 1NDOA 2NVFA 1ULJA 1EZVE 3CX5E 4HJLA 2NVEA 2JO6A 2NUMA 3L75E 4NBAD 4NBBD 2HMJA 2ZYLA 5AEWA 3L74E 4QDCA 1G8JB 1L0NE 3GL2A 1VM9A 3H1IE 1JM1A 4NB9D 4U3FE 2DE6A 4NBCA 1O7WA 1KYOE 2QJKC 4NBHD 1WQLA 4NBEA 2IBZE 2YFLA 4OGQD 3GL0A 3EQQA 3D89A 1Z01A 2CKFA 2E76D 3GTSA 2BMRA 4EMJB 2DE7D 4NBGD 1UUVA 4HM4A 2Q3WA 3H1LE 3CXHE 4HM5A 4HKVA 3VMID 4HM6A 3EN1A 2FYUE 3C0DA 4NBAA 4NBBA 4AIVA 1Z02A 2YFIA 1NYKA 2XSOA 4NB9A 4PD4E 4HM2A 4HM7A 1FQTA 3H1KE 2HMOA 4NBFD 2BMQA 4NBHA 2ZT9D 5CXMA 4QUPA 3L71E 4AAYB 1RIEA 2A06E 4NBDD 2BMOA 3GCEA 2DE7A 3GKQA 4NBGA 1PP9E 1O7HA 2E4QA 4HM0A 2DE5D 5KKZC 5BOKA 3VMIA 1O7PA 3TGUE 4QDFA 1SQQE 2BCCE 1UUWA 1P84E 2GBWA 2QJPC 1BCCE 2B24A 1SQBE 1RFSA 4PV1D 4QDDA 4NBFA 3GOBA 2NVGA 2GBXA 1SQPE 4H13D 1BE3E 3FOUA 3L73E 1VCKA 5KLIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKE A;  4NBD A;  5HL4 A;  2NUK A;  4NB8 D;  3GZX A;  1G8K B;  1EG9 A;  1NTK E;  2DE5 A;  2YVJ B;  4QUQ A;  4P1C H;  3H1J E;  4H44 D;  1NU1 E;  3L70 E;  1SJG A;  2YIU C;  2HMM A;  1Q90 C;  3BCC E;  3GTE A;  3VCA A;  1O7G A;  1SQX E;  1L0L E;  3L72 E;  2B1X A;  2E74 D;  2XR8 A;  3CWB E;  2XSH A;  3VMH D;  5AEU A;  4QCK A;  2QJY C;  3VMG D;  1WW9 A;  1O7M A;  1ZRT E;  2NWF A;  1Z03 A;  4P1B H;  3VCP A;  4NB8 A;  4H0L D;  2HMK A;  2D2C D;  2HMN A;  1NTM E;  2HML A;  2I7F A;  5KLV E;  1SQV E;  2QPZ A;  3H1H E;  3N0Q A;  2DE6 D;  2FYN C;  4HM8 A;  1PPJ E;  4HM1 A;  4NBC D;  4HM3 A;  4NBE D;  3AZC A;  1ULI A;  4QUR A;  2XRX A;  3GCF A;  2YFJ A;  2E4P A;  3GB4 A;  3VMH A;  3VMG A;  4QDF B;  3DQY A;  1VF5 D;  3GZY A;  1NTZ E;  1KB9 E;  1O7N A;  2E75 D;  2JZA A;  1NDO A;  2NVF A;  1ULJ A;  1EZV E;  3CX5 E;  4HJL A;  2NVE A;  2JO6 A;  2NUM A;  3L75 E;  4NBA D;  4NBB D;  2HMJ A;  2ZYL A;  5AEW A;  3L74 E;  4QDC A;  1G8J B;  1L0N E;  3GL2 A;  1VM9 A;  3H1I E;  1JM1 A;  4NB9 D;  4U3F E;  2DE6 A;  4NBC A;  1O7W A;  1KYO E;  2QJK C;  4NBH D;  1WQL A;  4NBE A;  2IBZ E;  2YFL A;  4OGQ D;  3GL0 A;  3EQQ A;  3D89 A;  1Z01 A;  2CKF A;  2E76 D;  3GTS A;  2BMR A;  4EMJ B;  2DE7 D;  4NBG D;  1UUV A;  4HM4 A;  2Q3W A;  3H1L E;  3CXH E;  4HM5 A;  4HKV A;  3VMI D;  4HM6 A;  3EN1 A;  2FYU E;  3C0D A;  4NBA A;  4NBB A;  4AIV A;  1Z02 A;  2YFI A;  1NYK A;  2XSO A;  4NB9 A;  4PD4 E;  4HM2 A;  4HM7 A;  1FQT A;  3H1K E;  2HMO A;  4NBF D;  2BMQ A;  4NBH A;  2ZT9 D;  5CXM A;  4QUP A;  3L71 E;  4AAY B;  1RIE A;  2A06 E;  4NBD D;  2BMO A;  3GCE A;  2DE7 A;  3GKQ A;  4NBG A;  1PP9 E;  1O7H A;  2E4Q A;  4HM0 A;  2DE5 D;  5KKZ C;  5BOK A;  3VMI A;  1O7P A;  3TGU E;  4QDF A;  1SQQ E;  2BCC E;  1UUW A;  1P84 E;  2GBW A;  2QJP C;  1BCC E;  2B24 A;  1SQB E;  1RFS A;  4PV1 D;  4QDD A;  4NBF A;  3GOB A;  2NVG A;  2GBX A;  1SQP E;  4H13 D;  1BE3 E;  3FOU A;  3L73 E;  1VCK A;  5KLI C; 
#chains in the Genus database with same CATH topology
 3GKE A;  4NBD A;  5HL4 A;  2NUK A;  4NB8 D;  3GZX A;  1G8K B;  1EG9 A;  1NTK E;  2DE5 A;  2YVJ B;  4QUQ A;  4P1C H;  3H1J E;  4H44 D;  1NU1 E;  3L70 E;  1SJG A;  2YIU C;  2HMM A;  1Q90 C;  3BCC E;  3GTE A;  3VCA A;  1O7G A;  1SQX E;  1L0L E;  3L72 E;  2B1X A;  2E74 D;  2XR8 A;  3CWB E;  2XSH A;  3VMH D;  5AEU A;  4QCK A;  2QJY C;  3VMG D;  1WW9 A;  1O7M A;  1ZRT E;  2NWF A;  1Z03 A;  4P1B H;  3VCP A;  4NB8 A;  4H0L D;  2HMK A;  2D2C D;  2HMN A;  1NTM E;  2HML A;  2I7F A;  5KLV E;  1SQV E;  2QPZ A;  3H1H E;  3N0Q A;  2DE6 D;  2FYN C;  4HM8 A;  1PPJ E;  4HM1 A;  4NBC D;  4HM3 A;  4NBE D;  3AZC A;  1ULI A;  4QUR A;  2XRX A;  3GCF A;  2YFJ A;  2E4P A;  3GB4 A;  3VMH A;  3VMG A;  4QDF B;  3DQY A;  1VF5 D;  3GZY A;  1NTZ E;  1KB9 E;  1O7N A;  2E75 D;  2JZA A;  1NDO A;  2NVF A;  1ULJ A;  1EZV E;  3CX5 E;  4HJL A;  2NVE A;  2JO6 A;  2NUM A;  3L75 E;  4NBA D;  4NBB D;  2HMJ A;  2ZYL A;  5AEW A;  3L74 E;  4QDC A;  1G8J B;  1L0N E;  3GL2 A;  1VM9 A;  3H1I E;  1JM1 A;  4NB9 D;  4U3F E;  2DE6 A;  4NBC A;  1O7W A;  1KYO E;  2QJK C;  4NBH D;  1WQL A;  4NBE A;  2IBZ E;  2YFL A;  4OGQ D;  3GL0 A;  3EQQ A;  3D89 A;  1Z01 A;  2CKF A;  2E76 D;  3GTS A;  2BMR A;  4EMJ B;  2DE7 D;  4NBG D;  1UUV A;  4HM4 A;  2Q3W A;  3H1L E;  3CXH E;  4HM5 A;  4HKV A;  3VMI D;  4HM6 A;  3EN1 A;  2FYU E;  3C0D A;  4NBA A;  4NBB A;  4AIV A;  1Z02 A;  2YFI A;  1NYK A;  2XSO A;  4NB9 A;  4PD4 E;  4HM2 A;  4HM7 A;  1FQT A;  3H1K E;  2HMO A;  4NBF D;  2BMQ A;  4NBH A;  2ZT9 D;  5CXM A;  4QUP A;  3L71 E;  4AAY B;  1RIE A;  2A06 E;  4NBD D;  2BMO A;  3GCE A;  2DE7 A;  3GKQ A;  4NBG A;  1PP9 E;  1O7H A;  2E4Q A;  4HM0 A;  2DE5 D;  5KKZ C;  5BOK A;  3VMI A;  1O7P A;  3TGU E;  4QDF A;  1SQQ E;  2BCC E;  1UUW A;  1P84 E;  2GBW A;  2QJP C;  1BCC E;  2B24 A;  1SQB E;  1RFS A;  4PV1 D;  4QDD A;  4NBF A;  3GOB A;  2NVG A;  2GBX A;  1SQP E;  4H13 D;  1BE3 E;  3FOU A;  3L73 E;  1VCK A;  5KLI C; 
#chains in the Genus database with same CATH homology
 3GKE A;  4NBD A;  5HL4 A;  2NUK A;  4NB8 D;  3GZX A;  1G8K B;  1EG9 A;  1NTK E;  2DE5 A;  2YVJ B;  4QUQ A;  4P1C H;  3H1J E;  4H44 D;  1NU1 E;  3L70 E;  1SJG A;  2YIU C;  2HMM A;  1Q90 C;  3BCC E;  3GTE A;  3VCA A;  1O7G A;  1SQX E;  1L0L E;  3L72 E;  2B1X A;  2E74 D;  2XR8 A;  3CWB E;  2XSH A;  3VMH D;  5AEU A;  4QCK A;  2QJY C;  3VMG D;  1WW9 A;  1O7M A;  1ZRT E;  2NWF A;  1Z03 A;  4P1B H;  3VCP A;  4NB8 A;  4H0L D;  2HMK A;  2D2C D;  2HMN A;  1NTM E;  2HML A;  2I7F A;  5KLV E;  1SQV E;  2QPZ A;  3H1H E;  3N0Q A;  2DE6 D;  2FYN C;  4HM8 A;  1PPJ E;  4HM1 A;  4NBC D;  4HM3 A;  4NBE D;  3AZC A;  1ULI A;  4QUR A;  2XRX A;  3GCF A;  2YFJ A;  2E4P A;  3GB4 A;  3VMH A;  3VMG A;  4QDF B;  3DQY A;  1VF5 D;  3GZY A;  1NTZ E;  1KB9 E;  1O7N A;  2E75 D;  2JZA A;  1NDO A;  2NVF A;  1ULJ A;  1EZV E;  3CX5 E;  4HJL A;  2NVE A;  2JO6 A;  2NUM A;  3L75 E;  4NBA D;  4NBB D;  2HMJ A;  2ZYL A;  5AEW A;  3L74 E;  4QDC A;  1G8J B;  1L0N E;  3GL2 A;  1VM9 A;  3H1I E;  1JM1 A;  4NB9 D;  4U3F E;  2DE6 A;  4NBC A;  1O7W A;  1KYO E;  2QJK C;  4NBH D;  1WQL A;  4NBE A;  2IBZ E;  2YFL A;  4OGQ D;  3GL0 A;  3EQQ A;  3D89 A;  1Z01 A;  2CKF A;  2E76 D;  3GTS A;  2BMR A;  4EMJ B;  2DE7 D;  4NBG D;  1UUV A;  4HM4 A;  2Q3W A;  3H1L E;  3CXH E;  4HM5 A;  4HKV A;  3VMI D;  4HM6 A;  3EN1 A;  2FYU E;  3C0D A;  4NBA A;  4NBB A;  4AIV A;  1Z02 A;  2YFI A;  1NYK A;  2XSO A;  4NB9 A;  4PD4 E;  4HM2 A;  4HM7 A;  1FQT A;  3H1K E;  2HMO A;  4NBF D;  2BMQ A;  4NBH A;  2ZT9 D;  5CXM A;  4QUP A;  3L71 E;  4AAY B;  1RIE A;  2A06 E;  4NBD D;  2BMO A;  3GCE A;  2DE7 A;  3GKQ A;  4NBG A;  1PP9 E;  1O7H A;  2E4Q A;  4HM0 A;  2DE5 D;  5KKZ C;  5BOK A;  3VMI A;  1O7P A;  3TGU E;  4QDF A;  1SQQ E;  2BCC E;  1UUW A;  1P84 E;  2GBW A;  2QJP C;  1BCC E;  2B24 A;  1SQB E;  1RFS A;  4PV1 D;  4QDD A;  4NBF A;  3GOB A;  2NVG A;  2GBX A;  1SQP E;  4H13 D;  1BE3 E;  3FOU A;  3L73 E;  1VCK A;  5KLI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...