3L73E

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 38
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l73E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l73E02
1NTZE 4HM4A 1SQQE 1NTKE 1VF5D 3GZXA 4HM2A 4QCKA 2I7FA 4PD4E 2NVEA 1L0LE 1L0NE 1SQVE 1SQXE 4HKVA 3GOBA 2E76D 3GKEA 3N0QA 4NBGD 3VCPA 1NTME 1O7GA 2FYUE 4U3FE 4NB8D 2QJKC 2JZAA 4HM0A 2NUKA 1RFSA 1SJGA 1O7WA 2GBXA 1G8JB 1O7MA 4NBDD 5AEWA 2QJPC 2BCCE 2ZYLA 2XR8A 3CWBE 1EZVE 2DE5D 4EMJB 2HMKA 3EQQA 1NDOA 2QPZA 3H1LE 3EN1A 5KKZC 3H1KE 2DE7D 1BCCE 5AEUA 1FQTA 5HL4A 2BMQA 2D2CD 3GCEA 1SQBE 4QUPA 4OGQD 1NYKA 4QDFB 5KLIC 4HM8A 2QJYC 2YIUC 4HM7A 3CX5E 4HJLA 1PP9E 4NBBD 4PV1D 3C0DA 2GBWA 3GZYA 3VMGD 1UUVA 2NVFA 3GB4A 1KB9E 1G8KB 3H1JE 2BMRA 4QDCA 4QDFA 1JM1A 2NUMA 4NBED 3CXHE 4HM1A 1ULIA 3VCAA 2HMNA 1WQLA 1NU1E 2B24A 2E74D 2HMOA 3GTSA 2B1XA 5BOKA 2YFJA 3H1HE 2NWFA 3VMHD 1KYOE 2Q3WA 5KLVE 4P1CH 2YVJB 2ZT9D 1BGYE 3FOUA 3L72E 4HM6A 2E4PA 4NBFD 4QDDA 4HM3A 2DE6D 2XSHA 3VMID 1ZRTE 1EG9A 2HMLA 4AAYB 4P1BH 2XRXA 4H13D 4NBHD 1RIEA 3GL2A 2HMJA 4NBAD 1ULJA 2CKFA 2BMOA 1VCKA 3TGUE 4QURA 1P84E 3D89A 1BE3E 4H44D 1O7HA 2NVGA 4D6TE 2YFLA 3H1IE 1SQPE 5CXMA 4AIVA 4HM5A 3L70E 1O7PA 3BCCE 4NB9D 2A06E 3AZCA 2E4QA 1PPJE 4QUQA 3L73E 3GTEA 3L71E 2YFIA 2XSOA 2HMMA 4NBCD 1Q90C 3GL0A 1UUWA 2E75D 2IBZE 3L74E 3L75E 2FYNC 2JO6A 1O7NA 1VM9A 3DQYA 4H0LD
chains in the Genus database with same CATH superfamily
3AE5C 3AEGC 2WSSH 2NVEA 1WT6A 3Q1MA 5CBNA 4HKVA 5AVSB 3BRTB 1YJWP 3GHGB 4UB8E 4HKZH 3CXHD 5BVZA 2LXBA 4W7ZA 3HTKA 1RQVA 3M0DA 1Z56A 2QPZA 1KYOD 4WY4B 1AJYA 1FZGA 3VMXA 1SQQJ 3GCEA 1MFTA 1FZFA 1SQXJ 1AVOA 3A0BH 4YXWH 1JY2O 1J1DB 3A2AA 1G8KB 3F89A 3FX0A 1IFDA 3SWFA 3QWOC 1HVVA 2QJPB 3VP8A 1T3JA 5KKZB 2KNCB 1PIXA 5CCGA 1EG9A 2K1AA 2OYHB 1N7SC 3HUSB 1N86A 1UIXA 3RK2B 3H1JJ 5AVVB 1CW5A 1YYCA 2KZIA 5CCHC 1O7PA 1TU3F 3AE8C 3CWBD 1EZVD 3O6QA 2XSOA 1X8YA 3CCSP 3IAOA 1L0LK 1KB9H 5GTIE 1SQVE 1ZRTD 1JCDA 3HRNA 3V5BA 4BRYA 1NTME 2CPBA 2LXCB 4GDOA 1M90Q 1EDLA 1HGVA 2WTYA 5AEWA 2AEMA 3P7KA 2PFXA 5KJ7C 1KQSO 2Z4EA 3TGUG 2M8RA 3AEFC 2E76B 1LJ2A 3BCCG 5AVTB 1NYKA 4I7ZB 1R5SA 3GZYA 3CCUP 4U7JA 4N78D 1JUNA 2NUMA 2KNCA 5GTHH 1N73B 1VQMP 2QJKB 2OGUA 3SWKA 4RO0A 3C1LA 1SQXG 2BCCD 4H44C 3AEDC 1S5LX 3Q2YA 1NWQA 3A7OA 1T3UA 2CKFA 3TGUE 4OWFA 4IFDK 1R5LA 1P84E 1MZ9A 3CX5D 2K88A 1N7SD 3AE6C 3BCCE 2WPVB 4ASVA 3L72G 1LWUA 2XV5A 3MP7B 2WWWA 4HB1A 1M1JB 3PLNA 3H1JG 2M5AB 5CCHD 1SQQE 3P8MC 1S1CX 1SQBD 1VQ4P 1SQXE 1K05A 3HD7C 4NBGD 1BGYG 1RF1B 1RFSA 1SJGA 5M1BA 3LIEA 2NPSD 2QM8A 1W5CE 1WMKA 3RL0g 3JC22 3L71J 3V2RA 1FJPA 3L74J 1ZV8A 2WSEH 2JKVA 1CSBA 1YTZI 3TNUB 2E42A 4XA4A 4QUPA 2FYUG 1GU4A 5KJ7D 1L4AD 2YXRB 4JPZB 2GBWA 3CC2P 3W67A 3H1JE 2QSIA 2JWAA 1JY2P 1LP1B 3VCAA 2GM4A 1KTMA 1WQLA 1FZBA 1VQKP 1K04A 1URQC 3PP5A 3TF5A 3H1LJ 2WZ7A 1K9MQ 1BGYE 2KS1B 2QG4A 1W2EA 1FZAA 1QX8A 1ZXGA 3RGUA 3EFFK 1M57D 1IJDB 2A45G 3KZIH 1NU1G 4C7NB 3CCLP 1P84I 1LTJC 2E75C 4H44D 1Y9BA 2M5AA 3CL3D 1S72P 3H1KJ 5KTBA 2ZVOB 2HLOA 1VQNP 1DH3A 1JNMA 5BOKA 1VQOP 1MUUA 2E5TA 4WVZA 3E7KA 5AVUB 3GKEA 2KOGA 1X22A 5KAFE 1BE3J 1PGJA 2W6AA 1VQ6P 1O7MA 1YTZT 2IFNA 1S5LE 1H89A 2IDBA 4HYTB 4EMJB 2YKOA 3HD7D 5KLVD 3O8ZA 1JY3N 2P7JA 2NRGA 4DJGA 2N9YB 1VDFA 4BXLA 3L71G 1RF0A 1T8ZA 4U3FJ 3BRVB 2PAJA 2BMRA 3B5NC 1WRGA 4R4LA 3H1ID 1CI6A 2Q3IA 3AE9C 4RKUJ 3CCEP 2GUSA 3A0HH 1BCCJ 2HPCA 2ZT9D 2G8YA 2IFMA 3P8CE 1GU5A 3AEBC 1GL2A 2L5GB 1JTHB 3GLMA 4NBHD 5APWA 1URQD 3OW2O 3H1LG 1RQUA 2LKMA 1SFCA 1HBWA 5BU8B 2XKMA 3RBXA 1JOCA 3L71E 4NPDA 2E75D 3L74E 2W6BA 3Q5SA 5B66H 3CX5H 1JY2N 1LT9A 2WQYC 3L35A 1KILA 2Y0CA 4L76A 4I2LC 1JB0J 1IFIA 3R4YA 1KB9D 2KLVA 2RKLA 1NU1D 3V2NA 1OWAA 2A45I 2H88C 3H1HD 1YQ3C 3L70D 3NXSA 3H1LE 1RE4C 2C9LY 1R8EA 2KZJA 3JSVC 3PTZA 3VP9A 5AW3B 1AVYA 3SSUA 3C0DA 3C9IA 1OW6A 3CXHE 1VQLP 1FOSF 2WSFJ 2A06D 3MHVA 5AVWB 3V2PA 2YFJA 2N1TA 1KYOE 2O01H 4YPCA 2K9JB 3B5ND 5CMZA 4N6JA 4JQ0D 1SQBJ 1Y47A 1NTKD 2ZXEB 3CWBG 1EZVG 1QLED 2BMOA 1FDIA 2N9BA 3WU2H 5AW7B 1BE3E 3FGAD 3PJSK 1GZLA 4HM5A 4NB9D 2E4QA 1VF5C 4AQRD 4ZNCA 1Q90C 1VQPP 2KXPB 2YMKA 1SQXK 1AA0A 1KORA 2JJLA 4AYCA 1MFZA 1OVVA 1N7SB 1VQ5P 4GIFA 1XTGB 4HH2A 4U3FE 1J2JB 4HM0A 3WMM0 4AUWA 2ZJSE 4LLHA 1LTSC 1KZUB 4MN4C 3CWBE 1HH0A 1EZVE 1K73Q 1BCCE 3C8VA 2FFDC 1IZNB 3T97A 3CCRP 3TGUJ 1NHLA 1FC2C 2NPSB 1ZLLA 1DEEG 3MD0A 3BCCJ 2BCCG 3CCQP 2Q6QA 1IO4A 2IZ0A 3CXHI 1X9VA 3WUUA 3BATA 2B9BA 4ASWA 4H13C 1FE6A 1KYOI 1K8AQ 3FXEA 2O01N 1Q81Q 1L4AB 2DE6D 4LC1A 2CPSA 2Q9IA 4DOJA 2JDIH 1M1KQ 1RE3A 4NBAD 1D7MA 3M0DC 2YO3A 5APUA 3KPEA 4N78E 4OVNF 2PP6A 3W68A 1SQBG 4EYYQ 1OZHA 4PJ0E 4TLFA 3H25A 3GTEA 1G1IA 3L72J 3GL0A 5CHXA 5TISH 3CMAP 4H44B 1VF5D 3M06A 3SFEC 2I7FA 5AVQB 1Q90D 2B87B 4W7YA 3H1IJ 3N7NA 1PZQA 4O9BA 2D2CC 5CCGC 1BGYJ 2XR8A 1EZVI 3GHGA 4OH8B 3D6ZA 2NPSC 1PGOA 2AEFA 4IOIH 1N8RQ 2FKWB 3S9OA 2BMQA 4GOEA 3U1AA 3RBZA 1SQBE 3E1RA 4WY4A 2FXPA 4K35A 2YIUC 2M0BA 3A3YB 4GODA 2FYUJ 1KN7A 3HD7B 1M7LA 1AQTA 3L4FA 3D70A 1BSNA 3CC4P 1LTBC 1SS1A 1L4AC 1H0TB 1LNQA 3PH0A 3RK3C 3Q5PA 1DX7A 2Y9YA 3AE3C 1NYHA 2Q3WA 1M8OB 2YVJB 2W83C 1SLQA 4ZKPA 2HMLA 2E43A 1S2EA 4H13D 1KQLA 1OXZA 1G2CB 1ULJA 2UWJE 2JR8A 5EFWB 2OYHA 2O1KA 1E5WA 3HUSA 2IX7C 3D89A 5DJTB 2OTJP 2HFED 2YNYA 1NU1J 2ZT9B 3OJAB 3H32B 5AW5B 3H1HJ 4IL6H 5E79H 1T6AA 2YFIA 4LGDE 2HMMA 1URQB 5BU5A 1CZQA 3AEEC 2JZAA 4HM4A 3AECC 2J5UA 1JY3P 3I5CA 2BEZF 1HJBA 2W90A 5KLVG 2O1JA 1ZR2A 1PGPA 4WB4A 1G8JB 1NOHA 3PHLA 1LTJB 2E75B 3CCVP 4CPGA 2P1JA 3IN6A 3VYIA 5AW0B 2NZ2A 1QL2A 1LTAC 1NKNA 4PV1C 1RHZB 2XNXA 5TJHA 2V7QH 2D2CD 3H1IG 5CCGD 2FXMA 2YO2A 1KFMA 3H6PA 1RY3A 2B88A 2RMZA 1EQ7A 5KAIH 2ZYAA 2GUVA 3VMGD 3AE4C 3GB4A 3JCUH 2OARA 1SQVD 2MKVA 4D6TD 2IZ1A 1NTMD 3MUDA 4L75A 1KV4A 2HMOA 4ZKUA 2ZVNB 3USSA 2XU6A 1N73A 5KLVE 1QVFO 3L72E 2OYIC 1FOSE 4QDDA 2FY8A 2XSHA 1NTZD 2H43A 2H89C 4I6MC 2ZT9C 3RK3D 2HMJA 1L0ND 2YKQA 2V4HA 3CCMP 3H1IE 3A0BE 1OW8A 3SWYA 3B5NB 2AXTH 1E79H 2KI7B 1T2KC 3GZXA 4HJGH 2WSEJ 4JYCA 1M1JA 3V6IA 3H1HG 2QIWA 3L70G 2LR2A 1YI2P 4EIJA 2H7HA 2WITA 4UB6H 5TISE 2FYUE 5AVYB 2QRXA 1QGKB 3RL0C 4NBDD 4Y99B 5B5EH 1GW4A 2XNDH 4N3YB 1USEA 1GK4A 1RF1A 3QH9A 1ZW0A 3M9BA 1U57A 1XTCC 2A06G 2E74C 5H2FH 2KSEA 2KUBA 2QVAA 4IFMA 1SQQD 4PV1D 3TNUA 1KB9E 2Q7CA 4EI2A 3KQGA 1FS0E 3TYYA 1SQPD 1OW7A 2HMNA 3S4RA 1NU1E 1NTKG 1GTWA 2HODB 4TT3H 4KJMA 3H1HE 3VMHD 3L73D 3G3ZA 5AW2B 1VQ8P 1BSHA 1LP1A 3FOUA 2DW3A 3L75D 1N7LA 3MIWA 1EDIA 2KS1A 4UB8H 1OVRA 2ZFCA 3CWBJ 2NVGA 2RH0A 2YFLA 4H0LC 2A06E 2QEXP 3AZCA 4C7NA 1S9KE 4QUQA 2RN0A 1BDDA 1MKMA 2P10A 1YIJP 3GF7A 5GTHE 2IPPA 1RF0C 1MV8A 2IYOA 1JMBA 1NTKE 2I1JA 4Y99C 2KSJA 1AV1A 3BASA 1YBKA 2ITAA 1O7GA 1FZCC 2SPZA 3UIAA 2POHA 1T2KD 2WT7B 1GL2C 4OGQC 3MTUE 3G6EP 1VF5B 2C0WA 1SQBK 1OMIA 3RL0D 5CJ4A 1SFCC 2B89A 2ZXXA 4QDFB 2WSCH 2QJYC 3LW5H 4HM7A 4NBBD 1KB9I 1IC2A 3HE5B 1NJIQ 5C39A 4GT1A 2BCCJ 2E74D 1LT9C 2PGDA 1ZR4A 1PL5A 3BVHA 1KILC 1YHQP 5GTIH 2HYNA 2W8ZA 4HM3A 3VMID 2FFDB 1IK7A 4PD4D 1L0LD 3HE4B 1JM0A 5AVZB 4ZMDA 3AEAC 1JTHA 2W27A 2K9YA 1DIPA 1OVUA 4B86A 2Z5HA 3I55P 1LTTC 4H13B 1HUCA 2XDJA 1M56D 3B71A 1DD3A 1O7NA 2Y9ZA 4H0LD 2JO1A 1J1EC 3U59A 2BASA 5APTA 2FXOA 2AXTE 3P8CD 3GOBA 2N1TC 3WUTA 2WVRA 4D6TJ 2I8DA 2J59M 1FZEA 2GBXA 1JCCA 2IYPA 1KC8Q 3KZIE 2FYZA 1VL2A 1QEXA 2HMKA 1PFIA 2DE7D 1Q86Q 5AEUA 1NTZJ 2W6JH 2O01J 1GL2D 1P84H 3L74D 4OGQD 1L0NJ 1Y8AA 5KLIC 3NFQA 2R44A 2NVFA 4DCKA 1JM1A 3KHUA 1SFCD 5KLVK 2D2CB 3NTNA 4NPFX 2NWFA 3HE4A 1LGHB 4I1LA 3TK1A 4NBFD 3VMZA 2IBZD 3TDKA 2R32A 4K3AA 2KLUA 1ZRTE 4EOTA 2G3AA 3LIDA 2XRXA 3G4SP 1FDOA 2K9JA 1KILD 1YJNP 2WPQA 2J58A 4QURA 4W80A 2YIUB 1IK9A 3O6QB 1NKZB 3CLQA 2C0XA 2KP8A 1S4XA 2R3CA 1IFPA 3RK3B 3B4SA 1KQGB 2K3RA 3H1KD 2OTKE 1USDA 1KMIZ 2ZYGA 4BRYB 3GMAA 3A5TA 3V4QA 3A0HE 3OA7A 4HM2A 3KYQA 4QCKA 2FYUK 1LTIC 3CMEP 3N0QA 1PP9D 1FU1A 3FXDA 5CBOA 3Q5RA 2NUKA 1SQPJ 3M0AA 1N7SA 5KLVJ 1Q2NA 1GK6A 2BCCE 4Y28J 1BE3D 2KK7A 3L73J 1A02F 4L74A 2N1TD 1RE3C 1IFMA 4KT0J 2OYOA 3L75J 4C7RA 1IFNA 1SQVG 4D6TG 5CCHA 3EWKA 1NTMG 5APSA 5L8RJ 4RJTA 5B66E 3G71P 3CX5E 1OIPA 4C46A 2R5BA 1UUVA 1L2PA 1NU1K 1EDJA 4QDCA 2NPSA 2HR3A 1NTZG 4DZOA 4U3FD 4XFJA 1PPJD 1L0NG 3KDPB 4PV1B 4RESB 5KAFH 1BCCD 1RIEA 5KJ7A 3GHGC 1L4AA 4R4MA 1NAYA 1DEBA 5APQA 1LWUB 1S5LH 1NGMB 2R5DA 4D6TE 3EQ2A 2A45H 4AIVA 1G1JA 4WY4C 4PD4H 1Q7YQ 2WPSA 2H8PD 3M9QA 4KHXA 1GDTA 1UUWA 2JWDA 3OAKA 1NTKK 1NTZE 3Q3DA 2OYIB 2P2UA 3RK3E 2JEEA 1J1DC 1L0NE 3ITKA 1AFOA 2Q5UA 4XE5B 2XZRA 2ZYDA 4NB8D 3G9RA 3L70J 5AW4B 2QJPC 2ZYLA 3WU2E 4M3LA 2B87A 4QMAA 3MGNA 4DT0A 1SQQG 5KKZC 3CC7P 1EXJA 2OYHC 3HUSC 1SQPG 3FWNA 3RK2C 1L0LJ 3PRJA 3AE7C 3L73G 3CX5I 4HJLA 1FDMA 3L75G 1PGQA 1SP4A 2WMMA 4HM1A 1X79B 3GTSA 3RL0B 2P58A 3HD7A 5APXA 3VN0A 2YXQB 4P1CH 1NTKJ 2E4PA 2Q3EA 1H0TA 1LWUC 5AVXB 1A02J 4BWNA 3FWLA 2QA4P 2E74B 4IFFA 3VOPA 3V4WA 1O7HA 3NMDA 1G2CA 4IL6X 1SQPE 3SFDC 2OYIA 3VTPC 1GW3A 4GKGA 3L73E 2E5YA 3IR9A 1ZN5A 2E76C 5AW9B 3B8EB 3L75E 3H32A 3II6A 2HG5D 3L36A 4I7ZC 4EDFA 3MUDC 1URQA 4WY4D 3ABVC 4YTPC 3CXHH 2V7QJ 2FYNB 1N73C 2QJKC 3GW6A 3M91A 1O7WA 1KYOH 1JO5A 1H8AA 4JF7A 4H0LB 5APYA 2BEQD 1LT1A 1U7JA 2OQQA 1LTJA 1QL1A 3MZWB 1FQTA 5HL4A 4WBAA 1Q82Q 4HM8A 1CI6B 3CPWO 2MJZA 2AEJA 1VQ9P 3TGUD 2VRSA 1P84D 3CCJP 4NBED 3RK2D 2HPCB 3TSIA 3BCCD 1FZCB 1QVGO 2B1XA 1L0LG 1VPCA 1GL2B 1M1JC 1HF9A 2P67A 4OGQB 4HM6A 1YJ9P 1YITP 2JP3A 1FJKA 3IF4A 3GL2A 2L91A 1SFCB 1SQXD 1PP9J 1VCKA 1RF1C 3K5BA 2QJYB 5DJUB 4A7PA 4Z1MH 5APVA 2I1KA 4L73A 3L70E 1FBMA 1HWTC 3KXDA 3R2PA 1RH5B 1LT9B 1DD4A 3B5NA 1KILB 2CK3H 2FYNC 3F5HA 3VMAA 2C9NY 3CD6P 2M3EA 3L72D 3U1CA 4PD4E 1L0LE 5AW6B 3AE1C 1IFJA 2E76D 1N2DC 3VCPA 3GF3A 4WWIA 1FAVA 2WPRA 2QE7H 3H1JD 3L74G 3AE2C 2AXCA 1EDKA 1NDOA 1UIIA 1BGYD 1KQFB 4IL6E 5E79E 1OX3A 1FZCA 1J1EB 3CI9A 1GD2E 2IBZG 4PJ0H 2N1TB 3D71A 1ULIA 1NO4A 2FYUD 1AQ5A 3VMYA 1PV3A 1HTLC 4YXDC 2HODA 4NPEA 4JYBA 4P1BH 2OTLP 1SQVK 1HGZA 1RE4A 5KLIB 2WSFH 1NTMK 3H1KG 1U7MA 5KAIE 5CXMA 1YQ4C 3P32A 3JCUE 5K5GB 3GG2A 3L37A 1PP9G 1NTZK 2IBZE 3EFGA 2JO6A 1VM9A 2K37A 3DQYA 1L0NK 1LTGC 5AW8B 1EXIA 1BDCA 1BE3G 4PD4I 1KILE 1S3JA 1GMJA 2WSCJ 2ZAEB 5AW1B 3LW5J 1VQ7P 3ZDMA 2O3JA 2YMYA 1KD1Q 2DE5D 3T97B 3EQQA 4JBZA 3WUVA 3EN1A 1NVOA 1KFNA 3H1KE 2WT7A 1S9KD 1JEKA 2GA1A 3S1KA 1W2BO 1ZOYC 3V2QA 3E1IA 4U3FG 3HTKB 1PPJG 1SQVJ 1X0TA 1NTMJ 1PP9E 3IFMA 4GOFA 1ZMEC 4QDFA 5AVRB 2FBWC 2B24A 1BCCG 2YKPA 4UB6E 1NH4A 2M3BA 3HE5A 2KB7P 3L71D 2PRRA 2QM7A 5B5EE 2Q1KA 1JMMA 2Y0EA 1OFCX 1SQQK 3D6YA 4AAYB 1JY3O 2Z5IA 1HJ0A 1SQPK 1EC5A 2FFDA 2R3SA 5H2FE 3I56P 1NAFA 1SVFA 2KYVA 1PPJE 3N4XA 2Y0DA 2KIKA 1ZP0C 3M9HA 3H1LD 1H88A 4NBCD 2IBZI 5CJ0A
chains in the Genus database with same CATH topology
1NTZE 4HM4A 1SQQE 1NTKE 1VF5D 3GZXA 4HM2A 4QCKA 2I7FA 4PD4E 2NVEA 1L0LE 1L0NE 1SQVE 1SQXE 4HKVA 3GOBA 2E76D 3GKEA 3N0QA 4NBGD 3VCPA 1NTME 1O7GA 2FYUE 4U3FE 4NB8D 2QJKC 2JZAA 4HM0A 2NUKA 1RFSA 1SJGA 1O7WA 2GBXA 1G8JB 1O7MA 4NBDD 5AEWA 2QJPC 2BCCE 2ZYLA 2XR8A 3CWBE 1EZVE 2DE5D 4EMJB 2HMKA 3EQQA 1NDOA 2QPZA 3H1LE 3EN1A 5KKZC 3H1KE 2DE7D 1BCCE 5AEUA 1FQTA 5HL4A 2BMQA 2D2CD 3GCEA 1SQBE 4QUPA 4OGQD 1NYKA 4QDFB 5KLIC 4HM8A 2QJYC 2YIUC 4HM7A 3CX5E 4HJLA 1PP9E 4NBBD 4PV1D 3C0DA 2GBWA 3GZYA 3VMGD 1UUVA 2NVFA 3GB4A 1KB9E 1G8KB 3H1JE 2BMRA 4QDCA 4QDFA 1JM1A 2NUMA 4NBED 3CXHE 4HM1A 1ULIA 3VCAA 2HMNA 1WQLA 1NU1E 2B24A 2E74D 2HMOA 3GTSA 2B1XA 5BOKA 2YFJA 3H1HE 2NWFA 3VMHD 1KYOE 2Q3WA 5KLVE 4P1CH 2YVJB 2ZT9D 1BGYE 3FOUA 3L72E 4HM6A 2E4PA 4NBFD 4QDDA 4HM3A 2DE6D 2XSHA 3VMID 1ZRTE 1EG9A 2HMLA 4AAYB 4P1BH 2XRXA 4H13D 4NBHD 1RIEA 3GL2A 2HMJA 4NBAD 1ULJA 2CKFA 2BMOA 1VCKA 3TGUE 4QURA 1P84E 3D89A 1BE3E 4H44D 1O7HA 2NVGA 4D6TE 2YFLA 3H1IE 1SQPE 5CXMA 4AIVA 4HM5A 3L70E 1O7PA 3BCCE 4NB9D 2A06E 3AZCA 2E4QA 1PPJE 4QUQA 3L73E 3GTEA 3L71E 2YFIA 2XSOA 2HMMA 4NBCD 1Q90C 3GL0A 1UUWA 2E75D 2IBZE 3L74E 3L75E 2FYNC 2JO6A 1O7NA 1VM9A 3DQYA 4H0LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ E;  4HM4 A;  1SQQ E;  1NTK E;  1VF5 D;  3GZX A;  4HM2 A;  4QCK A;  2I7F A;  4PD4 E;  2NVE A;  1L0L E;  1L0N E;  1SQV E;  1SQX E;  4HKV A;  3GOB A;  2E76 D;  3GKE A;  3N0Q A;  4NBG D;  3VCP A;  1NTM E;  1O7G A;  2FYU E;  4U3F E;  4NB8 D;  2QJK C;  2JZA A;  4HM0 A;  2NUK A;  1RFS A;  1SJG A;  1O7W A;  2GBX A;  1G8J B;  1O7M A;  4NBD D;  5AEW A;  2QJP C;  2BCC E;  2ZYL A;  2XR8 A;  3CWB E;  1EZV E;  2DE5 D;  4EMJ B;  2HMK A;  3EQQ A;  1NDO A;  2QPZ A;  3H1L E;  3EN1 A;  5KKZ C;  3H1K E;  2DE7 D;  1BCC E;  5AEU A;  1FQT A;  5HL4 A;  2BMQ A;  2D2C D;  3GCE A;  1SQB E;  4QUP A;  4OGQ D;  1NYK A;  4QDF B;  5KLI C;  4HM8 A;  2QJY C;  2YIU C;  4HM7 A;  3CX5 E;  4HJL A;  1PP9 E;  4NBB D;  4PV1 D;  3C0D A;  2GBW A;  3GZY A;  3VMG D;  1UUV A;  2NVF A;  3GB4 A;  1KB9 E;  1G8K B;  3H1J E;  2BMR A;  4QDC A;  4QDF A;  1JM1 A;  2NUM A;  4NBE D;  3CXH E;  4HM1 A;  1ULI A;  3VCA A;  2HMN A;  1WQL A;  1NU1 E;  2B24 A;  2E74 D;  2HMO A;  3GTS A;  2B1X A;  5BOK A;  2YFJ A;  3H1H E;  2NWF A;  3VMH D;  1KYO E;  2Q3W A;  5KLV E;  4P1C H;  2YVJ B;  2ZT9 D;  1BGY E;  3FOU A;  3L72 E;  4HM6 A;  2E4P A;  4NBF D;  4QDD A;  4HM3 A;  2DE6 D;  2XSH A;  3VMI D;  1ZRT E;  1EG9 A;  2HML A;  4AAY B;  4P1B H;  2XRX A;  4H13 D;  4NBH D;  1RIE A;  3GL2 A;  2HMJ A;  4NBA D;  1ULJ A;  2CKF A;  2BMO A;  1VCK A;  3TGU E;  4QUR A;  1P84 E;  3D89 A;  1BE3 E;  4H44 D;  1O7H A;  2NVG A;  4D6T E;  2YFL A;  3H1I E;  1SQP E;  5CXM A;  4AIV A;  4HM5 A;  3L70 E;  1O7P A;  3BCC E;  4NB9 D;  2A06 E;  3AZC A;  2E4Q A;  1PPJ E;  4QUQ A;  3L73 E;  3GTE A;  3L71 E;  2YFI A;  2XSO A;  2HMM A;  4NBC D;  1Q90 C;  3GL0 A;  1UUW A;  2E75 D;  2IBZ E;  3L74 E;  3L75 E;  2FYN C;  2JO6 A;  1O7N A;  1VM9 A;  3DQY A;  4H0L D; 
#chains in the Genus database with same CATH topology
 3AE5 C;  3AEG C;  2WSS H;  2NVE A;  1WT6 A;  3Q1M A;  5CBN A;  4HKV A;  5AVS B;  3BRT B;  1YJW P;  3GHG B;  4UB8 E;  4HKZ H;  3CXH D;  5BVZ A;  2LXB A;  4W7Z A;  3HTK A;  1RQV A;  3M0D A;  1Z56 A;  2QPZ A;  1KYO D;  4WY4 B;  1AJY A;  1FZG A;  3VMX A;  1SQQ J;  3GCE A;  1MFT A;  1FZF A;  1SQX J;  1AVO A;  3A0B H;  4YXW H;  1JY2 O;  1J1D B;  3A2A A;  1G8K B;  3F89 A;  3FX0 A;  1IFD A;  3SWF A;  3QWO C;  1HVV A;  2QJP B;  3VP8 A;  1T3J A;  5KKZ B;  2KNC B;  1PIX A;  5CCG A;  1EG9 A;  2K1A A;  2OYH B;  1N7S C;  3HUS B;  1N86 A;  1UIX A;  3RK2 B;  3H1J J;  5AVV B;  1CW5 A;  1YYC A;  2KZI A;  5CCH C;  1O7P A;  1TU3 F;  3AE8 C;  3CWB D;  1EZV D;  3O6Q A;  2XSO A;  1X8Y A;  3CCS P;  3IAO A;  1L0L K;  1KB9 H;  5GTI E;  1SQV E;  1ZRT D;  1JCD A;  3HRN A;  3V5B A;  4BRY A;  1NTM E;  2CPB A;  2LXC B;  4GDO A;  1M90 Q;  1EDL A;  1HGV A;  2WTY A;  5AEW A;  2AEM A;  3P7K A;  2PFX A;  5KJ7 C;  1KQS O;  2Z4E A;  3TGU G;  2M8R A;  3AEF C;  2E76 B;  1LJ2 A;  3BCC G;  5AVT B;  1NYK A;  4I7Z B;  1R5S A;  3GZY A;  3CCU P;  4U7J A;  4N78 D;  1JUN A;  2NUM A;  2KNC A;  5GTH H;  1N73 B;  1VQM P;  2QJK B;  2OGU A;  3SWK A;  4RO0 A;  3C1L A;  1SQX G;  2BCC D;  4H44 C;  3AED C;  1S5L X;  3Q2Y A;  1NWQ A;  3A7O A;  1T3U A;  2CKF A;  3TGU E;  4OWF A;  4IFD K;  1R5L A;  1P84 E;  1MZ9 A;  3CX5 D;  2K88 A;  1N7S D;  3AE6 C;  3BCC E;  2WPV B;  4ASV A;  3L72 G;  1LWU A;  2XV5 A;  3MP7 B;  2WWW A;  4HB1 A;  1M1J B;  3PLN A;  3H1J G;  2M5A B;  5CCH D;  1SQQ E;  3P8M C;  1S1C X;  1SQB D;  1VQ4 P;  1SQX E;  1K05 A;  3HD7 C;  4NBG D;  1BGY G;  1RF1 B;  1RFS A;  1SJG A;  5M1B A;  3LIE A;  2NPS D;  2QM8 A;  1W5C E;  1WMK A;  3RL0 g;  3JC2 2;  3L71 J;  3V2R A;  1FJP A;  3L74 J;  1ZV8 A;  2WSE H;  2JKV A;  1CSB A;  1YTZ I;  3TNU B;  2E42 A;  4XA4 A;  4QUP A;  2FYU G;  1GU4 A;  5KJ7 D;  1L4A D;  2YXR B;  4JPZ B;  2GBW A;  3CC2 P;  3W67 A;  3H1J E;  2QSI A;  2JWA A;  1JY2 P;  1LP1 B;  3VCA A;  2GM4 A;  1KTM A;  1WQL A;  1FZB A;  1VQK P;  1K04 A;  1URQ C;  3PP5 A;  3TF5 A;  3H1L J;  2WZ7 A;  1K9M Q;  1BGY E;  2KS1 B;  2QG4 A;  1W2E A;  1FZA A;  1QX8 A;  1ZXG A;  3RGU A;  3EFF K;  1M57 D;  1IJD B;  2A45 G;  3KZI H;  1NU1 G;  4C7N B;  3CCL P;  1P84 I;  1LTJ C;  2E75 C;  4H44 D;  1Y9B A;  2M5A A;  3CL3 D;  1S72 P;  3H1K J;  5KTB A;  2ZVO B;  2HLO A;  1VQN P;  1DH3 A;  1JNM A;  5BOK A;  1VQO P;  1MUU A;  2E5T A;  4WVZ A;  3E7K A;  5AVU B;  3GKE A;  2KOG A;  1X22 A;  5KAF E;  1BE3 J;  1PGJ A;  2W6A A;  1VQ6 P;  1O7M A;  1YTZ T;  2IFN A;  1S5L E;  1H89 A;  2IDB A;  4HYT B;  4EMJ B;  2YKO A;  3HD7 D;  5KLV D;  3O8Z A;  1JY3 N;  2P7J A;  2NRG A;  4DJG A;  2N9Y B;  1VDF A;  4BXL A;  3L71 G;  1RF0 A;  1T8Z A;  4U3F J;  3BRV B;  2PAJ A;  2BMR A;  3B5N C;  1WRG A;  4R4L A;  3H1I D;  1CI6 A;  2Q3I A;  3AE9 C;  4RKU J;  3CCE P;  2GUS A;  3A0H H;  1BCC J;  2HPC A;  2ZT9 D;  2G8Y A;  2IFM A;  3P8C E;  1GU5 A;  3AEB C;  1GL2 A;  2L5G B;  1JTH B;  3GLM A;  4NBH D;  5APW A;  1URQ D;  3OW2 O;  3H1L G;  1RQU A;  2LKM A;  1SFC A;  1HBW A;  5BU8 B;  2XKM A;  3RBX A;  1JOC A;  3L71 E;  4NPD A;  2E75 D;  3L74 E;  2W6B A;  3Q5S A;  5B66 H;  3CX5 H;  1JY2 N;  1LT9 A;  2WQY C;  3L35 A;  1KIL A;  2Y0C A;  4L76 A;  4I2L C;  1JB0 J;  1IFI A;  3R4Y A;  1KB9 D;  2KLV A;  2RKL A;  1NU1 D;  3V2N A;  1OWA A;  2A45 I;  2H88 C;  3H1H D;  1YQ3 C;  3L70 D;  3NXS A;  3H1L E;  1RE4 C;  2C9L Y;  1R8E A;  2KZJ A;  3JSV C;  3PTZ A;  3VP9 A;  5AW3 B;  1AVY A;  3SSU A;  3C0D A;  3C9I A;  1OW6 A;  3CXH E;  1VQL P;  1FOS F;  2WSF J;  2A06 D;  3MHV A;  5AVW B;  3V2P A;  2YFJ A;  2N1T A;  1KYO E;  2O01 H;  4YPC A;  2K9J B;  3B5N D;  5CMZ A;  4N6J A;  4JQ0 D;  1SQB J;  1Y47 A;  1NTK D;  2ZXE B;  3CWB G;  1EZV G;  1QLE D;  2BMO A;  1FDI A;  2N9B A;  3WU2 H;  5AW7 B;  1BE3 E;  3FGA D;  3PJS K;  1GZL A;  4HM5 A;  4NB9 D;  2E4Q A;  1VF5 C;  4AQR D;  4ZNC A;  1Q90 C;  1VQP P;  2KXP B;  2YMK A;  1SQX K;  1AA0 A;  1KOR A;  2JJL A;  4AYC A;  1MFZ A;  1OVV A;  1N7S B;  1VQ5 P;  4GIF A;  1XTG B;  4HH2 A;  4U3F E;  1J2J B;  4HM0 A;  3WMM 0;  4AUW A;  2ZJS E;  4LLH A;  1LTS C;  1KZU B;  4MN4 C;  3CWB E;  1HH0 A;  1EZV E;  1K73 Q;  1BCC E;  3C8V A;  2FFD C;  1IZN B;  3T97 A;  3CCR P;  3TGU J;  1NHL A;  1FC2 C;  2NPS B;  1ZLL A;  1DEE G;  3MD0 A;  3BCC J;  2BCC G;  3CCQ P;  2Q6Q A;  1IO4 A;  2IZ0 A;  3CXH I;  1X9V A;  3WUU A;  3BAT A;  2B9B A;  4ASW A;  4H13 C;  1FE6 A;  1KYO I;  1K8A Q;  3FXE A;  2O01 N;  1Q81 Q;  1L4A B;  2DE6 D;  4LC1 A;  2CPS A;  2Q9I A;  4DOJ A;  2JDI H;  1M1K Q;  1RE3 A;  4NBA D;  1D7M A;  3M0D C;  2YO3 A;  5APU A;  3KPE A;  4N78 E;  4OVN F;  2PP6 A;  3W68 A;  1SQB G;  4EYY Q;  1OZH A;  4PJ0 E;  4TLF A;  3H25 A;  3GTE A;  1G1I A;  3L72 J;  3GL0 A;  5CHX A;  5TIS H;  3CMA P;  4H44 B;  1VF5 D;  3M06 A;  3SFE C;  2I7F A;  5AVQ B;  1Q90 D;  2B87 B;  4W7Y A;  3H1I J;  3N7N A;  1PZQ A;  4O9B A;  2D2C C;  5CCG C;  1BGY J;  2XR8 A;  1EZV I;  3GHG A;  4OH8 B;  3D6Z A;  2NPS C;  1PGO A;  2AEF A;  4IOI H;  1N8R Q;  2FKW B;  3S9O A;  2BMQ A;  4GOE A;  3U1A A;  3RBZ A;  1SQB E;  3E1R A;  4WY4 A;  2FXP A;  4K35 A;  2YIU C;  2M0B A;  3A3Y B;  4GOD A;  2FYU J;  1KN7 A;  3HD7 B;  1M7L A;  1AQT A;  3L4F A;  3D70 A;  1BSN A;  3CC4 P;  1LTB C;  1SS1 A;  1L4A C;  1H0T B;  1LNQ A;  3PH0 A;  3RK3 C;  3Q5P A;  1DX7 A;  2Y9Y A;  3AE3 C;  1NYH A;  2Q3W A;  1M8O B;  2YVJ B;  2W83 C;  1SLQ A;  4ZKP A;  2HML A;  2E43 A;  1S2E A;  4H13 D;  1KQL A;  1OXZ A;  1G2C B;  1ULJ A;  2UWJ E;  2JR8 A;  5EFW B;  2OYH A;  2O1K A;  1E5W A;  3HUS A;  2IX7 C;  3D89 A;  5DJT B;  2OTJ P;  2HFE D;  2YNY A;  1NU1 J;  2ZT9 B;  3OJA B;  3H32 B;  5AW5 B;  3H1H J;  4IL6 H;  5E79 H;  1T6A A;  2YFI A;  4LGD E;  2HMM A;  1URQ B;  5BU5 A;  1CZQ A;  3AEE C;  2JZA A;  4HM4 A;  3AEC C;  2J5U A;  1JY3 P;  3I5C A;  2BEZ F;  1HJB A;  2W90 A;  5KLV G;  2O1J A;  1ZR2 A;  1PGP A;  4WB4 A;  1G8J B;  1NOH A;  3PHL A;  1LTJ B;  2E75 B;  3CCV P;  4CPG A;  2P1J A;  3IN6 A;  3VYI A;  5AW0 B;  2NZ2 A;  1QL2 A;  1LTA C;  1NKN A;  4PV1 C;  1RHZ B;  2XNX A;  5TJH A;  2V7Q H;  2D2C D;  3H1I G;  5CCG D;  2FXM A;  2YO2 A;  1KFM A;  3H6P A;  1RY3 A;  2B88 A;  2RMZ A;  1EQ7 A;  5KAI H;  2ZYA A;  2GUV A;  3VMG D;  3AE4 C;  3GB4 A;  3JCU H;  2OAR A;  1SQV D;  2MKV A;  4D6T D;  2IZ1 A;  1NTM D;  3MUD A;  4L75 A;  1KV4 A;  2HMO A;  4ZKU A;  2ZVN B;  3USS A;  2XU6 A;  1N73 A;  5KLV E;  1QVF O;  3L72 E;  2OYI C;  1FOS E;  4QDD A;  2FY8 A;  2XSH A;  1NTZ D;  2H43 A;  2H89 C;  4I6M C;  2ZT9 C;  3RK3 D;  2HMJ A;  1L0N D;  2YKQ A;  2V4H A;  3CCM P;  3H1I E;  3A0B E;  1OW8 A;  3SWY A;  3B5N B;  2AXT H;  1E79 H;  2KI7 B;  1T2K C;  3GZX A;  4HJG H;  2WSE J;  4JYC A;  1M1J A;  3V6I A;  3H1H G;  2QIW A;  3L70 G;  2LR2 A;  1YI2 P;  4EIJ A;  2H7H A;  2WIT A;  4UB6 H;  5TIS E;  2FYU E;  5AVY B;  2QRX A;  1QGK B;  3RL0 C;  4NBD D;  4Y99 B;  5B5E H;  1GW4 A;  2XND H;  4N3Y B;  1USE A;  1GK4 A;  1RF1 A;  3QH9 A;  1ZW0 A;  3M9B A;  1U57 A;  1XTC C;  2A06 G;  2E74 C;  5H2F H;  2KSE A;  2KUB A;  2QVA A;  4IFM A;  1SQQ D;  4PV1 D;  3TNU A;  1KB9 E;  2Q7C A;  4EI2 A;  3KQG A;  1FS0 E;  3TYY A;  1SQP D;  1OW7 A;  2HMN A;  3S4R A;  1NU1 E;  1NTK G;  1GTW A;  2HOD B;  4TT3 H;  4KJM A;  3H1H E;  3VMH D;  3L73 D;  3G3Z A;  5AW2 B;  1VQ8 P;  1BSH A;  1LP1 A;  3FOU A;  2DW3 A;  3L75 D;  1N7L A;  3MIW A;  1EDI A;  2KS1 A;  4UB8 H;  1OVR A;  2ZFC A;  3CWB J;  2NVG A;  2RH0 A;  2YFL A;  4H0L C;  2A06 E;  2QEX P;  3AZC A;  4C7N A;  1S9K E;  4QUQ A;  2RN0 A;  1BDD A;  1MKM A;  2P10 A;  1YIJ P;  3GF7 A;  5GTH E;  2IPP A;  1RF0 C;  1MV8 A;  2IYO A;  1JMB A;  1NTK E;  2I1J A;  4Y99 C;  2KSJ A;  1AV1 A;  3BAS A;  1YBK A;  2ITA A;  1O7G A;  1FZC C;  2SPZ A;  3UIA A;  2POH A;  1T2K D;  2WT7 B;  1GL2 C;  4OGQ C;  3MTU E;  3G6E P;  1VF5 B;  2C0W A;  1SQB K;  1OMI A;  3RL0 D;  5CJ4 A;  1SFC C;  2B89 A;  2ZXX A;  4QDF B;  2WSC H;  2QJY C;  3LW5 H;  4HM7 A;  4NBB D;  1KB9 I;  1IC2 A;  3HE5 B;  1NJI Q;  5C39 A;  4GT1 A;  2BCC J;  2E74 D;  1LT9 C;  2PGD A;  1ZR4 A;  1PL5 A;  3BVH A;  1KIL C;  1YHQ P;  5GTI H;  2HYN A;  2W8Z A;  4HM3 A;  3VMI D;  2FFD B;  1IK7 A;  4PD4 D;  1L0L D;  3HE4 B;  1JM0 A;  5AVZ B;  4ZMD A;  3AEA C;  1JTH A;  2W27 A;  2K9Y A;  1DIP A;  1OVU A;  4B86 A;  2Z5H A;  3I55 P;  1LTT C;  4H13 B;  1HUC A;  2XDJ A;  1M56 D;  3B71 A;  1DD3 A;  1O7N A;  2Y9Z A;  4H0L D;  2JO1 A;  1J1E C;  3U59 A;  2BAS A;  5APT A;  2FXO A;  2AXT E;  3P8C D;  3GOB A;  2N1T C;  3WUT A;  2WVR A;  4D6T J;  2I8D A;  2J59 M;  1FZE A;  2GBX A;  1JCC A;  2IYP A;  1KC8 Q;  3KZI E;  2FYZ A;  1VL2 A;  1QEX A;  2HMK A;  1PFI A;  2DE7 D;  1Q86 Q;  5AEU A;  1NTZ J;  2W6J H;  2O01 J;  1GL2 D;  1P84 H;  3L74 D;  4OGQ D;  1L0N J;  1Y8A A;  5KLI C;  3NFQ A;  2R44 A;  2NVF A;  4DCK A;  1JM1 A;  3KHU A;  1SFC D;  5KLV K;  2D2C B;  3NTN A;  4NPF X;  2NWF A;  3HE4 A;  1LGH B;  4I1L A;  3TK1 A;  4NBF D;  3VMZ A;  2IBZ D;  3TDK A;  2R32 A;  4K3A A;  2KLU A;  1ZRT E;  4EOT A;  2G3A A;  3LID A;  2XRX A;  3G4S P;  1FDO A;  2K9J A;  1KIL D;  1YJN P;  2WPQ A;  2J58 A;  4QUR A;  4W80 A;  2YIU B;  1IK9 A;  3O6Q B;  1NKZ B;  3CLQ A;  2C0X A;  2KP8 A;  1S4X A;  2R3C A;  1IFP A;  3RK3 B;  3B4S A;  1KQG B;  2K3R A;  3H1K D;  2OTK E;  1USD A;  1KMI Z;  2ZYG A;  4BRY B;  3GMA A;  3A5T A;  3V4Q A;  3A0H E;  3OA7 A;  4HM2 A;  3KYQ A;  4QCK A;  2FYU K;  1LTI C;  3CME P;  3N0Q A;  1PP9 D;  1FU1 A;  3FXD A;  5CBO A;  3Q5R A;  2NUK A;  1SQP J;  3M0A A;  1N7S A;  5KLV J;  1Q2N A;  1GK6 A;  2BCC E;  4Y28 J;  1BE3 D;  2KK7 A;  3L73 J;  1A02 F;  4L74 A;  2N1T D;  1RE3 C;  1IFM A;  4KT0 J;  2OYO A;  3L75 J;  4C7R A;  1IFN A;  1SQV G;  4D6T G;  5CCH A;  3EWK A;  1NTM G;  5APS A;  5L8R J;  4RJT A;  5B66 E;  3G71 P;  3CX5 E;  1OIP A;  4C46 A;  2R5B A;  1UUV A;  1L2P A;  1NU1 K;  1EDJ A;  4QDC A;  2NPS A;  2HR3 A;  1NTZ G;  4DZO A;  4U3F D;  4XFJ A;  1PPJ D;  1L0N G;  3KDP B;  4PV1 B;  4RES B;  5KAF H;  1BCC D;  1RIE A;  5KJ7 A;  3GHG C;  1L4A A;  4R4M A;  1NAY A;  1DEB A;  5APQ A;  1LWU B;  1S5L H;  1NGM B;  2R5D A;  4D6T E;  3EQ2 A;  2A45 H;  4AIV A;  1G1J A;  4WY4 C;  4PD4 H;  1Q7Y Q;  2WPS A;  2H8P D;  3M9Q A;  4KHX A;  1GDT A;  1UUW A;  2JWD A;  3OAK A;  1NTK K;  1NTZ E;  3Q3D A;  2OYI B;  2P2U A;  3RK3 E;  2JEE A;  1J1D C;  1L0N E;  3ITK A;  1AFO A;  2Q5U A;  4XE5 B;  2XZR A;  2ZYD A;  4NB8 D;  3G9R A;  3L70 J;  5AW4 B;  2QJP C;  2ZYL A;  3WU2 E;  4M3L A;  2B87 A;  4QMA A;  3MGN A;  4DT0 A;  1SQQ G;  5KKZ C;  3CC7 P;  1EXJ A;  2OYH C;  3HUS C;  1SQP G;  3FWN A;  3RK2 C;  1L0L J;  3PRJ A;  3AE7 C;  3L73 G;  3CX5 I;  4HJL A;  1FDM A;  3L75 G;  1PGQ A;  1SP4 A;  2WMM A;  4HM1 A;  1X79 B;  3GTS A;  3RL0 B;  2P58 A;  3HD7 A;  5APX A;  3VN0 A;  2YXQ B;  4P1C H;  1NTK J;  2E4P A;  2Q3E A;  1H0T A;  1LWU C;  5AVX B;  1A02 J;  4BWN A;  3FWL A;  2QA4 P;  2E74 B;  4IFF A;  3VOP A;  3V4W A;  1O7H A;  3NMD A;  1G2C A;  4IL6 X;  1SQP E;  3SFD C;  2OYI A;  3VTP C;  1GW3 A;  4GKG A;  3L73 E;  2E5Y A;  3IR9 A;  1ZN5 A;  2E76 C;  5AW9 B;  3B8E B;  3L75 E;  3H32 A;  3II6 A;  2HG5 D;  3L36 A;  4I7Z C;  4EDF A;  3MUD C;  1URQ A;  4WY4 D;  3ABV C;  4YTP C;  3CXH H;  2V7Q J;  2FYN B;  1N73 C;  2QJK C;  3GW6 A;  3M91 A;  1O7W A;  1KYO H;  1JO5 A;  1H8A A;  4JF7 A;  4H0L B;  5APY A;  2BEQ D;  1LT1 A;  1U7J A;  2OQQ A;  1LTJ A;  1QL1 A;  3MZW B;  1FQT A;  5HL4 A;  4WBA A;  1Q82 Q;  4HM8 A;  1CI6 B;  3CPW O;  2MJZ A;  2AEJ A;  1VQ9 P;  3TGU D;  2VRS A;  1P84 D;  3CCJ P;  4NBE D;  3RK2 D;  2HPC B;  3TSI A;  3BCC D;  1FZC B;  1QVG O;  2B1X A;  1L0L G;  1VPC A;  1GL2 B;  1M1J C;  1HF9 A;  2P67 A;  4OGQ B;  4HM6 A;  1YJ9 P;  1YIT P;  2JP3 A;  1FJK A;  3IF4 A;  3GL2 A;  2L91 A;  1SFC B;  1SQX D;  1PP9 J;  1VCK A;  1RF1 C;  3K5B A;  2QJY B;  5DJU B;  4A7P A;  4Z1M H;  5APV A;  2I1K A;  4L73 A;  3L70 E;  1FBM A;  1HWT C;  3KXD A;  3R2P A;  1RH5 B;  1LT9 B;  1DD4 A;  3B5N A;  1KIL B;  2CK3 H;  2FYN C;  3F5H A;  3VMA A;  2C9N Y;  3CD6 P;  2M3E A;  3L72 D;  3U1C A;  4PD4 E;  1L0L E;  5AW6 B;  3AE1 C;  1IFJ A;  2E76 D;  1N2D C;  3VCP A;  3GF3 A;  4WWI A;  1FAV A;  2WPR A;  2QE7 H;  3H1J D;  3L74 G;  3AE2 C;  2AXC A;  1EDK A;  1NDO A;  1UII A;  1BGY D;  1KQF B;  4IL6 E;  5E79 E;  1OX3 A;  1FZC A;  1J1E B;  3CI9 A;  1GD2 E;  2IBZ G;  4PJ0 H;  2N1T B;  3D71 A;  1ULI A;  1NO4 A;  2FYU D;  1AQ5 A;  3VMY A;  1PV3 A;  1HTL C;  4YXD C;  2HOD A;  4NPE A;  4JYB A;  4P1B H;  2OTL P;  1SQV K;  1HGZ A;  1RE4 A;  5KLI B;  2WSF H;  1NTM K;  3H1K G;  1U7M A;  5KAI E;  5CXM A;  1YQ4 C;  3P32 A;  3JCU E;  5K5G B;  3GG2 A;  3L37 A;  1PP9 G;  1NTZ K;  2IBZ E;  3EFG A;  2JO6 A;  1VM9 A;  2K37 A;  3DQY A;  1L0N K;  1LTG C;  5AW8 B;  1EXI A;  1BDC A;  1BE3 G;  4PD4 I;  1KIL E;  1S3J A;  1GMJ A;  2WSC J;  2ZAE B;  5AW1 B;  3LW5 J;  1VQ7 P;  3ZDM A;  2O3J A;  2YMY A;  1KD1 Q;  2DE5 D;  3T97 B;  3EQQ A;  4JBZ A;  3WUV A;  3EN1 A;  1NVO A;  1KFN A;  3H1K E;  2WT7 A;  1S9K D;  1JEK A;  2GA1 A;  3S1K A;  1W2B O;  1ZOY C;  3V2Q A;  3E1I A;  4U3F G;  3HTK B;  1PPJ G;  1SQV J;  1X0T A;  1NTM J;  1PP9 E;  3IFM A;  4GOF A;  1ZME C;  4QDF A;  5AVR B;  2FBW C;  2B24 A;  1BCC G;  2YKP A;  4UB6 E;  1NH4 A;  2M3B A;  3HE5 A;  2KB7 P;  3L71 D;  2PRR A;  2QM7 A;  5B5E E;  2Q1K A;  1JMM A;  2Y0E A;  1OFC X;  1SQQ K;  3D6Y A;  4AAY B;  1JY3 O;  2Z5I A;  1HJ0 A;  1SQP K;  1EC5 A;  2FFD A;  2R3S A;  5H2F E;  3I56 P;  1NAF A;  1SVF A;  2KYV A;  1PPJ E;  3N4X A;  2Y0D A;  2KIK A;  1ZP0 C;  3M9H A;  3H1L D;  1H88 A;  4NBC D;  2IBZ I;  5CJ0 A; 
#chains in the Genus database with same CATH homology
 1NTZ E;  4HM4 A;  1SQQ E;  1NTK E;  1VF5 D;  3GZX A;  4HM2 A;  4QCK A;  2I7F A;  4PD4 E;  2NVE A;  1L0L E;  1L0N E;  1SQV E;  1SQX E;  4HKV A;  3GOB A;  2E76 D;  3GKE A;  3N0Q A;  4NBG D;  3VCP A;  1NTM E;  1O7G A;  2FYU E;  4U3F E;  4NB8 D;  2QJK C;  2JZA A;  4HM0 A;  2NUK A;  1RFS A;  1SJG A;  1O7W A;  2GBX A;  1G8J B;  1O7M A;  4NBD D;  5AEW A;  2QJP C;  2BCC E;  2ZYL A;  2XR8 A;  3CWB E;  1EZV E;  2DE5 D;  4EMJ B;  2HMK A;  3EQQ A;  1NDO A;  2QPZ A;  3H1L E;  3EN1 A;  5KKZ C;  3H1K E;  2DE7 D;  1BCC E;  5AEU A;  1FQT A;  5HL4 A;  2BMQ A;  2D2C D;  3GCE A;  1SQB E;  4QUP A;  4OGQ D;  1NYK A;  4QDF B;  5KLI C;  4HM8 A;  2QJY C;  2YIU C;  4HM7 A;  3CX5 E;  4HJL A;  1PP9 E;  4NBB D;  4PV1 D;  3C0D A;  2GBW A;  3GZY A;  3VMG D;  1UUV A;  2NVF A;  3GB4 A;  1KB9 E;  1G8K B;  3H1J E;  2BMR A;  4QDC A;  4QDF A;  1JM1 A;  2NUM A;  4NBE D;  3CXH E;  4HM1 A;  1ULI A;  3VCA A;  2HMN A;  1WQL A;  1NU1 E;  2B24 A;  2E74 D;  2HMO A;  3GTS A;  2B1X A;  5BOK A;  2YFJ A;  3H1H E;  2NWF A;  3VMH D;  1KYO E;  2Q3W A;  5KLV E;  4P1C H;  2YVJ B;  2ZT9 D;  1BGY E;  3FOU A;  3L72 E;  4HM6 A;  2E4P A;  4NBF D;  4QDD A;  4HM3 A;  2DE6 D;  2XSH A;  3VMI D;  1ZRT E;  1EG9 A;  2HML A;  4AAY B;  4P1B H;  2XRX A;  4H13 D;  4NBH D;  1RIE A;  3GL2 A;  2HMJ A;  4NBA D;  1ULJ A;  2CKF A;  2BMO A;  1VCK A;  3TGU E;  4QUR A;  1P84 E;  3D89 A;  1BE3 E;  4H44 D;  1O7H A;  2NVG A;  4D6T E;  2YFL A;  3H1I E;  1SQP E;  5CXM A;  4AIV A;  4HM5 A;  3L70 E;  1O7P A;  3BCC E;  4NB9 D;  2A06 E;  3AZC A;  2E4Q A;  1PPJ E;  4QUQ A;  3L73 E;  3GTE A;  3L71 E;  2YFI A;  2XSO A;  2HMM A;  4NBC D;  1Q90 C;  3GL0 A;  1UUW A;  2E75 D;  2IBZ E;  3L74 E;  3L75 E;  2FYN C;  2JO6 A;  1O7N A;  1VM9 A;  3DQY A;  4H0L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...