3L73E

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 38
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l73E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l73E02
5AEUA 1ZRTE 4HM6A 4H0LD 4AAYB 2BMQA 2BCCE 1WQLA 4QUQA 2E76D 1ULJA 4HM2A 4PV1D 3GL0A 4QDCA 3DQYA 3VMGD 2DE7D 2A06E 2GBXA 2JO6A 4NBCD 3CWBE 3GKEA 5KLIC 4OGQD 1KB9E 3L71E 4HJLA 4NBFD 2HMKA 3VMHD 2DE5D 1NTZE 2BMOA 5AEWA 2HMOA 1NTKE 3N0QA 1G8JB 3AZCA 4AIVA 1BGYE 4QDFA 1VM9A 4HM3A 5BOKA 3L72E 2E75D 1O7MA 2HMNA 2XSOA 2HMMA 2HMLA 3C0DA 4P1CH 4QCKA 4NB9D 3L74E 3BCCE 4HM7A 4HM0A 1NU1E 3EQQA 3GL2A 2B1XA 2BMRA 5KKZC 1VCKA 1Q90C 2E4QA 1L0LE 1EZVE 4NBBD 4HM5A 1O7HA 3EN1A 1FQTA 4HM1A 4NB8D 5CXMA 4HM8A 4EMJB 3H1JE 2NUMA 2JZAA 1RIEA 2FYNC 3VCAA 3CX5E 1NTME 3L70E 1RFSA 2ZYLA 3GOBA 1NDOA 1G8KB 1EG9A 1O7GA 1JM1A 3FOUA 1O7NA 1PP9E 4HKVA 2QJYC 2YFLA 2E4PA 1KYOE 2QPZA 4U3FE 2DE6D 2YFJA 1BE3E 5KLVE 2IBZE 4D6TE 1UUVA 2Q3WA 2I7FA 2QJKC 4P1BH 3GZXA 1O7WA 2NWFA 2NVEA 4NBAD 2GBWA 3VMID 1L0NE 1VF5D 4H44D 1PPJE 3H1HE 3L75E 3VCPA 1SQPE 3CXHE 3L73E 3D89A 4QDDA 2YIUC 4HM4A 4NBHD 1UUWA 2YVJB 2XSHA 3GTSA 2CKFA 2XR8A 5HL4A 1ULIA 4NBGD 3H1KE 1O7PA 3GZYA 4QDFB 2D2CD 3GCEA 3TGUE 4QURA 1SQQE 2B24A 3H1LE 1SJGA 2E74D 4NBDD 2NVFA 3H1IE 1BCCE 2XRXA 1SQVE 4NBED 1SQBE 4QUPA 2YFIA 2HMJA 1P84E 3GTEA 3GB4A 2ZT9D 2NUKA 2QJPC 4H13D 1NYKA 1SQXE 4PD4E 2FYUE 2NVGA
chains in the Genus database with same CATH superfamily
1W5CE 1IC2A 1N73A 4WY4C 1GL2A 3EWKA 1LTGC 2P2UA 2R5DA 3DQYA 2JO6A 1GL2D 3ABVC 1LTBC 1Q90D 4IL6X 2WPSA 2KUBA 2N1TB 1KTMA 1NTZE 3H32A 1S5LH 2HMOA 4JPZB 2ITAA 1RE3C 2FYZA 3BRTB 1X0TA 1GW4A 2K9JA 5KJ7A 3OW2O 1N7SC 4XA4A 5KJ7D 2C0XA 2JEEA 3L74D 3VCAA 2M3BA 5AW2B 1IFNA 3L70E 3HD7B 2POHA 1SLQA 4QMAA 2E76B 5AW5B 1NU1G 2K9JB 1VQ8P 3NFQA 4NBAD 1USDA 1T8ZA 4O9BA 2I8DA 1S2EA 3HRNA 1FZFA 2GUVA 2V4HA 4QURA 2ZXEB 1J1DB 1LTIC 2KIKA 5TISE 1T2KC 1MUUA 1MFTA 4L75A 4YXWH 1BSHA 1J1EB 1SQPG 2W83C 1KFMA 1NOHA 2QG4A 1JY2O 1SQXE 3A7OA 2RN0A 2QE7H 1KQSO 5AEUA 4GDOA 2MJZA 1KILC 4QUQA 1JOCA 5AVZB 1BCCJ 4PV1D 3EQ2A 1FDOA 1GU4A 1KFNA 1MV8A 1AA0A 1NTZJ 4GOEA 2JWDA 1T3JA 4JYCA 2Y9YA 5M1BA 1VQMP 1OX3A 1L4AA 2JDIH 3VOPA 1KB9D 5APYA 3GF3A 1L4AD 4PV1B 2B89A 1P84D 3L74E 1ZRTD 1PFIA 5KLIB 3L70J 3CL3D 5AVVB 2UWJE 1NTKG 3CXHI 2V7QH 3AEDC 4L73A 2FFDB 2NVEA 2YNYA 1JTHB 3L73E 4RJTA 1FZBA 5AW1B 4KHXA 2XSHA 3CCRP 2OYIC 4WY4A 4WY4D 3BRVB 2PAJA 2ZYAA 1LT1A 3TGUD 3G71P 2A45H 1SQXJ 2W8ZA 4Y99C 3GB4A 2FBWC 3NMDA 4RO0A 1RE3A 3CCUP 3B71A 3B5NC 2IZ0A 1SQVK 4YXDC 3H1HD 4CPGA 4GIFA 1L0NK 5KLVG 4IFMA 5APXA 3KXDA 1N7SA 1PGOA 2B9BA 1N7SD 1KB9E 2JO1A 4GT1A 4H13C 3VMHD 1BDCA 1KB9H 1QX8A 2BEQD 2HODA 5BU8B 4QDFA 1LTSC 1P84H 3VN0A 4N78D 3WUUA 4I7ZB 4PJ0E 3L74J 4QCKA 2M8RA 3GL2A 1QEXA 1VQPP 5AW7B 1N7SB 3M91A 1RE4C 1M56D 1S4XA 1YTZT 1UIXA 1FQTA 2ZT9B 2NUMA 2RKLA 1GZLA 3CCSP 1HH0A 2HODB 5DJUB 1LWUC 2YFLA 5KLVE 3V4QA 4C7NA 3I5CA 4I6MC 3L73J 1GK6A 1T2KD 1FJPA 1UUWA 3HE4A 3AEAC 3LIDA 3VYIA 2LXCB 1KILA 2Y9ZA 4UB8E 2D2CD 3TGUE 3LIEA 2QM8A 1FBMA 1E79H 1KILD 3KQGA 4H44C 4C7NB 2OYHC 3SSUA 1CI6A 4N3YB 5CBNA 2OTJP 1JY3O 3VTPC 1SQVD 2ZXXA 1OW8A 3HE4B 1L0ND 1FDMA 1SQBK 1AQ5A 4Z1MH 2YMKA 5E79E 2LR2A 5E79H 1OFCX 1CI6B 3MTUE 1JCCA 4IFDK 1RQVA 2KP8A 2Y0EA 3HUSB 1O7MA 2E74B 2JR8A 2CPSA 3SWKA 1KQGB 3RK3E 3OAKA 3RBZA 2GUSA 3GLMA 4NBBD 4HM5A 4R4LA 2XKMA 1RFSA 3GOBA 2OYIA 4JF7A 1FC2C 5C39A 3MHVA 3D71A 3TDKA 1FU1A 1OVUA 1NVOA 1Q86Q 4QDDA 1KILE 3N7NA 1VQ7P 2XR8A 3TGUJ 1ULIA 2OYIB 1BE3G 5B66E 1K04A 1SQVE 2ZFCA 3II6A 1DD3A 1PPJG 1YI2P 1QL1A 4H13D 1X8YA 1NYKA 1Q82Q 2Q1KA 1SQBD 1VL2A 3B5NB 1QVGO 3H1IG 3GL0A 4QDCA 2IBZI 5BU5A 1RE4A 2BASA 1LP1A 1VF5B 1M1JC 3MD0A 4TLFA 2VRSA 3RGUA 1NO4A 1KORA 2WSSH 4H0LC 1LWUA 2YO2A 1FZEA 1JY2N 1LNQA 4B86A 1IZNB 4HM7A 1RY3A 3AE8C 2C9LY 2ZAEB 1VPCA 1LP1B 4JYBA 3L71G 1X9VA 5CXMA 4K35A 3WU2E 4XFJA 1BGYG 1NU1K 1QL2A 2ZVNB 4Y28J 2QJYC 2FXPA 1S3JA 3PP5A 1E5WA 2OYHA 3CWBG 1DH3A 4H44D 4U3FD 3E1RA 1GTWA 4D6TD 5CMZA 2WT7A 4YPCA 3JSVC 1L4AC 3GZYA 1ZR4A 1SQVJ 1GD2E 3AE3C 1L0NJ 1SQBE 2HLOA 2OARA 4QUPA 2HR3A 2AEMA 1IFDA 4IL6E 3FWLA 3CCJP 5CCHC 2NVGA 3G4SP 1A02J 2WT7B 4GKGA 3V5BA 2YXRB 1KD1Q 1ZLLA 2HFED 1PZQA 2M5AA 4WB4A 4LC1A 3FWNA 2OGUA 1H0TA 2GBXA 2WVRA 3CWBE 2IDBA 3EFGA 5EFWB 1ZXGA 1SFCC 1PV3A 2KLUA 2FYUG 2MKVA 3A3YB 3N4XA 4W80A 3H1KG 1M8OB 2M3EA 2CPBA 2HMLA 2M0BA 1URQC 1SQXD 1HGZA 2WQYC 2A06G 1NTKK 3CC4P 1NYHA 1EZVE 4NPEA 5APTA 2P1JA 2Z5HA 2Q3IA 1M7LA 1JEKA 1NU1D 5KTBA 3C9IA 1O7GA 3VMXA 1U57A 3L72G 4U3FE 1N73B 4D6TE 2XZRA 2Q3WA 1GL2B 1T3UA 2Q6QA 2Z4EA 1AQTA 3AE6C 3H1JG 1NTMG 1LTJC 3H32B 1EDIA 3TNUA 3O6QA 5AVYB 3H1KE 1O7PA 3SWFA 4TT3H 1SQBJ 5AVXB 1M1JA 2I1JA 3D6YA 1WRGA 2W6AA 1Q81Q 3RK3C 2NUKA 1FJKA 3R4YA 5KLVK 2H88C 4KT0J 4XE5B 2XDJA 1LTTC 1JB0J 4H0LD 3L73D 4PD4D 1PGJA 3HTKA 1S5LX 2KI7B 4HYTB 3G9RA 5TISH 4ZKUA 1VQKP 3BVHA 2BMOA 2O1JA 4BRYA 1G2CA 4H0LB 2D2CC 1JY3N 2HMNA 4P1CH 4HJGH 1NTKD 1NU1E 5KKZC 3HTKB 2B87A 3V2NA 2J58A 3WMM0 1JM1A 3S9OA 1NWQA 4BRYB 4U3FJ 3I55P 4D6TJ 2DE6D 1YHQP 3S4RA 3A0HE 1O7WA 1SS1A 5APQA 1FZCC 3GF7A 2IZ1A 3U1CA 2WPQA 3M9BA 2HPCA 1D7MA 5CCHA 1SQPE 3CXHE 5CCHD 1IFIA 5CJ4A 1OVVA 1L4AB 2JJLA 1H89A 2AEFA 3RL0D 1MZ9A 1YTZI 3L35A 2XV5A 1SFCA 5KLVD 4PD4E 4R4MA 1SFCD 1HJ0A 4PD4H 2HG5D 1AFOA 2WSFH 1URQA 2J5UA 4NBCD 4DT0A 1URQD 2FXMA 2OYOA 3GKEA 3OA7A 1G1JA 2Y0CA 3L75G 1SFCB 3VMYA 1NTKE 1G8JB 4AIVA 2QJPB 4UB6E 4UB6H 1NU1J 2NPSC 3CD6P 1YJNP 4HM0A 4WY4B 2Q3EA 3MGNA 1RF1C 2IFMA 2Q5UA 1HTLC 2A45I 3W68A 1LTJA 4RESB 3VMZA 1VQOP 2DW3A 3FXDA 2KSEA 2E42A 1CSBA 3BCCG 4PJ0H 2QJKC 2KOGA 2Y0DA 2KZJA 1L0LG 1SQPJ 3L75E 2O3JA 3D89A 4HM4A 1KB9I 1FZGA 3VP9A 3F89A 4WBAA 1FOSE 1P84I 3RK3D 1HGVA 5AW0B 2WWWA 3Q1MA 4QDFB 1IFJA 1EDJA 1PGPA 1DEEG 2QEXP 1HJBA 1LT9C 3H1HG 3IF4A 2Q7CA 4ASWA 2P58A 2LXBA 3K5BA 3RK3B 5AW4B 2WSFJ 4IOIH 2K37A 3KDPB 2BMQA 1SQQG 3HE5A 3IR9A 4KJMA 1MKMA 1M90Q 4UB8H 4RKUJ 4NPDA 3TF5A 2BEZF 4OGQD 2P67A 4NBFD 1OXZA 4OWFA 1NTKJ 3CLQA 2DE5D 1A02F 1M57D 2D2CB 3IFMA 2BCCG 5CBOA 1KILB 2H8PD 2LKMA 3H1LG 1GU5A 2B1XA 2BMRA 1FZCA 5KKZB 2E4QA 1NKZB 1VQ9P 3CC2P 4W7YA 1KC8Q 1GW3A 3JC22 3IAOA 4W7ZA 3U59A 1HF9A 2N9YB 1EXJA 1KYOE 2P7JA 1USEA 3Q5PA 4JBZA 3V2QA 2JWAA 1FZCB 2NWFA 1VQ5P 1JY2P 2IFNA 1ZW0A 1BE3D 5AW9B 1N8RQ 1W2EA 3M0AA 1N86A 2CKFA 1EC5A 1PP9G 4NBGD 1FS0E 2N9BA 3U1AA 2L5GB 3A5TA 5KLVJ 3IN6A 3H1LE 2IBZG 5L8RJ 3B8EB 2KK7A 2N1TC 3AE9C 4L76A 3H1ID 1FZAA 1EQ7A 1H88A 1JCDA 2NPSA 3KZIE 2GM4A 2PRRA 1RF1A 2NPSD 2YKOA 5B66H 2FYUK 3TK1A 1FAVA 2I1KA 1K9MQ 4GODA 3HD7C 2NZ2A 4Y99B 2ZYGA 2XNXA 2E76C 4IFFA 3D6ZA 3CCMP 1BGYD 3M9HA 3USSA 3EN1A 3W67A 2KZIA 4H13B 1S9KE 1U7JA 1RIEA 1NDOA 5AW6B 1O7NA 3CWBD 4HKVA 1J1DC 5DJTB 5AVUB 4YTPC 1BE3E 1GDTA 2KYVA 1DEBA 2XNDH 3CCQP 2QJKB 4BXLA 3CCEP 1NTMK 3C8VA 1LT9A 1J1EC 1PPJE 2YMYA 3FXEA 3KYQA 4NBHD 2YVJB 5CCGC 3GTSA 3WU2H 1EZVD 1LWUB 2WSEH 4K3AA 1NJIQ 3H1IE 2XRXA 3O8ZA 4NBED 3CCVP 1SP4A 4MN4C 1LT9B 3AE5C 3GTEA 3AECC 3AEFC 1VQ4P 1JMMA 1QVFO 2RH0A 2H7HA 3WUVA 1AJYA 4HM2A 2FYUD 1SQPK 1T6AA 5AW8B 2R32A 3PH0A 2B88A 4H44B 2OYHB 3H1KD 2Q9IA 5KLIC 3L71E 5KAFE 3TYYA 3CCLP 2HYNA 3SFDC 1BDDA 5KAFH 2A06D 1BGYE 3AE2C 4IL6H 1JM0A 1M1KQ 1XTGB 1RF0C 1JUNA 1SVFA 3RL0C 2FFDC 1BCCG 3P8MC 1CW5A 3L72D 3E1IA 2KNCA 4HM1A 4HM8A 1R5SA 2IYOA 3S1KA 1NTZG 3CX5E 1K73Q 4WWIA 3VMAA 2E75C 5AVQB 1R8EA 3L36A 1BE3J 1NAYA 1WMKA 2QIWA 3H1JD 3PLNA 3ZDMA 1H8AA 1NTMD 3SFEC 2M5AB 1N7LA 1EXIA 2N1TA 1H0TB 2GBWA 1EDKA 1S72P 4C7RA 1JY3P 1AVOA 2N1TD 3L70G 2WSEJ 2AEJA 1PGQA 4AYCA 1WT6A 3H1IJ 2H89C 1BCCE 1DIPA 1K05A 2JKVA 4DCKA 1OWAA 2QRXA 1S5LE 1U7MA 2YFIA 2IX7C 1KQFB 3HD7A 5B5EE 1EZVI 2AXCA 3BATA 1OIPA 1IFMA 1J2JB 3NTNA 2FYUE 5B5EH 3HD7D 3GW6A 4I7ZC 3RL0g 3AE1C 2O01H 2QA4P 2E76D 1SQPD 3CXHD 3L4FA 1ULJA 3P7KA 3CPWO 2A06E 3L71J 1LGHB 2ZT9C 1Q7YQ 1BGYJ 1SQXG 3AZCA 2PGDA 4DZOA 2YKPA 3L72E 2KB7P 2R5BA 2HMMA 3TNUB 3O6QB 4NB9D 2WMMA 4GOFA 3V4WA 2KXPB 3CWBJ 1IFPA 3MP7B 4C46A 1M1JB 3H1JE 1NTME 5CCGA 2QVAA 3M0DC 2ZYLA 3FOUA 2K3RA 3B4SA 5CCGD 1JO5A 1L0LK 1PL5A 3L74G 4P1BH 1RHZB 1DX7A 3KPEA 4OGQC 2WITA 1OMIA 2C9NY 2O1KA 3A2AA 1AV1A 1G2CB 2QJYB 1Y47A 3P8CD 3I56P 1XTCC 2E5YA 1HUCA 5CJ0A 3A0HH 5H2FE 3GMAA 3T97A 3L73G 2B87B 2FYUJ 5K5GB 1SQQK 1FOSF 5H2FH 2O01J 3AE4C 1JNMA 3M9QA 2IYPA 3CXHH 3H1KJ 1QLED 3HUSC 1RF0A 4N6JA 2E74C 1WQLA 3L75D 1Q2NA 1QGKB 3PTZA 1IK9A 4DOJA 2FFDA 1LTAC 4EYYQ 2A45G 1JTHA 2P10A 3PRJA 4LGDE 4ZNCA 2HPCB 3WUTA 3AEEC 3T97B 1OVRA 5AEWA 3N0QA 3CMAP 4AUWA 3L72J 2W6BA 2E75D 2K1AA 4EOTA 1VCKA 3RL0B 2H43A 1YQ4C 4HKZH 4EI2A 1O7HA 2YKQA 3H1JJ 4NB8D 1NTMJ 3BCCD 2JZAA 2FYNC 3CMEP 2FY8A 2E75B 1L0LD 3SWYA 4PD4I 1NH4A 2E4PA 1KZUB 2KSJA 1ZOYC 3FGAD 2KS1A 3Q3DA 1UUVA 2WZ7A 2IPPA 1Y8AA 1VQ6P 1URQB 5AVTB 3V2RA 3VMID 2K9YA 5APWA 1NHLA 1ZN5A 2CK3H 3P32A 3P8CE 5KAIE 2JP3A 1YIJP 1OW7A 5KAIH 3NXSA 5HL4A 2R3SA 5TJHA 2XU6A 2G8YA 4EDFA 4AQRD 2B24A 1SJGA 4NBDD 4OVNF 2KS1B 1HBWA 1VF5C 4M3LA 1IO4A 2QM7A 2HMJA 1SQQD 1KYOD 4HH2A 4A7PA 1P84E 2ZT9D 2OQQA 1LTJB 5BVZA 1ZRTE 4HM6A 4AAYB 3TGUG 3ITKA 1YJ9P 1X79B 1ZR2A 2DE7D 1HWTC 3KHUA 4DJGA 1VDFA 2BCCD 2L91A 2V7QJ 2WSCH 4HJLA 2HMKA 3H1LD 2O01N 2PP6A 1YITP 3M0DA 5AVSB 1W2BO 4L74A 1YJWP 3FX0A 1EDLA 2XSOA 3C0DA 1LJ2A 1MFZA 3BCCE 3EQQA 5AVWB 3F5HA 1L0LE 2YO3A 2WPVB 1ZP0C 4I1LA 1RH5B 1OZHA 3GHGC 3CI9A 1TU3F 3OJAB 2W6JH 2I7FA 3HE5B 1CZQA 3GZXA 3QH9A 2ZVOB 1GMJA 1PP9D 4OGQB 1YBKA 2NRGA 3H1HE 1KV4A 1G1IA 2IBZD 1Y9BA 2YIUC 1IJDB 4LLHA 3GG2A 2C0WA 1PIXA 3Q5RA 2WTYA 3HUSA 2SPZA 4U7JA 2OTLP 5GTHE 1SQQE 3RK2C 2E74D 2R3CA 3AEBC 1S9KD 3EFFK 5GTHH 1KYOH 2YXQB 4I2LC 3MUDC 1JMBA 3L37A 4N78E 4JQ0D 3BASA 3L75J 5AW3B 3R2PA 3AEGC 2WPRA 3MIWA 2BCCE 2KLVA 1PPJD 1R5LA 1KYOI 2WSCJ 4HB1A 1Z56A 1SQVG 2QSIA 1L0NG 3RBXA 4NPFX 4HM3A 2E43A 4ZMDA 3D70A 1N73C 3BCCJ 1KMIZ 1GL2C 1L0LJ 1Q90C 1NTZK 3KZIH 2ZJSE 1ZMEC 2W90A 1UIIA 3VP8A 1KQLA 1AVYA 2FYNB 3B5NA 3LW5H 1RQUA 1PP9E 3B5ND 2QPZA 3L71D 2YFJA 2IBZE 3AE7C 2NPSB 2G3AA 3M06A 2RMZA 1S1CX 2ZYDA 5KJ7C 5AVRB 3PHLA 3H1HJ 2E5TA 1RF1B 1L0NE 1VF5D 3VCPA 1SQQJ 2W27A 3CC7P 2R44A 2NVFA 3CX5D 1FDIA 1GK4A 4ZKPA 5GTIE 3A0BE 2GA1A 3C1LA 5GTIH 3A0BH 3QWOC 5APVA 3G6EP 2BCCJ 1YQ3C 2FXOA 3H1LJ 3H6PA 3VMGD 1SQXK 1SQBG 3V6IA 1OW6A 2K88A 1BCCD 1K8AQ 3GHGA 3Q5SA 3H25A 1VM9A 5BOKA 5CHXA 4PV1C 4WVZA 2AXTE 1NTZD 2FKWB 2AXTH 3MZWB 3G3ZA 3LW5J 1NGMB 5APSA 4EMJB 3PJSK 1PP9J 1G8KB 1EG9A 3GHGB 1N2DC 1NKNA 1KN7A 1YYCA 1NAFA 2PFXA 2OTKE 3L70D 3JCUE 3MUDA 1IK7A 3RK2D 3JCUH 1EZVG 1VQNP 4EIJA 3V2PA 4BWNA 3TSIA 1FE6A 2YIUB 5APUA 1X22A 1L2PA 3E7KA 3CX5H 3GCEA 4U3FG 2Z5IA 4OH8B 1HVVA 3RK2B 4D6TG 2J59M 3UIAA 1DD4A 4ASVA 2KNCB 2QJPC 1BSNA 1VQLP 1ZV8A 3Q2YA 3CX5I
chains in the Genus database with same CATH topology
5AEUA 1ZRTE 4HM6A 4H0LD 4AAYB 2BMQA 2BCCE 1WQLA 4QUQA 2E76D 1ULJA 4HM2A 4PV1D 3GL0A 4QDCA 3DQYA 3VMGD 2DE7D 2A06E 2GBXA 2JO6A 4NBCD 3CWBE 3GKEA 5KLIC 4OGQD 1KB9E 3L71E 4HJLA 4NBFD 2HMKA 3VMHD 2DE5D 1NTZE 2BMOA 5AEWA 2HMOA 1NTKE 3N0QA 1G8JB 3AZCA 4AIVA 1BGYE 4QDFA 1VM9A 4HM3A 5BOKA 3L72E 2E75D 1O7MA 2HMNA 2XSOA 2HMMA 2HMLA 3C0DA 4P1CH 4QCKA 4NB9D 3L74E 3BCCE 4HM7A 4HM0A 1NU1E 3EQQA 3GL2A 2B1XA 2BMRA 5KKZC 1VCKA 1Q90C 2E4QA 1L0LE 1EZVE 4NBBD 4HM5A 1O7HA 3EN1A 1FQTA 4HM1A 4NB8D 5CXMA 4HM8A 4EMJB 3H1JE 2NUMA 2JZAA 1RIEA 2FYNC 3VCAA 3CX5E 1NTME 3L70E 1RFSA 2ZYLA 3GOBA 1NDOA 1G8KB 1EG9A 1O7GA 1JM1A 3FOUA 1O7NA 1PP9E 4HKVA 2QJYC 2YFLA 2E4PA 1KYOE 2QPZA 4U3FE 2DE6D 2YFJA 1BE3E 5KLVE 2IBZE 4D6TE 1UUVA 2Q3WA 2I7FA 2QJKC 4P1BH 3GZXA 1O7WA 2NWFA 2NVEA 4NBAD 2GBWA 3VMID 1L0NE 1VF5D 4H44D 1PPJE 3H1HE 3L75E 3VCPA 1SQPE 3CXHE 3L73E 3D89A 4QDDA 2YIUC 4HM4A 4NBHD 1UUWA 2YVJB 2XSHA 3GTSA 2CKFA 2XR8A 5HL4A 1ULIA 4NBGD 3H1KE 1O7PA 3GZYA 4QDFB 2D2CD 3GCEA 3TGUE 4QURA 1SQQE 2B24A 3H1LE 1SJGA 2E74D 4NBDD 2NVFA 3H1IE 1BCCE 2XRXA 1SQVE 4NBED 1SQBE 4QUPA 2YFIA 2HMJA 1P84E 3GTEA 3GB4A 2ZT9D 2NUKA 2QJPC 4H13D 1NYKA 1SQXE 4PD4E 2FYUE 2NVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEU A;  1ZRT E;  4HM6 A;  4H0L D;  4AAY B;  2BMQ A;  2BCC E;  1WQL A;  4QUQ A;  2E76 D;  1ULJ A;  4HM2 A;  4PV1 D;  3GL0 A;  4QDC A;  3DQY A;  3VMG D;  2DE7 D;  2A06 E;  2GBX A;  2JO6 A;  4NBC D;  3CWB E;  3GKE A;  5KLI C;  4OGQ D;  1KB9 E;  3L71 E;  4HJL A;  4NBF D;  2HMK A;  3VMH D;  2DE5 D;  1NTZ E;  2BMO A;  5AEW A;  2HMO A;  1NTK E;  3N0Q A;  1G8J B;  3AZC A;  4AIV A;  1BGY E;  4QDF A;  1VM9 A;  4HM3 A;  5BOK A;  3L72 E;  2E75 D;  1O7M A;  2HMN A;  2XSO A;  2HMM A;  2HML A;  3C0D A;  4P1C H;  4QCK A;  4NB9 D;  3L74 E;  3BCC E;  4HM7 A;  4HM0 A;  1NU1 E;  3EQQ A;  3GL2 A;  2B1X A;  2BMR A;  5KKZ C;  1VCK A;  1Q90 C;  2E4Q A;  1L0L E;  1EZV E;  4NBB D;  4HM5 A;  1O7H A;  3EN1 A;  1FQT A;  4HM1 A;  4NB8 D;  5CXM A;  4HM8 A;  4EMJ B;  3H1J E;  2NUM A;  2JZA A;  1RIE A;  2FYN C;  3VCA A;  3CX5 E;  1NTM E;  3L70 E;  1RFS A;  2ZYL A;  3GOB A;  1NDO A;  1G8K B;  1EG9 A;  1O7G A;  1JM1 A;  3FOU A;  1O7N A;  1PP9 E;  4HKV A;  2QJY C;  2YFL A;  2E4P A;  1KYO E;  2QPZ A;  4U3F E;  2DE6 D;  2YFJ A;  1BE3 E;  5KLV E;  2IBZ E;  4D6T E;  1UUV A;  2Q3W A;  2I7F A;  2QJK C;  4P1B H;  3GZX A;  1O7W A;  2NWF A;  2NVE A;  4NBA D;  2GBW A;  3VMI D;  1L0N E;  1VF5 D;  4H44 D;  1PPJ E;  3H1H E;  3L75 E;  3VCP A;  1SQP E;  3CXH E;  3L73 E;  3D89 A;  4QDD A;  2YIU C;  4HM4 A;  4NBH D;  1UUW A;  2YVJ B;  2XSH A;  3GTS A;  2CKF A;  2XR8 A;  5HL4 A;  1ULI A;  4NBG D;  3H1K E;  1O7P A;  3GZY A;  4QDF B;  2D2C D;  3GCE A;  3TGU E;  4QUR A;  1SQQ E;  2B24 A;  3H1L E;  1SJG A;  2E74 D;  4NBD D;  2NVF A;  3H1I E;  1BCC E;  2XRX A;  1SQV E;  4NBE D;  1SQB E;  4QUP A;  2YFI A;  2HMJ A;  1P84 E;  3GTE A;  3GB4 A;  2ZT9 D;  2NUK A;  2QJP C;  4H13 D;  1NYK A;  1SQX E;  4PD4 E;  2FYU E;  2NVG A; 
#chains in the Genus database with same CATH topology
 1W5C E;  1IC2 A;  1N73 A;  4WY4 C;  1GL2 A;  3EWK A;  1LTG C;  2P2U A;  2R5D A;  3DQY A;  2JO6 A;  1GL2 D;  3ABV C;  1LTB C;  1Q90 D;  4IL6 X;  2WPS A;  2KUB A;  2N1T B;  1KTM A;  1NTZ E;  3H32 A;  1S5L H;  2HMO A;  4JPZ B;  2ITA A;  1RE3 C;  2FYZ A;  3BRT B;  1X0T A;  1GW4 A;  2K9J A;  5KJ7 A;  3OW2 O;  1N7S C;  4XA4 A;  5KJ7 D;  2C0X A;  2JEE A;  3L74 D;  3VCA A;  2M3B A;  5AW2 B;  1IFN A;  3L70 E;  3HD7 B;  2POH A;  1SLQ A;  4QMA A;  2E76 B;  5AW5 B;  1NU1 G;  2K9J B;  1VQ8 P;  3NFQ A;  4NBA D;  1USD A;  1T8Z A;  4O9B A;  2I8D A;  1S2E A;  3HRN A;  1FZF A;  2GUV A;  2V4H A;  4QUR A;  2ZXE B;  1J1D B;  1LTI C;  2KIK A;  5TIS E;  1T2K C;  1MUU A;  1MFT A;  4L75 A;  4YXW H;  1BSH A;  1J1E B;  1SQP G;  2W83 C;  1KFM A;  1NOH A;  2QG4 A;  1JY2 O;  1SQX E;  3A7O A;  2RN0 A;  2QE7 H;  1KQS O;  5AEU A;  4GDO A;  2MJZ A;  1KIL C;  4QUQ A;  1JOC A;  5AVZ B;  1BCC J;  4PV1 D;  3EQ2 A;  1FDO A;  1GU4 A;  1KFN A;  1MV8 A;  1AA0 A;  1NTZ J;  4GOE A;  2JWD A;  1T3J A;  4JYC A;  2Y9Y A;  5M1B A;  1VQM P;  1OX3 A;  1L4A A;  2JDI H;  3VOP A;  1KB9 D;  5APY A;  3GF3 A;  1L4A D;  4PV1 B;  2B89 A;  1P84 D;  3L74 E;  1ZRT D;  1PFI A;  5KLI B;  3L70 J;  3CL3 D;  5AVV B;  2UWJ E;  1NTK G;  3CXH I;  2V7Q H;  3AED C;  4L73 A;  2FFD B;  2NVE A;  2YNY A;  1JTH B;  3L73 E;  4RJT A;  1FZB A;  5AW1 B;  4KHX A;  2XSH A;  3CCR P;  2OYI C;  4WY4 A;  4WY4 D;  3BRV B;  2PAJ A;  2ZYA A;  1LT1 A;  3TGU D;  3G71 P;  2A45 H;  1SQX J;  2W8Z A;  4Y99 C;  3GB4 A;  2FBW C;  3NMD A;  4RO0 A;  1RE3 A;  3CCU P;  3B71 A;  3B5N C;  2IZ0 A;  1SQV K;  4YXD C;  3H1H D;  4CPG A;  4GIF A;  1L0N K;  5KLV G;  4IFM A;  5APX A;  3KXD A;  1N7S A;  1PGO A;  2B9B A;  1N7S D;  1KB9 E;  2JO1 A;  4GT1 A;  4H13 C;  3VMH D;  1BDC A;  1KB9 H;  1QX8 A;  2BEQ D;  2HOD A;  5BU8 B;  4QDF A;  1LTS C;  1P84 H;  3VN0 A;  4N78 D;  3WUU A;  4I7Z B;  4PJ0 E;  3L74 J;  4QCK A;  2M8R A;  3GL2 A;  1QEX A;  1VQP P;  5AW7 B;  1N7S B;  3M91 A;  1RE4 C;  1M56 D;  1S4X A;  1YTZ T;  1UIX A;  1FQT A;  2ZT9 B;  2NUM A;  2RKL A;  1GZL A;  3CCS P;  1HH0 A;  2HOD B;  5DJU B;  1LWU C;  2YFL A;  5KLV E;  3V4Q A;  4C7N A;  3I5C A;  4I6M C;  3L73 J;  1GK6 A;  1T2K D;  1FJP A;  1UUW A;  3HE4 A;  3AEA C;  3LID A;  3VYI A;  2LXC B;  1KIL A;  2Y9Z A;  4UB8 E;  2D2C D;  3TGU E;  3LIE A;  2QM8 A;  1FBM A;  1E79 H;  1KIL D;  3KQG A;  4H44 C;  4C7N B;  2OYH C;  3SSU A;  1CI6 A;  4N3Y B;  5CBN A;  2OTJ P;  1JY3 O;  3VTP C;  1SQV D;  2ZXX A;  1OW8 A;  3HE4 B;  1L0N D;  1FDM A;  1SQB K;  1AQ5 A;  4Z1M H;  2YMK A;  5E79 E;  2LR2 A;  5E79 H;  1OFC X;  1CI6 B;  3MTU E;  1JCC A;  4IFD K;  1RQV A;  2KP8 A;  2Y0E A;  3HUS B;  1O7M A;  2E74 B;  2JR8 A;  2CPS A;  3SWK A;  1KQG B;  3RK3 E;  3OAK A;  3RBZ A;  2GUS A;  3GLM A;  4NBB D;  4HM5 A;  4R4L A;  2XKM A;  1RFS A;  3GOB A;  2OYI A;  4JF7 A;  1FC2 C;  5C39 A;  3MHV A;  3D71 A;  3TDK A;  1FU1 A;  1OVU A;  1NVO A;  1Q86 Q;  4QDD A;  1KIL E;  3N7N A;  1VQ7 P;  2XR8 A;  3TGU J;  1ULI A;  2OYI B;  1BE3 G;  5B66 E;  1K04 A;  1SQV E;  2ZFC A;  3II6 A;  1DD3 A;  1PPJ G;  1YI2 P;  1QL1 A;  4H13 D;  1X8Y A;  1NYK A;  1Q82 Q;  2Q1K A;  1SQB D;  1VL2 A;  3B5N B;  1QVG O;  3H1I G;  3GL0 A;  4QDC A;  2IBZ I;  5BU5 A;  1RE4 A;  2BAS A;  1LP1 A;  1VF5 B;  1M1J C;  3MD0 A;  4TLF A;  2VRS A;  3RGU A;  1NO4 A;  1KOR A;  2WSS H;  4H0L C;  1LWU A;  2YO2 A;  1FZE A;  1JY2 N;  1LNQ A;  4B86 A;  1IZN B;  4HM7 A;  1RY3 A;  3AE8 C;  2C9L Y;  2ZAE B;  1VPC A;  1LP1 B;  4JYB A;  3L71 G;  1X9V A;  5CXM A;  4K35 A;  3WU2 E;  4XFJ A;  1BGY G;  1NU1 K;  1QL2 A;  2ZVN B;  4Y28 J;  2QJY C;  2FXP A;  1S3J A;  3PP5 A;  1E5W A;  2OYH A;  3CWB G;  1DH3 A;  4H44 D;  4U3F D;  3E1R A;  1GTW A;  4D6T D;  5CMZ A;  2WT7 A;  4YPC A;  3JSV C;  1L4A C;  3GZY A;  1ZR4 A;  1SQV J;  1GD2 E;  3AE3 C;  1L0N J;  1SQB E;  2HLO A;  2OAR A;  4QUP A;  2HR3 A;  2AEM A;  1IFD A;  4IL6 E;  3FWL A;  3CCJ P;  5CCH C;  2NVG A;  3G4S P;  1A02 J;  2WT7 B;  4GKG A;  3V5B A;  2YXR B;  1KD1 Q;  1ZLL A;  2HFE D;  1PZQ A;  2M5A A;  4WB4 A;  4LC1 A;  3FWN A;  2OGU A;  1H0T A;  2GBX A;  2WVR A;  3CWB E;  2IDB A;  3EFG A;  5EFW B;  1ZXG A;  1SFC C;  1PV3 A;  2KLU A;  2FYU G;  2MKV A;  3A3Y B;  3N4X A;  4W80 A;  3H1K G;  1M8O B;  2M3E A;  2CPB A;  2HML A;  2M0B A;  1URQ C;  1SQX D;  1HGZ A;  2WQY C;  2A06 G;  1NTK K;  3CC4 P;  1NYH A;  1EZV E;  4NPE A;  5APT A;  2P1J A;  2Z5H A;  2Q3I A;  1M7L A;  1JEK A;  1NU1 D;  5KTB A;  3C9I A;  1O7G A;  3VMX A;  1U57 A;  3L72 G;  4U3F E;  1N73 B;  4D6T E;  2XZR A;  2Q3W A;  1GL2 B;  1T3U A;  2Q6Q A;  2Z4E A;  1AQT A;  3AE6 C;  3H1J G;  1NTM G;  1LTJ C;  3H32 B;  1EDI A;  3TNU A;  3O6Q A;  5AVY B;  3H1K E;  1O7P A;  3SWF A;  4TT3 H;  1SQB J;  5AVX B;  1M1J A;  2I1J A;  3D6Y A;  1WRG A;  2W6A A;  1Q81 Q;  3RK3 C;  2NUK A;  1FJK A;  3R4Y A;  5KLV K;  2H88 C;  4KT0 J;  4XE5 B;  2XDJ A;  1LTT C;  1JB0 J;  4H0L D;  3L73 D;  4PD4 D;  1PGJ A;  3HTK A;  1S5L X;  2KI7 B;  4HYT B;  3G9R A;  5TIS H;  4ZKU A;  1VQK P;  3BVH A;  2BMO A;  2O1J A;  4BRY A;  1G2C A;  4H0L B;  2D2C C;  1JY3 N;  2HMN A;  4P1C H;  4HJG H;  1NTK D;  1NU1 E;  5KKZ C;  3HTK B;  2B87 A;  3V2N A;  2J58 A;  3WMM 0;  1JM1 A;  3S9O A;  1NWQ A;  4BRY B;  4U3F J;  3I55 P;  4D6T J;  2DE6 D;  1YHQ P;  3S4R A;  3A0H E;  1O7W A;  1SS1 A;  5APQ A;  1FZC C;  3GF7 A;  2IZ1 A;  3U1C A;  2WPQ A;  3M9B A;  2HPC A;  1D7M A;  5CCH A;  1SQP E;  3CXH E;  5CCH D;  1IFI A;  5CJ4 A;  1OVV A;  1L4A B;  2JJL A;  1H89 A;  2AEF A;  3RL0 D;  1MZ9 A;  1YTZ I;  3L35 A;  2XV5 A;  1SFC A;  5KLV D;  4PD4 E;  4R4M A;  1SFC D;  1HJ0 A;  4PD4 H;  2HG5 D;  1AFO A;  2WSF H;  1URQ A;  2J5U A;  4NBC D;  4DT0 A;  1URQ D;  2FXM A;  2OYO A;  3GKE A;  3OA7 A;  1G1J A;  2Y0C A;  3L75 G;  1SFC B;  3VMY A;  1NTK E;  1G8J B;  4AIV A;  2QJP B;  4UB6 E;  4UB6 H;  1NU1 J;  2NPS C;  3CD6 P;  1YJN P;  4HM0 A;  4WY4 B;  2Q3E A;  3MGN A;  1RF1 C;  2IFM A;  2Q5U A;  1HTL C;  2A45 I;  3W68 A;  1LTJ A;  4RES B;  3VMZ A;  1VQO P;  2DW3 A;  3FXD A;  2KSE A;  2E42 A;  1CSB A;  3BCC G;  4PJ0 H;  2QJK C;  2KOG A;  2Y0D A;  2KZJ A;  1L0L G;  1SQP J;  3L75 E;  2O3J A;  3D89 A;  4HM4 A;  1KB9 I;  1FZG A;  3VP9 A;  3F89 A;  4WBA A;  1FOS E;  1P84 I;  3RK3 D;  1HGV A;  5AW0 B;  2WWW A;  3Q1M A;  4QDF B;  1IFJ A;  1EDJ A;  1PGP A;  1DEE G;  2QEX P;  1HJB A;  1LT9 C;  3H1H G;  3IF4 A;  2Q7C A;  4ASW A;  2P58 A;  2LXB A;  3K5B A;  3RK3 B;  5AW4 B;  2WSF J;  4IOI H;  2K37 A;  3KDP B;  2BMQ A;  1SQQ G;  3HE5 A;  3IR9 A;  4KJM A;  1MKM A;  1M90 Q;  4UB8 H;  4RKU J;  4NPD A;  3TF5 A;  2BEZ F;  4OGQ D;  2P67 A;  4NBF D;  1OXZ A;  4OWF A;  1NTK J;  3CLQ A;  2DE5 D;  1A02 F;  1M57 D;  2D2C B;  3IFM A;  2BCC G;  5CBO A;  1KIL B;  2H8P D;  2LKM A;  3H1L G;  1GU5 A;  2B1X A;  2BMR A;  1FZC A;  5KKZ B;  2E4Q A;  1NKZ B;  1VQ9 P;  3CC2 P;  4W7Y A;  1KC8 Q;  1GW3 A;  3JC2 2;  3IAO A;  4W7Z A;  3U59 A;  1HF9 A;  2N9Y B;  1EXJ A;  1KYO E;  2P7J A;  1USE A;  3Q5P A;  4JBZ A;  3V2Q A;  2JWA A;  1FZC B;  2NWF A;  1VQ5 P;  1JY2 P;  2IFN A;  1ZW0 A;  1BE3 D;  5AW9 B;  1N8R Q;  1W2E A;  3M0A A;  1N86 A;  2CKF A;  1EC5 A;  1PP9 G;  4NBG D;  1FS0 E;  2N9B A;  3U1A A;  2L5G B;  3A5T A;  5KLV J;  3IN6 A;  3H1L E;  2IBZ G;  5L8R J;  3B8E B;  2KK7 A;  2N1T C;  3AE9 C;  4L76 A;  3H1I D;  1FZA A;  1EQ7 A;  1H88 A;  1JCD A;  2NPS A;  3KZI E;  2GM4 A;  2PRR A;  1RF1 A;  2NPS D;  2YKO A;  5B66 H;  2FYU K;  3TK1 A;  1FAV A;  2I1K A;  1K9M Q;  4GOD A;  3HD7 C;  2NZ2 A;  4Y99 B;  2ZYG A;  2XNX A;  2E76 C;  4IFF A;  3D6Z A;  3CCM P;  1BGY D;  3M9H A;  3USS A;  3EN1 A;  3W67 A;  2KZI A;  4H13 B;  1S9K E;  1U7J A;  1RIE A;  1NDO A;  5AW6 B;  1O7N A;  3CWB D;  4HKV A;  1J1D C;  5DJT B;  5AVU B;  4YTP C;  1BE3 E;  1GDT A;  2KYV A;  1DEB A;  2XND H;  3CCQ P;  2QJK B;  4BXL A;  3CCE P;  1NTM K;  3C8V A;  1LT9 A;  1J1E C;  1PPJ E;  2YMY A;  3FXE A;  3KYQ A;  4NBH D;  2YVJ B;  5CCG C;  3GTS A;  3WU2 H;  1EZV D;  1LWU B;  2WSE H;  4K3A A;  1NJI Q;  3H1I E;  2XRX A;  3O8Z A;  4NBE D;  3CCV P;  1SP4 A;  4MN4 C;  1LT9 B;  3AE5 C;  3GTE A;  3AEC C;  3AEF C;  1VQ4 P;  1JMM A;  1QVF O;  2RH0 A;  2H7H A;  3WUV A;  1AJY A;  4HM2 A;  2FYU D;  1SQP K;  1T6A A;  5AW8 B;  2R32 A;  3PH0 A;  2B88 A;  4H44 B;  2OYH B;  3H1K D;  2Q9I A;  5KLI C;  3L71 E;  5KAF E;  3TYY A;  3CCL P;  2HYN A;  3SFD C;  1BDD A;  5KAF H;  2A06 D;  1BGY E;  3AE2 C;  4IL6 H;  1JM0 A;  1M1K Q;  1XTG B;  1RF0 C;  1JUN A;  1SVF A;  3RL0 C;  2FFD C;  1BCC G;  3P8M C;  1CW5 A;  3L72 D;  3E1I A;  2KNC A;  4HM1 A;  4HM8 A;  1R5S A;  2IYO A;  3S1K A;  1NTZ G;  3CX5 E;  1K73 Q;  4WWI A;  3VMA A;  2E75 C;  5AVQ B;  1R8E A;  3L36 A;  1BE3 J;  1NAY A;  1WMK A;  2QIW A;  3H1J D;  3PLN A;  3ZDM A;  1H8A A;  1NTM D;  3SFE C;  2M5A B;  1N7L A;  1EXI A;  2N1T A;  1H0T B;  2GBW A;  1EDK A;  1S72 P;  4C7R A;  1JY3 P;  1AVO A;  2N1T D;  3L70 G;  2WSE J;  2AEJ A;  1PGQ A;  4AYC A;  1WT6 A;  3H1I J;  2H89 C;  1BCC E;  1DIP A;  1K05 A;  2JKV A;  4DCK A;  1OWA A;  2QRX A;  1S5L E;  1U7M A;  2YFI A;  2IX7 C;  1KQF B;  3HD7 A;  5B5E E;  1EZV I;  2AXC A;  3BAT A;  1OIP A;  1IFM A;  1J2J B;  3NTN A;  2FYU E;  5B5E H;  3HD7 D;  3GW6 A;  4I7Z C;  3RL0 g;  3AE1 C;  2O01 H;  2QA4 P;  2E76 D;  1SQP D;  3CXH D;  3L4F A;  1ULJ A;  3P7K A;  3CPW O;  2A06 E;  3L71 J;  1LGH B;  2ZT9 C;  1Q7Y Q;  1BGY J;  1SQX G;  3AZC A;  2PGD A;  4DZO A;  2YKP A;  3L72 E;  2KB7 P;  2R5B A;  2HMM A;  3TNU B;  3O6Q B;  4NB9 D;  2WMM A;  4GOF A;  3V4W A;  2KXP B;  3CWB J;  1IFP A;  3MP7 B;  4C46 A;  1M1J B;  3H1J E;  1NTM E;  5CCG A;  2QVA A;  3M0D C;  2ZYL A;  3FOU A;  2K3R A;  3B4S A;  5CCG D;  1JO5 A;  1L0L K;  1PL5 A;  3L74 G;  4P1B H;  1RHZ B;  1DX7 A;  3KPE A;  4OGQ C;  2WIT A;  1OMI A;  2C9N Y;  2O1K A;  3A2A A;  1AV1 A;  1G2C B;  2QJY B;  1Y47 A;  3P8C D;  3I56 P;  1XTC C;  2E5Y A;  1HUC A;  5CJ0 A;  3A0H H;  5H2F E;  3GMA A;  3T97 A;  3L73 G;  2B87 B;  2FYU J;  5K5G B;  1SQQ K;  1FOS F;  5H2F H;  2O01 J;  3AE4 C;  1JNM A;  3M9Q A;  2IYP A;  3CXH H;  3H1K J;  1QLE D;  3HUS C;  1RF0 A;  4N6J A;  2E74 C;  1WQL A;  3L75 D;  1Q2N A;  1QGK B;  3PTZ A;  1IK9 A;  4DOJ A;  2FFD A;  1LTA C;  4EYY Q;  2A45 G;  1JTH A;  2P10 A;  3PRJ A;  4LGD E;  4ZNC A;  2HPC B;  3WUT A;  3AEE C;  3T97 B;  1OVR A;  5AEW A;  3N0Q A;  3CMA P;  4AUW A;  3L72 J;  2W6B A;  2E75 D;  2K1A A;  4EOT A;  1VCK A;  3RL0 B;  2H43 A;  1YQ4 C;  4HKZ H;  4EI2 A;  1O7H A;  2YKQ A;  3H1J J;  4NB8 D;  1NTM J;  3BCC D;  2JZA A;  2FYN C;  3CME P;  2FY8 A;  2E75 B;  1L0L D;  3SWY A;  4PD4 I;  1NH4 A;  2E4P A;  1KZU B;  2KSJ A;  1ZOY C;  3FGA D;  2KS1 A;  3Q3D A;  1UUV A;  2WZ7 A;  2IPP A;  1Y8A A;  1VQ6 P;  1URQ B;  5AVT B;  3V2R A;  3VMI D;  2K9Y A;  5APW A;  1NHL A;  1ZN5 A;  2CK3 H;  3P32 A;  3P8C E;  5KAI E;  2JP3 A;  1YIJ P;  1OW7 A;  5KAI H;  3NXS A;  5HL4 A;  2R3S A;  5TJH A;  2XU6 A;  2G8Y A;  4EDF A;  4AQR D;  2B24 A;  1SJG A;  4NBD D;  4OVN F;  2KS1 B;  1HBW A;  1VF5 C;  4M3L A;  1IO4 A;  2QM7 A;  2HMJ A;  1SQQ D;  1KYO D;  4HH2 A;  4A7P A;  1P84 E;  2ZT9 D;  2OQQ A;  1LTJ B;  5BVZ A;  1ZRT E;  4HM6 A;  4AAY B;  3TGU G;  3ITK A;  1YJ9 P;  1X79 B;  1ZR2 A;  2DE7 D;  1HWT C;  3KHU A;  4DJG A;  1VDF A;  2BCC D;  2L91 A;  2V7Q J;  2WSC H;  4HJL A;  2HMK A;  3H1L D;  2O01 N;  2PP6 A;  1YIT P;  3M0D A;  5AVS B;  1W2B O;  4L74 A;  1YJW P;  3FX0 A;  1EDL A;  2XSO A;  3C0D A;  1LJ2 A;  1MFZ A;  3BCC E;  3EQQ A;  5AVW B;  3F5H A;  1L0L E;  2YO3 A;  2WPV B;  1ZP0 C;  4I1L A;  1RH5 B;  1OZH A;  3GHG C;  3CI9 A;  1TU3 F;  3OJA B;  2W6J H;  2I7F A;  3HE5 B;  1CZQ A;  3GZX A;  3QH9 A;  2ZVO B;  1GMJ A;  1PP9 D;  4OGQ B;  1YBK A;  2NRG A;  3H1H E;  1KV4 A;  1G1I A;  2IBZ D;  1Y9B A;  2YIU C;  1IJD B;  4LLH A;  3GG2 A;  2C0W A;  1PIX A;  3Q5R A;  2WTY A;  3HUS A;  2SPZ A;  4U7J A;  2OTL P;  5GTH E;  1SQQ E;  3RK2 C;  2E74 D;  2R3C A;  3AEB C;  1S9K D;  3EFF K;  5GTH H;  1KYO H;  2YXQ B;  4I2L C;  3MUD C;  1JMB A;  3L37 A;  4N78 E;  4JQ0 D;  3BAS A;  3L75 J;  5AW3 B;  3R2P A;  3AEG C;  2WPR A;  3MIW A;  2BCC E;  2KLV A;  1PPJ D;  1R5L A;  1KYO I;  2WSC J;  4HB1 A;  1Z56 A;  1SQV G;  2QSI A;  1L0N G;  3RBX A;  4NPF X;  4HM3 A;  2E43 A;  4ZMD A;  3D70 A;  1N73 C;  3BCC J;  1KMI Z;  1GL2 C;  1L0L J;  1Q90 C;  1NTZ K;  3KZI H;  2ZJS E;  1ZME C;  2W90 A;  1UII A;  3VP8 A;  1KQL A;  1AVY A;  2FYN B;  3B5N A;  3LW5 H;  1RQU A;  1PP9 E;  3B5N D;  2QPZ A;  3L71 D;  2YFJ A;  2IBZ E;  3AE7 C;  2NPS B;  2G3A A;  3M06 A;  2RMZ A;  1S1C X;  2ZYD A;  5KJ7 C;  5AVR B;  3PHL A;  3H1H J;  2E5T A;  1RF1 B;  1L0N E;  1VF5 D;  3VCP A;  1SQQ J;  2W27 A;  3CC7 P;  2R44 A;  2NVF A;  3CX5 D;  1FDI A;  1GK4 A;  4ZKP A;  5GTI E;  3A0B E;  2GA1 A;  3C1L A;  5GTI H;  3A0B H;  3QWO C;  5APV A;  3G6E P;  2BCC J;  1YQ3 C;  2FXO A;  3H1L J;  3H6P A;  3VMG D;  1SQX K;  1SQB G;  3V6I A;  1OW6 A;  2K88 A;  1BCC D;  1K8A Q;  3GHG A;  3Q5S A;  3H25 A;  1VM9 A;  5BOK A;  5CHX A;  4PV1 C;  4WVZ A;  2AXT E;  1NTZ D;  2FKW B;  2AXT H;  3MZW B;  3G3Z A;  3LW5 J;  1NGM B;  5APS A;  4EMJ B;  3PJS K;  1PP9 J;  1G8K B;  1EG9 A;  3GHG B;  1N2D C;  1NKN A;  1KN7 A;  1YYC A;  1NAF A;  2PFX A;  2OTK E;  3L70 D;  3JCU E;  3MUD A;  1IK7 A;  3RK2 D;  3JCU H;  1EZV G;  1VQN P;  4EIJ A;  3V2P A;  4BWN A;  3TSI A;  1FE6 A;  2YIU B;  5APU A;  1X22 A;  1L2P A;  3E7K A;  3CX5 H;  3GCE A;  4U3F G;  2Z5I A;  4OH8 B;  1HVV A;  3RK2 B;  4D6T G;  2J59 M;  3UIA A;  1DD4 A;  4ASV A;  2KNC B;  2QJP C;  1BSN A;  1VQL P;  1ZV8 A;  3Q2Y A;  3CX5 I; 
#chains in the Genus database with same CATH homology
 5AEU A;  1ZRT E;  4HM6 A;  4H0L D;  4AAY B;  2BMQ A;  2BCC E;  1WQL A;  4QUQ A;  2E76 D;  1ULJ A;  4HM2 A;  4PV1 D;  3GL0 A;  4QDC A;  3DQY A;  3VMG D;  2DE7 D;  2A06 E;  2GBX A;  2JO6 A;  4NBC D;  3CWB E;  3GKE A;  5KLI C;  4OGQ D;  1KB9 E;  3L71 E;  4HJL A;  4NBF D;  2HMK A;  3VMH D;  2DE5 D;  1NTZ E;  2BMO A;  5AEW A;  2HMO A;  1NTK E;  3N0Q A;  1G8J B;  3AZC A;  4AIV A;  1BGY E;  4QDF A;  1VM9 A;  4HM3 A;  5BOK A;  3L72 E;  2E75 D;  1O7M A;  2HMN A;  2XSO A;  2HMM A;  2HML A;  3C0D A;  4P1C H;  4QCK A;  4NB9 D;  3L74 E;  3BCC E;  4HM7 A;  4HM0 A;  1NU1 E;  3EQQ A;  3GL2 A;  2B1X A;  2BMR A;  5KKZ C;  1VCK A;  1Q90 C;  2E4Q A;  1L0L E;  1EZV E;  4NBB D;  4HM5 A;  1O7H A;  3EN1 A;  1FQT A;  4HM1 A;  4NB8 D;  5CXM A;  4HM8 A;  4EMJ B;  3H1J E;  2NUM A;  2JZA A;  1RIE A;  2FYN C;  3VCA A;  3CX5 E;  1NTM E;  3L70 E;  1RFS A;  2ZYL A;  3GOB A;  1NDO A;  1G8K B;  1EG9 A;  1O7G A;  1JM1 A;  3FOU A;  1O7N A;  1PP9 E;  4HKV A;  2QJY C;  2YFL A;  2E4P A;  1KYO E;  2QPZ A;  4U3F E;  2DE6 D;  2YFJ A;  1BE3 E;  5KLV E;  2IBZ E;  4D6T E;  1UUV A;  2Q3W A;  2I7F A;  2QJK C;  4P1B H;  3GZX A;  1O7W A;  2NWF A;  2NVE A;  4NBA D;  2GBW A;  3VMI D;  1L0N E;  1VF5 D;  4H44 D;  1PPJ E;  3H1H E;  3L75 E;  3VCP A;  1SQP E;  3CXH E;  3L73 E;  3D89 A;  4QDD A;  2YIU C;  4HM4 A;  4NBH D;  1UUW A;  2YVJ B;  2XSH A;  3GTS A;  2CKF A;  2XR8 A;  5HL4 A;  1ULI A;  4NBG D;  3H1K E;  1O7P A;  3GZY A;  4QDF B;  2D2C D;  3GCE A;  3TGU E;  4QUR A;  1SQQ E;  2B24 A;  3H1L E;  1SJG A;  2E74 D;  4NBD D;  2NVF A;  3H1I E;  1BCC E;  2XRX A;  1SQV E;  4NBE D;  1SQB E;  4QUP A;  2YFI A;  2HMJ A;  1P84 E;  3GTE A;  3GB4 A;  2ZT9 D;  2NUK A;  2QJP C;  4H13 D;  1NYK A;  1SQX E;  4PD4 E;  2FYU E;  2NVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...