3L73E

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 38
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l73E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l73E02
3GKEA 1VCKA 4PD4E 2Q3WA 3EQQA 4NB8D 2HMMA 3H1LE 2FYNC 2ZT9D 1PPJE 1SQPE 2HMOA 1Q90C 2HMKA 3TGUE 2DE6D 1FQTA 4P1CH 2YIUC 3H1HE 2YVJB 1JM1A 1VF5D 2E75D 2HMLA 4HKVA 3L73E 1SQVE 2BCCE 1SQBE 4NB9D 4PV1D 1RIEA 2E76D 1BCCE 2NVGA 1SQQE 3CXHE 1G8KB 5KKZC 2NVEA 1O7PA 1NTZE 3CWBE 1WQLA 3GCEA 2BMQA 1NU1E 1KB9E 4NBHD 2NWFA 3AZCA 1UUVA 2JZAA 3GL2A 4HM7A 4HJLA 4HM4A 4QCKA 2QJKC 4H0LD 4QDCA 4U3FE 1KYOE 3GTEA 4H13D 3GZYA 2FYUE 2XR8A 4HM0A 1NDOA 4NBDD 1ZRTE 2YFLA 1BGYE 1NYKA 3BCCE 2E74D 5KLIC 3VCAA 2IBZE 5KLVE 2DE5D 2GBXA 2HMNA 2QPZA 1O7NA 2D2CD 3GOBA 4NBCD 2XRXA 2E4PA 1L0NE 3L75E 5AEUA 2XSOA 1O7WA 2QJYC 4HM1A 3D89A 3VMID 3L71E 3DQYA 1NTKE 2BMRA 1ULIA 3L70E 3VMGD 4QURA 4NBBD 2BMOA 3VMHD 4NBFD 1BE3E 4NBGD 2NUMA 4AIVA 5AEWA 3FOUA 1O7GA 2YFIA 4NBAD 4HM6A 4QDFA 2NUKA 1EG9A 2NVFA 2XSHA 4H44D 4HM2A 1O7HA 4NBED 4QDDA 1PP9E 1G8JB 4QUPA 2YFJA 4HM8A 1EZVE 1SJGA 3L72E 4EMJB 5HL4A 2ZYLA 3L74E 2QJPC 1P84E 2B24A 2E4QA 3GL0A 4QDFB 3H1IE 1RFSA 1UUWA 2DE7D 4D6TE 3GZXA 3VCPA 2I7FA 2B1XA 3EN1A 3H1JE 3GB4A 3N0QA 4QUQA 4AAYB 1L0LE 2A06E 3H1KE 4HM5A 4P1BH 1O7MA 2HMJA 2CKFA 2JO6A 1VM9A 3C0DA 5CXMA 2GBWA 3CX5E 3GTSA 5BOKA 1NTME 1ULJA 4OGQD 4HM3A 1SQXE
chains in the Genus database with same CATH superfamily
3A7OA 1X9VA 3RK3B 3Q2YA 3H1LE 2WPVB 1T6AA 1VQNP 2B88A 2P7JA 4TT3H 1JM1A 2B89A 2C0XA 1SQPD 2W6JH 2JO1A 3TGUD 4PJ0H 3B5NB 3RK3D 3MGNA 5CCHD 4XE5B 1NYHA 1GU5A 3BCCG 1Q82Q 1QL2A 3P8CE 1L0NG 3L75G 5TJHA 3U1AA 3TSIA 4IOIH 1GL2B 3TNUA 4NPEA 4R4MA 4UB6E 3U59A 1PV3A 1RQUA 2QEXP 3MP7B 1K8AQ 2KNCA 1LTJB 4ZMDA 3I55P 1GL2D 4NBAD 1RF0C 4W80A 1ZN5A 2YKOA 2XU6A 2WQYC 2QJPC 1P84E 4D6TG 5AVTB 1AJYA 3AEEC 2YMYA 1N86A 2YKQA 1CW5A 4I7ZB 1LP1A 4WBAA 1Y9BA 2Y0DA 2XZRA 2IYOA 5L8RJ 1NWQA 1X8YA 3BCCJ 3Q3DA 1VF5C 1KQSO 1FZGA 2FYNC 2YKPA 2WSEH 3B71A 1L0NJ 1RF1B 1H0TA 1SQBG 2WSCH 4HKVA 2XNXA 3GMAA 1RF0A 2PFXA 1KYOD 4YXWH 1FZFA 1NVOA 1KZUB 2HPCA 1EDJA 1BGYG 1K73Q 1DD4A 1NDOA 3MUDC 2AEMA 2A45H 1YQ3C 3B8EB 1WRGA 1NTKG 1QVGO 1SP4A 5AVUB 5APTA 1O7WA 1TU3F 3L71E 4D6TJ 3DQYA 1ULIA 1JY2O 2V7QH 2OGUA 3Q1MA 1OWAA 3RL0B 2W27A 5CMZA 1K04A 3L72G 1IFIA 2KS1B 1GK6A 1CI6A 3P7KA 3RL0D 3CCEP 4IL6H 1SQBJ 4XFJA 1HWTC 5AW5B 1NKNA 3OW2O 2B1XA 1QX8A 1USDA 4GOEA 5AW7B 2WPSA 4HM3A 3H1LG 2IX7C 1BGYJ 2QVAA 2R5DA 1VCKA 4NB8D 3VMYA 4A7PA 1S5LX 3BATA 1JY2N 2KNCB 4BXLA 2W8ZA 3VTPC 2BEZF 4HH2A 1NTKJ 5KAIH 2KOGA 2K37A 3A0BE 5C39A 4H13C 2OYIB 4YPCA 3CXHI 2NWFA 3KYQA 1KYOE 2JP3A 1LT1A 3LW5J 1DH3A 4NBDD 4OWFA 5CBOA 2O1KA 3VCAA 1KB9D 3L72J 3TYYA 2QPZA 1FBMA 5KJ7C 1GD2E 3NTNA 3D71A 3BCCD 2XSOA 4RO0A 5AVYB 1RE4C 1H0TB 3CCSP 2QA4P 5AW4B 1L0ND 3L75D 3R4YA 3W67A 3KPEA 2P58A 5AVSB 1EG9A 1SQVK 3PP5A 1YTZI 2HPCB 2LKMA 4YTPC 1YIJP 1S2EA 2Q6QA 2BEQD 3FXDA 3RK2B 1J1DB 2W6BA 2L5GB 3H1JE 5KJ7A 4HM5A 2QG4A 2FYNB 2L91A 3AE6C 3Q5PA 5BOKA 4W7YA 4D6TD 1RE4A 1X22A 2FYZA 2KSJA 1SQQK 3BRVB 2HMKA 2AXCA 4DT0A 4GOFA 4PD4D 1VF5D 2ZVNB 2J59M 1LTAC 1BCCE 1SQQE 1UIXA 4ZNCA 1DD3A 4IFDK 2KB7P 4M3LA 4WVZA 1KTMA 1L2PA 3S4RA 1YYCA 1PGQA 2W83C 3TK1A 4EOTA 3L71G 3WUVA 4BWNA 1NHLA 1FS0E 1AFOA 3EFFK 3AEBC 4ZKPA 3B5NC 1RE3C 3U1CA 1LTGC 4LGDE 2HFED 2NVFA 3VOPA 2JEEA 4HM8A 1SJGA 2OARA 4I6MC 3P8MC 2O01J 3AE7C 4QDFB 1OXZA 3TF5A 1OVRA 3GB4A 1QEXA 3GF7A 3FX0A 3GTSA 3V2PA 1LTJC 4EYYQ 2J58A 2HMMA 1LWUB 4L74A 1QL1A 3A2AA 3B5NA 2HMOA 3SFDC 1RE3A 4H13B 2M5AB 2M0BA 5GTHH 3H1LD 4I2LC 4PV1D 5AVZB 2YXQB 1SFCC 1JO5A 1LT9C 1JY3P 2K3RA 4BRYA 1QGKB 3LIDA 2D2CC 4H13D 3KHUA 1BSHA 1KQLA 1ZW0A 4TLFA 2YFLA 3Q5RA 2DE5D 3QWOC 3AE2C 1YBKA 3M9QA 2KZIA 5AEUA 2E43A 2Q3EA 1H88A 3KZIH 3SFEC 1LTJA 4HM1A 3P8CD 3K5BA 5KJ7D 3SWYA 1YI2P 2R3SA 2RH0A 2JJLA 1SFCA 5APWA 2HG5D 1OW6A 1LT9A 4QDDA 1JM0A 3M06A 1EZVE 1IFMA 3M9HA 3H1JG 5KKZB 1Q86Q 3CX5H 3CMAP 4IL6E 1SLQA 1H89A 3H25A 2CKFA 1R5SA 4ASVA 1FZCC 2ZVOB 3O6QA 1JOCA 3GHGB 1JMBA 1HH0A 3WUTA 1T3UA 1S72P 3P32A 2K88A 4IFMA 1NAFA 2QJYB 1BCCG 2BCCE 1LTBC 4NB9D 4EIJA 1VQ9P 3M0DC 1OVVA 2WTYA 1VQ4P 2E74C 1S1CX 4LC1A 1KB9I 1LNQA 3PHLA 1M8OB 1EDKA 2IFNA 2PGDA 1RQVA 4AYCA 3GOBA 3AE8C 1W5CE 2Z5IA 3IF4A 1FOSF 1FZCA 1EC5A 3D89A 3TDKA 1URQA 1ZMEC 4HKZH 2KS1A 2OYIC 2ZT9B 2WT7A 1BE3E 2WZ7A 3L71D 3E1IA 5AW9B 3OAKA 3CMEP 1Q7YQ 4BRYB 2DW3A 2XSHA 3M0DA 4HM2A 1MKMA 4CPGA 3B5ND 1YJWP 1VQKP 1L0LK 1OZHA 4N78E 3PJSK 2LXCB 3EFGA 2ZYLA 2B24A 4OH8B 2XKMA 1USEA 1SQXD 4KT0J 1ZR2A 1A02J 3GLMA 2M3EA 4QUQA 4AAYB 1L0LE 1E79H 1O7MA 2P67A 2OTJP 5AW2B 5CXMA 2OTKE 2FFDB 4PD4I 1KFMA 4C46A 1JEKA 3CCJP 2OYIA 2GM4A 3MIWA 1NU1K 1S9KE 1PPJE 1SFCB 4GT1A 2HLOA 2ZYDA 2CPSA 1LT9B 1JTHB 2B9BA 2KK7A 3CD6P 3RK2C 1J1DC 2D2CB 2N9BA 2QM8A 1X79B 1ZXGA 1O7PA 1FZBA 3HD7B 2C9LY 1NU1E 1N8RQ 4HJLA 4HM4A 1SFCD 2IYPA 1N73C 4O9BA 3L75J 1ZRTE 1MFTA 5KAFH 2IBZE 1EXJA 3VMZA 2D2CD 2A45G 3JCUH 1PZQA 3O6QB 3AEDC 1RH5B 1GTWA 3E1RA 2KP8A 2KLVA 1EQ7A 1K05A 3A3YB 1GMJA 1S4XA 2YXRB 5AEWA 1VQ5P 4GODA 3G71P 1EZVG 2E76B 5DJTB 1KC8Q 1SS1A 1Q81Q 3CC4P 2ZYAA 2WSEJ 1SQXK 1N73A 2FXOA 4N6JA 3CX5D 1YHQP 1N2DC 2WSCJ 4R4LA 1FZCB 5TISH 3HE4A 3EQ2A 1JMMA 1HGZA 1URQB 2O3JA 5AVWB 1YJ9P 1SQXE 1SQVD 2GUSA 3H1JD 2WT7B 2H8PD 3IN6A 2Y0EA 4JF7A 2QIWA 1Q90C 2BCCG 1MV8A 1FDMA 1LTSC 4AUWA 1GZLA 4B86A 1JCDA 3D6YA 1VQPP 2E74B 4RKUJ 1MUUA 5B66H 3NFQA 5GTHE 1FDIA 2HODB 1R5LA 2V7QJ 3WMM0 4NBHD 1X0TA 1AVOA 1BCCD 2KUBA 1SQQD 2R3CA 1J2JB 1NYKA 1IFJA 2E74D 3L35A 1VQMP 2GBXA 1LWUC 2Q7CA 1FJPA 3AE9C 1OIPA 3UIAA 3WU2H 1BE3G 3AE1C 1J1EC 1PP9D 3KZIE 1YITP 4NBFD 2O1JA 1OVUA 4QDFA 3FWNA 1KILA 1WT6A 4NBED 1ZLLA 3HE5A 2IFMA 2BCCJ 4C7RA 5HL4A 3L74E 3I56P 1P84I 2B87A 3M91A 1L0LG 1LWUA 1G1JA 2YNYA 3N0QA 3H1KE 3AE5C 3NMDA 3H1LJ 2JO6A 1VM9A 2OYOA 2M5AA 2R5BA 3CX5E 1Z56A 4JBZA 2ITAA 1PPJG 4HJGH 1QLED 4I1LA 2N1TC 3VP8A 4DZOA 2DE6D 3CXHH 3A5TA 4EDFA 3L73E 1SQVE 4YXDC 4U3FD 1T2KC 2FYUD 2H88C 2OYHA 5KLVK 5KKZC 1BDDA 1NU1G 3G9RA 1N73B 5AW6B 3AEGC 1S3JA 2R44A 3AZCA 1FOSE 3RK2D 4QDCA 3HE4B 1JUNA 4HM0A 2ZYGA 2IBZG 3C9IA 3G3ZA 1ZR4A 1Q2NA 3GHGC 5KLVE 2HMNA 3CCMP 2QJYC 4HYTB 1WMKA 1L4AC 1G2CA 1L0LJ 1RY3A 2ZXXA 2N1TA 4H44C 2ZFCA 2OQQA 1MZ9A 2AXTH 2FY8A 1VPCA 1IK9A 4IFFA 3PH0A 1PP9E 4UB8E 2K1AA 2YIUB 5B5EH 3H32A 2WPQA 1IK7A 1M1JC 2HR3A 1S5LE 1XTGB 3GL0A 1VL2A 1NTZD 3CC7P 2K9JB 2WSSH 1UUWA 4IL6X 1EZVD 4RESB 2G3AA 1PGJA 3GHGA 3R2PA 2QJKB 1SQXG 2ZT9C 4DOJA 5AVRB 1ULJA 1L4AA 2LR2A 2WWWA 3HUSC 1JY3O 1KILB 4P1CH 2XV5A 2FYUK 1HVVA 2UWJE 3HE5B 4EI2A 3S1KA 1Q90D 5CBNA 2WSFH 2C0WA 2B87B 1SVFA 2BCCD 4NPFX 1IJDB 1M1JA 3V4QA 2H43A 4U3FE 2FYUE 1LGHB 2Q9IA 1KYOI 5BVZA 1D7MA 3L70D 2FFDC 3L71J 2VRSA 4NBCD 2O01N 1IZNB 1J1EB 5KAFE 1BSNA 1VQLP 3CCVP 3JCUE 1JNMA 2ZAEB 3HUSA 1NOHA 5AVXB 2SPZA 5CJ0A 1NGMB 3HD7C 4C7NA 3Q5SA 2OYHB 1SQXJ 2H89C 1FJKA 2E75B 3IR9A 2QSIA 3G4SP 1ZV8A 1BE3D 1HJ0A 3L74G 1NTZK 2E5YA 1KFNA 2POHA 1HF9A 2KSEA 3OA7A 4WWIA 3L37A 4N78D 2FFDA 3H1KG 2FXPA 2MJZA 1G2CB 3H1HD 1JTHA 1NTZE 2N1TB 5TISE 3M9BA 1M1KQ 1L0LD 3CCUP 2JWAA 2NZ2A 3CXHD 3RBZA 3II6A 3S9OA 2E76C 3HD7A 3L73G 1SQVG 3ITKA 3KXDA 1GK4A 2R32A 1S9KD 4H0LC 1PPJD 3H32B 4K35A 2N1TD 2Y0CA 4K3AA 1CSBA 4DJGA 2KLUA 3AEAC 3GL2A 1T2KD 2NPSB 4L76A 5B66E 5GTIH 1URQC 3GTEA 1NH4A 3V5BA 5KLVG 5APQA 1NU1D 1SQQG 1L4AB 4RJTA 3L74J 1M56D 4XA4A 1ZRTD 1KILE 4H44B 1KMIZ 3VMID 2IBZD 2JDIH 3L70E 1HGVA 3AEFC 2ZXEB 3CCQP 4NBGD 4WB4A 1PL5A 3WU2E 1L4AD 1HBWA 1EDIA 2YFIA 5AVVB 3M0AA 1PP9G 3V6IA 3JSVC 4H44D 1N7SC 1O7HA 1M1JB 1YJNP 3RGUA 5BU8B 3VN0A 5APUA 3L73J 1SQVJ 4JYBA 3H1JJ 1YTZT 2Y9YA 2Q5UA 4HB1A 3H1IE 1RFSA 2I1JA 4W7ZA 1MFZA 4UB8H 5AW3B 5CCGC 1S5LH 3HUSB 2Z5HA 5AVQB 1LJ2A 1OMIA 2CPBA 4AQRD 5KLVJ 3L36A 4C7NB 2P1JA 2ZT9D 1R8EA 3GG2A 2HODA 1BCCJ 4JPZB 1SQQJ 3H1HE 2YVJB 1A02F 1DIPA 1N7SA 1KB9H 3L4FA 2NVGA 3CXHE 3CWBE 3FGAD 1WQLA 4U3FG 3VP9A 2FYUG 5H2FH 1PIXA 3A0HH 3HRNA 2JR8A 1G1IA 1PP9J 2M8RA 1KQFB 2H7HA 5AW0B 5CCGA 1IFNA 1JB0J 3FWLA 2A45I 4N3YB 2K9YA 1FAVA 2QRXA 2V4HA 4OVNF 3C1LA 1OW7A 2NUMA 4AIVA 2KXPB 4MN4C 3MHVA 1O7GA 2P2UA 3HTKB 2C9NY 2AXTE 2IPPA 3HD7D 1VQ8P 3VMXA 1EZVI 1HUCA 3C8VA 2IDBA 4Y99C 2E4QA 1NTMD 5B5EE 1RHZB 1AQ5A 1SQPK 5APYA 2JKVA 1Y47A 4PD4H 3L74D 1NTZG 4U3FJ 1AVYA 2GBWA 2FYUJ 1NO4A 2I1KA 2Q3WA 3H1KD 1SQPE 2GA1A 4H0LB 3TGUE 3G6EP 3RK3E 2YIUC 2W6AA 1DX7A 1RIEA 3ZDMA 2E76D 1G8KB 2PAJA 1DEBA 1VDFA 3L73D 3BASA 1UUVA 4HM7A 2QJKC 4H0LD 1KN7A 1XTCC 1KV4A 3N4XA 4Y28J 2RN0A 2WITA 2JWDA 1M7LA 2FBWC 1FZAA 1URQD 1U7MA 2PRRA 1PFIA 1KILC 3L70G 3IAOA 2IZ1A 5KLVD 1FZEA 2Y9ZA 1EDLA 3VMGD 3MUDA 4NBBD 2BMOA 1UIIA 1E5WA 3CL3D 1N7SB 3LW5H 4WY4C 1NTZJ 3TNUB 1IFPA 3GF3A 1AA0A 3FOUA 3CI9A 1JY2P 2K9JA 2G8YA 1G8JB 3IFMA 2YFJA 2A06D 1NTMK 3H1IG 4PV1C 2CK3H 1N7SD 1M90Q 4OGQC 1FE6A 3OJAB 1PGPA 1GDTA 4L75A 1JCCA 1NTME 2OYHC 2I8DA 3GKEA 3KQGA 3NXSA 2E75C 2AEFA 5CCGD 3H1HG 3BVHA 1LP1B 4WY4A 1LTTC 5AW1B 2HMLA 2HYNA 3MTUE 3L70J 5CHXA 2W90A 5APVA 3CWBG 2KZJA 3AE3C 2WVRA 1PGOA 3V2NA 1FDOA 4L73A 1GU4A 3FXEA 4GDOA 1OW8A 4UB6H 5KLIC 5GTIE 2RKLA 2IBZI 2E4PA 3D6ZA 3F89A 2LXBA 2QJPB 4Z1MH 3H1IJ 5K5GB 3AECC 2XNDH 1BE3J 3RL0g 3T97A 3O8ZA 2FKWB 2KYVA 5BU5A 4QURA 5KTBA 1KQGB 2QM7A 2NPSC 1VF5B 4HM6A 3V4WA 2OTLP 4LLHA 3USSA 1P84H 4Y99B 4QMAA 3KDPB 4QUPA 1T8ZA 3H1HJ 1M57D 2YO2A 1N7LA 3N7NA 5E79E 3CC2P 4GKGA 3H6PA 1YQ4C 3CWBJ 2I7FA 1FC2C 1CI6B 2A06E 4U7JA 1BDCA 3I5CA 2N9YB 4GIFA 1SQBD 3EQQA 1SQPG 3SWFA 3EWKA 4PJ0E 1AV1A 3TGUG 2Q1KA 3LIEA 2O01H 2ZJSE 2AEJA 3GW6A 4ZKUA 1KORA 3RK3C 5CCHC 2YMKA 2NPSA 1NU1J 4JYCA 3MZWB 1BGYD 1VQ7P 2NVEA 1L0NK 3GCEA 2BMQA 1KB9E 1LTIC 1HJBA 2Q3IA 1U57A 5M1BA 3GZYA 3B4SA 1NTKD 3BCCE 5H2FE 3VYIA 3QH9A 3A0HE 1W2EA 2XRXA 1EXIA 1L0NE 3L75E 3CPWO 1Y8AA 5APSA 3CCLP 3D70A 2E5TA 4WY4B 2BMRA 2MKVA 2PP6A 1GL2C 2IZ0A 3VMHD 1KILD 1IFDA 5EFWB 5CCHA 3L72D 3V2QA 1K9MQ 1VQOP 1GW4A 2NRGA 3ABVC 3W68A 2NUKA 4PV1B 2KI7B 1SQPJ 3AE4C 4WY4D 3TGUJ 3CCRP 4EMJB 4OGQB 5AW8B 4NPDA 2RMZA 4JQ0D 2XDJA 1DEEG 2DE7D 1GW3A 3JC22 4D6TE 1JY3N 3EN1A 4P1BH 1NTMG 2HMJA 3PTZA 3C0DA 3H1ID 2WSFJ 3T97B 1SQBK 4DCKA 1OFCX 4OGQD 3CX5I 1CZQA 1W2BO 4PD4E 4I7ZC 1GL2A 1NKZB 1T3JA 3SSUA 3A0BH 5APXA 2YO3A 1VQ6P 1FQTA 2E75D 1SQBE 1ZP0C 3PRJA 1RF1C 3CLQA 2GUVA 2WPRA 1KYOH 1IO4A 1KD1Q 3MD0A 4QCKA 2JZAA 2FXMA 5KLIB 1NTKK 1NJIQ 5CJ4A 2XR8A 1IC2A 1ZOYC 2WMMA 3RBXA 1BGYE 3CWBD 3VMAA 1FU1A 4ASWA 1O7NA 1QVFO 2QE7H 3PLNA 2KIKA 3F5HA 2BASA 1NTKE 3HTKA 2E42A 3BRTB 2M3BA 1HTLC 2P10A 1AQTA 1NTMJ 4KJMA 1RF1A 3RL0C 1P84D 4KHXA 1U7JA 1NAYA 2Z4EA 3SWKA 3E7KA 3L72E 1H8AA 2NPSD 3V2RA 3WUUA 3H1KJ 2A06G 3GZXA 3VCPA 1OX3A 5DJUB 2J5UA 5E79H 5KAIE
chains in the Genus database with same CATH topology
3GKEA 1VCKA 4PD4E 2Q3WA 3EQQA 4NB8D 2HMMA 3H1LE 2FYNC 2ZT9D 1PPJE 1SQPE 2HMOA 1Q90C 2HMKA 3TGUE 2DE6D 1FQTA 4P1CH 2YIUC 3H1HE 2YVJB 1JM1A 1VF5D 2E75D 2HMLA 4HKVA 3L73E 1SQVE 2BCCE 1SQBE 4NB9D 4PV1D 1RIEA 2E76D 1BCCE 2NVGA 1SQQE 3CXHE 1G8KB 5KKZC 2NVEA 1O7PA 1NTZE 3CWBE 1WQLA 3GCEA 2BMQA 1NU1E 1KB9E 4NBHD 2NWFA 3AZCA 1UUVA 2JZAA 3GL2A 4HM7A 4HJLA 4HM4A 4QCKA 2QJKC 4H0LD 4QDCA 4U3FE 1KYOE 3GTEA 4H13D 3GZYA 2FYUE 2XR8A 4HM0A 1NDOA 4NBDD 1ZRTE 2YFLA 1BGYE 1NYKA 3BCCE 2E74D 5KLIC 3VCAA 2IBZE 5KLVE 2DE5D 2GBXA 2HMNA 2QPZA 1O7NA 2D2CD 3GOBA 4NBCD 2XRXA 2E4PA 1L0NE 3L75E 5AEUA 2XSOA 1O7WA 2QJYC 4HM1A 3D89A 3VMID 3L71E 3DQYA 1NTKE 2BMRA 1ULIA 3L70E 3VMGD 4QURA 4NBBD 2BMOA 3VMHD 4NBFD 1BE3E 4NBGD 2NUMA 4AIVA 5AEWA 3FOUA 1O7GA 2YFIA 4NBAD 4HM6A 4QDFA 2NUKA 1EG9A 2NVFA 2XSHA 4H44D 4HM2A 1O7HA 4NBED 4QDDA 1PP9E 1G8JB 4QUPA 2YFJA 4HM8A 1EZVE 1SJGA 3L72E 4EMJB 5HL4A 2ZYLA 3L74E 2QJPC 1P84E 2B24A 2E4QA 3GL0A 4QDFB 3H1IE 1RFSA 1UUWA 2DE7D 4D6TE 3GZXA 3VCPA 2I7FA 2B1XA 3EN1A 3H1JE 3GB4A 3N0QA 4QUQA 4AAYB 1L0LE 2A06E 3H1KE 4HM5A 4P1BH 1O7MA 2HMJA 2CKFA 2JO6A 1VM9A 3C0DA 5CXMA 2GBWA 3CX5E 3GTSA 5BOKA 1NTME 1ULJA 4OGQD 4HM3A 1SQXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKE A;  1VCK A;  4PD4 E;  2Q3W A;  3EQQ A;  4NB8 D;  2HMM A;  3H1L E;  2FYN C;  2ZT9 D;  1PPJ E;  1SQP E;  2HMO A;  1Q90 C;  2HMK A;  3TGU E;  2DE6 D;  1FQT A;  4P1C H;  2YIU C;  3H1H E;  2YVJ B;  1JM1 A;  1VF5 D;  2E75 D;  2HML A;  4HKV A;  3L73 E;  1SQV E;  2BCC E;  1SQB E;  4NB9 D;  4PV1 D;  1RIE A;  2E76 D;  1BCC E;  2NVG A;  1SQQ E;  3CXH E;  1G8K B;  5KKZ C;  2NVE A;  1O7P A;  1NTZ E;  3CWB E;  1WQL A;  3GCE A;  2BMQ A;  1NU1 E;  1KB9 E;  4NBH D;  2NWF A;  3AZC A;  1UUV A;  2JZA A;  3GL2 A;  4HM7 A;  4HJL A;  4HM4 A;  4QCK A;  2QJK C;  4H0L D;  4QDC A;  4U3F E;  1KYO E;  3GTE A;  4H13 D;  3GZY A;  2FYU E;  2XR8 A;  4HM0 A;  1NDO A;  4NBD D;  1ZRT E;  2YFL A;  1BGY E;  1NYK A;  3BCC E;  2E74 D;  5KLI C;  3VCA A;  2IBZ E;  5KLV E;  2DE5 D;  2GBX A;  2HMN A;  2QPZ A;  1O7N A;  2D2C D;  3GOB A;  4NBC D;  2XRX A;  2E4P A;  1L0N E;  3L75 E;  5AEU A;  2XSO A;  1O7W A;  2QJY C;  4HM1 A;  3D89 A;  3VMI D;  3L71 E;  3DQY A;  1NTK E;  2BMR A;  1ULI A;  3L70 E;  3VMG D;  4QUR A;  4NBB D;  2BMO A;  3VMH D;  4NBF D;  1BE3 E;  4NBG D;  2NUM A;  4AIV A;  5AEW A;  3FOU A;  1O7G A;  2YFI A;  4NBA D;  4HM6 A;  4QDF A;  2NUK A;  1EG9 A;  2NVF A;  2XSH A;  4H44 D;  4HM2 A;  1O7H A;  4NBE D;  4QDD A;  1PP9 E;  1G8J B;  4QUP A;  2YFJ A;  4HM8 A;  1EZV E;  1SJG A;  3L72 E;  4EMJ B;  5HL4 A;  2ZYL A;  3L74 E;  2QJP C;  1P84 E;  2B24 A;  2E4Q A;  3GL0 A;  4QDF B;  3H1I E;  1RFS A;  1UUW A;  2DE7 D;  4D6T E;  3GZX A;  3VCP A;  2I7F A;  2B1X A;  3EN1 A;  3H1J E;  3GB4 A;  3N0Q A;  4QUQ A;  4AAY B;  1L0L E;  2A06 E;  3H1K E;  4HM5 A;  4P1B H;  1O7M A;  2HMJ A;  2CKF A;  2JO6 A;  1VM9 A;  3C0D A;  5CXM A;  2GBW A;  3CX5 E;  3GTS A;  5BOK A;  1NTM E;  1ULJ A;  4OGQ D;  4HM3 A;  1SQX E; 
#chains in the Genus database with same CATH topology
 3A7O A;  1X9V A;  3RK3 B;  3Q2Y A;  3H1L E;  2WPV B;  1T6A A;  1VQN P;  2B88 A;  2P7J A;  4TT3 H;  1JM1 A;  2B89 A;  2C0X A;  1SQP D;  2W6J H;  2JO1 A;  3TGU D;  4PJ0 H;  3B5N B;  3RK3 D;  3MGN A;  5CCH D;  4XE5 B;  1NYH A;  1GU5 A;  3BCC G;  1Q82 Q;  1QL2 A;  3P8C E;  1L0N G;  3L75 G;  5TJH A;  3U1A A;  3TSI A;  4IOI H;  1GL2 B;  3TNU A;  4NPE A;  4R4M A;  4UB6 E;  3U59 A;  1PV3 A;  1RQU A;  2QEX P;  3MP7 B;  1K8A Q;  2KNC A;  1LTJ B;  4ZMD A;  3I55 P;  1GL2 D;  4NBA D;  1RF0 C;  4W80 A;  1ZN5 A;  2YKO A;  2XU6 A;  2WQY C;  2QJP C;  1P84 E;  4D6T G;  5AVT B;  1AJY A;  3AEE C;  2YMY A;  1N86 A;  2YKQ A;  1CW5 A;  4I7Z B;  1LP1 A;  4WBA A;  1Y9B A;  2Y0D A;  2XZR A;  2IYO A;  5L8R J;  1NWQ A;  1X8Y A;  3BCC J;  3Q3D A;  1VF5 C;  1KQS O;  1FZG A;  2FYN C;  2YKP A;  2WSE H;  3B71 A;  1L0N J;  1RF1 B;  1H0T A;  1SQB G;  2WSC H;  4HKV A;  2XNX A;  3GMA A;  1RF0 A;  2PFX A;  1KYO D;  4YXW H;  1FZF A;  1NVO A;  1KZU B;  2HPC A;  1EDJ A;  1BGY G;  1K73 Q;  1DD4 A;  1NDO A;  3MUD C;  2AEM A;  2A45 H;  1YQ3 C;  3B8E B;  1WRG A;  1NTK G;  1QVG O;  1SP4 A;  5AVU B;  5APT A;  1O7W A;  1TU3 F;  3L71 E;  4D6T J;  3DQY A;  1ULI A;  1JY2 O;  2V7Q H;  2OGU A;  3Q1M A;  1OWA A;  3RL0 B;  2W27 A;  5CMZ A;  1K04 A;  3L72 G;  1IFI A;  2KS1 B;  1GK6 A;  1CI6 A;  3P7K A;  3RL0 D;  3CCE P;  4IL6 H;  1SQB J;  4XFJ A;  1HWT C;  5AW5 B;  1NKN A;  3OW2 O;  2B1X A;  1QX8 A;  1USD A;  4GOE A;  5AW7 B;  2WPS A;  4HM3 A;  3H1L G;  2IX7 C;  1BGY J;  2QVA A;  2R5D A;  1VCK A;  4NB8 D;  3VMY A;  4A7P A;  1S5L X;  3BAT A;  1JY2 N;  2KNC B;  4BXL A;  2W8Z A;  3VTP C;  2BEZ F;  4HH2 A;  1NTK J;  5KAI H;  2KOG A;  2K37 A;  3A0B E;  5C39 A;  4H13 C;  2OYI B;  4YPC A;  3CXH I;  2NWF A;  3KYQ A;  1KYO E;  2JP3 A;  1LT1 A;  3LW5 J;  1DH3 A;  4NBD D;  4OWF A;  5CBO A;  2O1K A;  3VCA A;  1KB9 D;  3L72 J;  3TYY A;  2QPZ A;  1FBM A;  5KJ7 C;  1GD2 E;  3NTN A;  3D71 A;  3BCC D;  2XSO A;  4RO0 A;  5AVY B;  1RE4 C;  1H0T B;  3CCS P;  2QA4 P;  5AW4 B;  1L0N D;  3L75 D;  3R4Y A;  3W67 A;  3KPE A;  2P58 A;  5AVS B;  1EG9 A;  1SQV K;  3PP5 A;  1YTZ I;  2HPC B;  2LKM A;  4YTP C;  1YIJ P;  1S2E A;  2Q6Q A;  2BEQ D;  3FXD A;  3RK2 B;  1J1D B;  2W6B A;  2L5G B;  3H1J E;  5KJ7 A;  4HM5 A;  2QG4 A;  2FYN B;  2L91 A;  3AE6 C;  3Q5P A;  5BOK A;  4W7Y A;  4D6T D;  1RE4 A;  1X22 A;  2FYZ A;  2KSJ A;  1SQQ K;  3BRV B;  2HMK A;  2AXC A;  4DT0 A;  4GOF A;  4PD4 D;  1VF5 D;  2ZVN B;  2J59 M;  1LTA C;  1BCC E;  1SQQ E;  1UIX A;  4ZNC A;  1DD3 A;  4IFD K;  2KB7 P;  4M3L A;  4WVZ A;  1KTM A;  1L2P A;  3S4R A;  1YYC A;  1PGQ A;  2W83 C;  3TK1 A;  4EOT A;  3L71 G;  3WUV A;  4BWN A;  1NHL A;  1FS0 E;  1AFO A;  3EFF K;  3AEB C;  4ZKP A;  3B5N C;  1RE3 C;  3U1C A;  1LTG C;  4LGD E;  2HFE D;  2NVF A;  3VOP A;  2JEE A;  4HM8 A;  1SJG A;  2OAR A;  4I6M C;  3P8M C;  2O01 J;  3AE7 C;  4QDF B;  1OXZ A;  3TF5 A;  1OVR A;  3GB4 A;  1QEX A;  3GF7 A;  3FX0 A;  3GTS A;  3V2P A;  1LTJ C;  4EYY Q;  2J58 A;  2HMM A;  1LWU B;  4L74 A;  1QL1 A;  3A2A A;  3B5N A;  2HMO A;  3SFD C;  1RE3 A;  4H13 B;  2M5A B;  2M0B A;  5GTH H;  3H1L D;  4I2L C;  4PV1 D;  5AVZ B;  2YXQ B;  1SFC C;  1JO5 A;  1LT9 C;  1JY3 P;  2K3R A;  4BRY A;  1QGK B;  3LID A;  2D2C C;  4H13 D;  3KHU A;  1BSH A;  1KQL A;  1ZW0 A;  4TLF A;  2YFL A;  3Q5R A;  2DE5 D;  3QWO C;  3AE2 C;  1YBK A;  3M9Q A;  2KZI A;  5AEU A;  2E43 A;  2Q3E A;  1H88 A;  3KZI H;  3SFE C;  1LTJ A;  4HM1 A;  3P8C D;  3K5B A;  5KJ7 D;  3SWY A;  1YI2 P;  2R3S A;  2RH0 A;  2JJL A;  1SFC A;  5APW A;  2HG5 D;  1OW6 A;  1LT9 A;  4QDD A;  1JM0 A;  3M06 A;  1EZV E;  1IFM A;  3M9H A;  3H1J G;  5KKZ B;  1Q86 Q;  3CX5 H;  3CMA P;  4IL6 E;  1SLQ A;  1H89 A;  3H25 A;  2CKF A;  1R5S A;  4ASV A;  1FZC C;  2ZVO B;  3O6Q A;  1JOC A;  3GHG B;  1JMB A;  1HH0 A;  3WUT A;  1T3U A;  1S72 P;  3P32 A;  2K88 A;  4IFM A;  1NAF A;  2QJY B;  1BCC G;  2BCC E;  1LTB C;  4NB9 D;  4EIJ A;  1VQ9 P;  3M0D C;  1OVV A;  2WTY A;  1VQ4 P;  2E74 C;  1S1C X;  4LC1 A;  1KB9 I;  1LNQ A;  3PHL A;  1M8O B;  1EDK A;  2IFN A;  2PGD A;  1RQV A;  4AYC A;  3GOB A;  3AE8 C;  1W5C E;  2Z5I A;  3IF4 A;  1FOS F;  1FZC A;  1EC5 A;  3D89 A;  3TDK A;  1URQ A;  1ZME C;  4HKZ H;  2KS1 A;  2OYI C;  2ZT9 B;  2WT7 A;  1BE3 E;  2WZ7 A;  3L71 D;  3E1I A;  5AW9 B;  3OAK A;  3CME P;  1Q7Y Q;  4BRY B;  2DW3 A;  2XSH A;  3M0D A;  4HM2 A;  1MKM A;  4CPG A;  3B5N D;  1YJW P;  1VQK P;  1L0L K;  1OZH A;  4N78 E;  3PJS K;  2LXC B;  3EFG A;  2ZYL A;  2B24 A;  4OH8 B;  2XKM A;  1USE A;  1SQX D;  4KT0 J;  1ZR2 A;  1A02 J;  3GLM A;  2M3E A;  4QUQ A;  4AAY B;  1L0L E;  1E79 H;  1O7M A;  2P67 A;  2OTJ P;  5AW2 B;  5CXM A;  2OTK E;  2FFD B;  4PD4 I;  1KFM A;  4C46 A;  1JEK A;  3CCJ P;  2OYI A;  2GM4 A;  3MIW A;  1NU1 K;  1S9K E;  1PPJ E;  1SFC B;  4GT1 A;  2HLO A;  2ZYD A;  2CPS A;  1LT9 B;  1JTH B;  2B9B A;  2KK7 A;  3CD6 P;  3RK2 C;  1J1D C;  2D2C B;  2N9B A;  2QM8 A;  1X79 B;  1ZXG A;  1O7P A;  1FZB A;  3HD7 B;  2C9L Y;  1NU1 E;  1N8R Q;  4HJL A;  4HM4 A;  1SFC D;  2IYP A;  1N73 C;  4O9B A;  3L75 J;  1ZRT E;  1MFT A;  5KAF H;  2IBZ E;  1EXJ A;  3VMZ A;  2D2C D;  2A45 G;  3JCU H;  1PZQ A;  3O6Q B;  3AED C;  1RH5 B;  1GTW A;  3E1R A;  2KP8 A;  2KLV A;  1EQ7 A;  1K05 A;  3A3Y B;  1GMJ A;  1S4X A;  2YXR B;  5AEW A;  1VQ5 P;  4GOD A;  3G71 P;  1EZV G;  2E76 B;  5DJT B;  1KC8 Q;  1SS1 A;  1Q81 Q;  3CC4 P;  2ZYA A;  2WSE J;  1SQX K;  1N73 A;  2FXO A;  4N6J A;  3CX5 D;  1YHQ P;  1N2D C;  2WSC J;  4R4L A;  1FZC B;  5TIS H;  3HE4 A;  3EQ2 A;  1JMM A;  1HGZ A;  1URQ B;  2O3J A;  5AVW B;  1YJ9 P;  1SQX E;  1SQV D;  2GUS A;  3H1J D;  2WT7 B;  2H8P D;  3IN6 A;  2Y0E A;  4JF7 A;  2QIW A;  1Q90 C;  2BCC G;  1MV8 A;  1FDM A;  1LTS C;  4AUW A;  1GZL A;  4B86 A;  1JCD A;  3D6Y A;  1VQP P;  2E74 B;  4RKU J;  1MUU A;  5B66 H;  3NFQ A;  5GTH E;  1FDI A;  2HOD B;  1R5L A;  2V7Q J;  3WMM 0;  4NBH D;  1X0T A;  1AVO A;  1BCC D;  2KUB A;  1SQQ D;  2R3C A;  1J2J B;  1NYK A;  1IFJ A;  2E74 D;  3L35 A;  1VQM P;  2GBX A;  1LWU C;  2Q7C A;  1FJP A;  3AE9 C;  1OIP A;  3UIA A;  3WU2 H;  1BE3 G;  3AE1 C;  1J1E C;  1PP9 D;  3KZI E;  1YIT P;  4NBF D;  2O1J A;  1OVU A;  4QDF A;  3FWN A;  1KIL A;  1WT6 A;  4NBE D;  1ZLL A;  3HE5 A;  2IFM A;  2BCC J;  4C7R A;  5HL4 A;  3L74 E;  3I56 P;  1P84 I;  2B87 A;  3M91 A;  1L0L G;  1LWU A;  1G1J A;  2YNY A;  3N0Q A;  3H1K E;  3AE5 C;  3NMD A;  3H1L J;  2JO6 A;  1VM9 A;  2OYO A;  2M5A A;  2R5B A;  3CX5 E;  1Z56 A;  4JBZ A;  2ITA A;  1PPJ G;  4HJG H;  1QLE D;  4I1L A;  2N1T C;  3VP8 A;  4DZO A;  2DE6 D;  3CXH H;  3A5T A;  4EDF A;  3L73 E;  1SQV E;  4YXD C;  4U3F D;  1T2K C;  2FYU D;  2H88 C;  2OYH A;  5KLV K;  5KKZ C;  1BDD A;  1NU1 G;  3G9R A;  1N73 B;  5AW6 B;  3AEG C;  1S3J A;  2R44 A;  3AZC A;  1FOS E;  3RK2 D;  4QDC A;  3HE4 B;  1JUN A;  4HM0 A;  2ZYG A;  2IBZ G;  3C9I A;  3G3Z A;  1ZR4 A;  1Q2N A;  3GHG C;  5KLV E;  2HMN A;  3CCM P;  2QJY C;  4HYT B;  1WMK A;  1L4A C;  1G2C A;  1L0L J;  1RY3 A;  2ZXX A;  2N1T A;  4H44 C;  2ZFC A;  2OQQ A;  1MZ9 A;  2AXT H;  2FY8 A;  1VPC A;  1IK9 A;  4IFF A;  3PH0 A;  1PP9 E;  4UB8 E;  2K1A A;  2YIU B;  5B5E H;  3H32 A;  2WPQ A;  1IK7 A;  1M1J C;  2HR3 A;  1S5L E;  1XTG B;  3GL0 A;  1VL2 A;  1NTZ D;  3CC7 P;  2K9J B;  2WSS H;  1UUW A;  4IL6 X;  1EZV D;  4RES B;  2G3A A;  1PGJ A;  3GHG A;  3R2P A;  2QJK B;  1SQX G;  2ZT9 C;  4DOJ A;  5AVR B;  1ULJ A;  1L4A A;  2LR2 A;  2WWW A;  3HUS C;  1JY3 O;  1KIL B;  4P1C H;  2XV5 A;  2FYU K;  1HVV A;  2UWJ E;  3HE5 B;  4EI2 A;  3S1K A;  1Q90 D;  5CBN A;  2WSF H;  2C0W A;  2B87 B;  1SVF A;  2BCC D;  4NPF X;  1IJD B;  1M1J A;  3V4Q A;  2H43 A;  4U3F E;  2FYU E;  1LGH B;  2Q9I A;  1KYO I;  5BVZ A;  1D7M A;  3L70 D;  2FFD C;  3L71 J;  2VRS A;  4NBC D;  2O01 N;  1IZN B;  1J1E B;  5KAF E;  1BSN A;  1VQL P;  3CCV P;  3JCU E;  1JNM A;  2ZAE B;  3HUS A;  1NOH A;  5AVX B;  2SPZ A;  5CJ0 A;  1NGM B;  3HD7 C;  4C7N A;  3Q5S A;  2OYH B;  1SQX J;  2H89 C;  1FJK A;  2E75 B;  3IR9 A;  2QSI A;  3G4S P;  1ZV8 A;  1BE3 D;  1HJ0 A;  3L74 G;  1NTZ K;  2E5Y A;  1KFN A;  2POH A;  1HF9 A;  2KSE A;  3OA7 A;  4WWI A;  3L37 A;  4N78 D;  2FFD A;  3H1K G;  2FXP A;  2MJZ A;  1G2C B;  3H1H D;  1JTH A;  1NTZ E;  2N1T B;  5TIS E;  3M9B A;  1M1K Q;  1L0L D;  3CCU P;  2JWA A;  2NZ2 A;  3CXH D;  3RBZ A;  3II6 A;  3S9O A;  2E76 C;  3HD7 A;  3L73 G;  1SQV G;  3ITK A;  3KXD A;  1GK4 A;  2R32 A;  1S9K D;  4H0L C;  1PPJ D;  3H32 B;  4K35 A;  2N1T D;  2Y0C A;  4K3A A;  1CSB A;  4DJG A;  2KLU A;  3AEA C;  3GL2 A;  1T2K D;  2NPS B;  4L76 A;  5B66 E;  5GTI H;  1URQ C;  3GTE A;  1NH4 A;  3V5B A;  5KLV G;  5APQ A;  1NU1 D;  1SQQ G;  1L4A B;  4RJT A;  3L74 J;  1M56 D;  4XA4 A;  1ZRT D;  1KIL E;  4H44 B;  1KMI Z;  3VMI D;  2IBZ D;  2JDI H;  3L70 E;  1HGV A;  3AEF C;  2ZXE B;  3CCQ P;  4NBG D;  4WB4 A;  1PL5 A;  3WU2 E;  1L4A D;  1HBW A;  1EDI A;  2YFI A;  5AVV B;  3M0A A;  1PP9 G;  3V6I A;  3JSV C;  4H44 D;  1N7S C;  1O7H A;  1M1J B;  1YJN P;  3RGU A;  5BU8 B;  3VN0 A;  5APU A;  3L73 J;  1SQV J;  4JYB A;  3H1J J;  1YTZ T;  2Y9Y A;  2Q5U A;  4HB1 A;  3H1I E;  1RFS A;  2I1J A;  4W7Z A;  1MFZ A;  4UB8 H;  5AW3 B;  5CCG C;  1S5L H;  3HUS B;  2Z5H A;  5AVQ B;  1LJ2 A;  1OMI A;  2CPB A;  4AQR D;  5KLV J;  3L36 A;  4C7N B;  2P1J A;  2ZT9 D;  1R8E A;  3GG2 A;  2HOD A;  1BCC J;  4JPZ B;  1SQQ J;  3H1H E;  2YVJ B;  1A02 F;  1DIP A;  1N7S A;  1KB9 H;  3L4F A;  2NVG A;  3CXH E;  3CWB E;  3FGA D;  1WQL A;  4U3F G;  3VP9 A;  2FYU G;  5H2F H;  1PIX A;  3A0H H;  3HRN A;  2JR8 A;  1G1I A;  1PP9 J;  2M8R A;  1KQF B;  2H7H A;  5AW0 B;  5CCG A;  1IFN A;  1JB0 J;  3FWL A;  2A45 I;  4N3Y B;  2K9Y A;  1FAV A;  2QRX A;  2V4H A;  4OVN F;  3C1L A;  1OW7 A;  2NUM A;  4AIV A;  2KXP B;  4MN4 C;  3MHV A;  1O7G A;  2P2U A;  3HTK B;  2C9N Y;  2AXT E;  2IPP A;  3HD7 D;  1VQ8 P;  3VMX A;  1EZV I;  1HUC A;  3C8V A;  2IDB A;  4Y99 C;  2E4Q A;  1NTM D;  5B5E E;  1RHZ B;  1AQ5 A;  1SQP K;  5APY A;  2JKV A;  1Y47 A;  4PD4 H;  3L74 D;  1NTZ G;  4U3F J;  1AVY A;  2GBW A;  2FYU J;  1NO4 A;  2I1K A;  2Q3W A;  3H1K D;  1SQP E;  2GA1 A;  4H0L B;  3TGU E;  3G6E P;  3RK3 E;  2YIU C;  2W6A A;  1DX7 A;  1RIE A;  3ZDM A;  2E76 D;  1G8K B;  2PAJ A;  1DEB A;  1VDF A;  3L73 D;  3BAS A;  1UUV A;  4HM7 A;  2QJK C;  4H0L D;  1KN7 A;  1XTC C;  1KV4 A;  3N4X A;  4Y28 J;  2RN0 A;  2WIT A;  2JWD A;  1M7L A;  2FBW C;  1FZA A;  1URQ D;  1U7M A;  2PRR A;  1PFI A;  1KIL C;  3L70 G;  3IAO A;  2IZ1 A;  5KLV D;  1FZE A;  2Y9Z A;  1EDL A;  3VMG D;  3MUD A;  4NBB D;  2BMO A;  1UII A;  1E5W A;  3CL3 D;  1N7S B;  3LW5 H;  4WY4 C;  1NTZ J;  3TNU B;  1IFP A;  3GF3 A;  1AA0 A;  3FOU A;  3CI9 A;  1JY2 P;  2K9J A;  2G8Y A;  1G8J B;  3IFM A;  2YFJ A;  2A06 D;  1NTM K;  3H1I G;  4PV1 C;  2CK3 H;  1N7S D;  1M90 Q;  4OGQ C;  1FE6 A;  3OJA B;  1PGP A;  1GDT A;  4L75 A;  1JCC A;  1NTM E;  2OYH C;  2I8D A;  3GKE A;  3KQG A;  3NXS A;  2E75 C;  2AEF A;  5CCG D;  3H1H G;  3BVH A;  1LP1 B;  4WY4 A;  1LTT C;  5AW1 B;  2HML A;  2HYN A;  3MTU E;  3L70 J;  5CHX A;  2W90 A;  5APV A;  3CWB G;  2KZJ A;  3AE3 C;  2WVR A;  1PGO A;  3V2N A;  1FDO A;  4L73 A;  1GU4 A;  3FXE A;  4GDO A;  1OW8 A;  4UB6 H;  5KLI C;  5GTI E;  2RKL A;  2IBZ I;  2E4P A;  3D6Z A;  3F89 A;  2LXB A;  2QJP B;  4Z1M H;  3H1I J;  5K5G B;  3AEC C;  2XND H;  1BE3 J;  3RL0 g;  3T97 A;  3O8Z A;  2FKW B;  2KYV A;  5BU5 A;  4QUR A;  5KTB A;  1KQG B;  2QM7 A;  2NPS C;  1VF5 B;  4HM6 A;  3V4W A;  2OTL P;  4LLH A;  3USS A;  1P84 H;  4Y99 B;  4QMA A;  3KDP B;  4QUP A;  1T8Z A;  3H1H J;  1M57 D;  2YO2 A;  1N7L A;  3N7N A;  5E79 E;  3CC2 P;  4GKG A;  3H6P A;  1YQ4 C;  3CWB J;  2I7F A;  1FC2 C;  1CI6 B;  2A06 E;  4U7J A;  1BDC A;  3I5C A;  2N9Y B;  4GIF A;  1SQB D;  3EQQ A;  1SQP G;  3SWF A;  3EWK A;  4PJ0 E;  1AV1 A;  3TGU G;  2Q1K A;  3LIE A;  2O01 H;  2ZJS E;  2AEJ A;  3GW6 A;  4ZKU A;  1KOR A;  3RK3 C;  5CCH C;  2YMK A;  2NPS A;  1NU1 J;  4JYC A;  3MZW B;  1BGY D;  1VQ7 P;  2NVE A;  1L0N K;  3GCE A;  2BMQ A;  1KB9 E;  1LTI C;  1HJB A;  2Q3I A;  1U57 A;  5M1B A;  3GZY A;  3B4S A;  1NTK D;  3BCC E;  5H2F E;  3VYI A;  3QH9 A;  3A0H E;  1W2E A;  2XRX A;  1EXI A;  1L0N E;  3L75 E;  3CPW O;  1Y8A A;  5APS A;  3CCL P;  3D70 A;  2E5T A;  4WY4 B;  2BMR A;  2MKV A;  2PP6 A;  1GL2 C;  2IZ0 A;  3VMH D;  1KIL D;  1IFD A;  5EFW B;  5CCH A;  3L72 D;  3V2Q A;  1K9M Q;  1VQO P;  1GW4 A;  2NRG A;  3ABV C;  3W68 A;  2NUK A;  4PV1 B;  2KI7 B;  1SQP J;  3AE4 C;  4WY4 D;  3TGU J;  3CCR P;  4EMJ B;  4OGQ B;  5AW8 B;  4NPD A;  2RMZ A;  4JQ0 D;  2XDJ A;  1DEE G;  2DE7 D;  1GW3 A;  3JC2 2;  4D6T E;  1JY3 N;  3EN1 A;  4P1B H;  1NTM G;  2HMJ A;  3PTZ A;  3C0D A;  3H1I D;  2WSF J;  3T97 B;  1SQB K;  4DCK A;  1OFC X;  4OGQ D;  3CX5 I;  1CZQ A;  1W2B O;  4PD4 E;  4I7Z C;  1GL2 A;  1NKZ B;  1T3J A;  3SSU A;  3A0B H;  5APX A;  2YO3 A;  1VQ6 P;  1FQT A;  2E75 D;  1SQB E;  1ZP0 C;  3PRJ A;  1RF1 C;  3CLQ A;  2GUV A;  2WPR A;  1KYO H;  1IO4 A;  1KD1 Q;  3MD0 A;  4QCK A;  2JZA A;  2FXM A;  5KLI B;  1NTK K;  1NJI Q;  5CJ4 A;  2XR8 A;  1IC2 A;  1ZOY C;  2WMM A;  3RBX A;  1BGY E;  3CWB D;  3VMA A;  1FU1 A;  4ASW A;  1O7N A;  1QVF O;  2QE7 H;  3PLN A;  2KIK A;  3F5H A;  2BAS A;  1NTK E;  3HTK A;  2E42 A;  3BRT B;  2M3B A;  1HTL C;  2P10 A;  1AQT A;  1NTM J;  4KJM A;  1RF1 A;  3RL0 C;  1P84 D;  4KHX A;  1U7J A;  1NAY A;  2Z4E A;  3SWK A;  3E7K A;  3L72 E;  1H8A A;  2NPS D;  3V2R A;  3WUU A;  3H1K J;  2A06 G;  3GZX A;  3VCP A;  1OX3 A;  5DJU B;  2J5U A;  5E79 H;  5KAI E; 
#chains in the Genus database with same CATH homology
 3GKE A;  1VCK A;  4PD4 E;  2Q3W A;  3EQQ A;  4NB8 D;  2HMM A;  3H1L E;  2FYN C;  2ZT9 D;  1PPJ E;  1SQP E;  2HMO A;  1Q90 C;  2HMK A;  3TGU E;  2DE6 D;  1FQT A;  4P1C H;  2YIU C;  3H1H E;  2YVJ B;  1JM1 A;  1VF5 D;  2E75 D;  2HML A;  4HKV A;  3L73 E;  1SQV E;  2BCC E;  1SQB E;  4NB9 D;  4PV1 D;  1RIE A;  2E76 D;  1BCC E;  2NVG A;  1SQQ E;  3CXH E;  1G8K B;  5KKZ C;  2NVE A;  1O7P A;  1NTZ E;  3CWB E;  1WQL A;  3GCE A;  2BMQ A;  1NU1 E;  1KB9 E;  4NBH D;  2NWF A;  3AZC A;  1UUV A;  2JZA A;  3GL2 A;  4HM7 A;  4HJL A;  4HM4 A;  4QCK A;  2QJK C;  4H0L D;  4QDC A;  4U3F E;  1KYO E;  3GTE A;  4H13 D;  3GZY A;  2FYU E;  2XR8 A;  4HM0 A;  1NDO A;  4NBD D;  1ZRT E;  2YFL A;  1BGY E;  1NYK A;  3BCC E;  2E74 D;  5KLI C;  3VCA A;  2IBZ E;  5KLV E;  2DE5 D;  2GBX A;  2HMN A;  2QPZ A;  1O7N A;  2D2C D;  3GOB A;  4NBC D;  2XRX A;  2E4P A;  1L0N E;  3L75 E;  5AEU A;  2XSO A;  1O7W A;  2QJY C;  4HM1 A;  3D89 A;  3VMI D;  3L71 E;  3DQY A;  1NTK E;  2BMR A;  1ULI A;  3L70 E;  3VMG D;  4QUR A;  4NBB D;  2BMO A;  3VMH D;  4NBF D;  1BE3 E;  4NBG D;  2NUM A;  4AIV A;  5AEW A;  3FOU A;  1O7G A;  2YFI A;  4NBA D;  4HM6 A;  4QDF A;  2NUK A;  1EG9 A;  2NVF A;  2XSH A;  4H44 D;  4HM2 A;  1O7H A;  4NBE D;  4QDD A;  1PP9 E;  1G8J B;  4QUP A;  2YFJ A;  4HM8 A;  1EZV E;  1SJG A;  3L72 E;  4EMJ B;  5HL4 A;  2ZYL A;  3L74 E;  2QJP C;  1P84 E;  2B24 A;  2E4Q A;  3GL0 A;  4QDF B;  3H1I E;  1RFS A;  1UUW A;  2DE7 D;  4D6T E;  3GZX A;  3VCP A;  2I7F A;  2B1X A;  3EN1 A;  3H1J E;  3GB4 A;  3N0Q A;  4QUQ A;  4AAY B;  1L0L E;  2A06 E;  3H1K E;  4HM5 A;  4P1B H;  1O7M A;  2HMJ A;  2CKF A;  2JO6 A;  1VM9 A;  3C0D A;  5CXM A;  2GBW A;  3CX5 E;  3GTS A;  5BOK A;  1NTM E;  1ULJ A;  4OGQ D;  4HM3 A;  1SQX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...