2E4PA

Crystal structure of bpha3 (oxidized form)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
TFTKACSVDEVPPGEALQVSHDAQKVAIFNVDGEFFATQDQCTHGEWSLSEGGYLDGDVVECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGRDVLVDFSRAALHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biphenyl dioxygenase ferredoxin subunit
publication title Molecular Mechanism of the Redox-dependent Interaction between NADH-dependent Ferredoxin Reductase and Rieske-type [2Fe-2S] Ferredoxin
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Electron transport
total genus 19
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e4pA00
3GZYA 3VMHD 2DE6D 1BE3E 4QCKA 3L70E 3L75E 4NB8D 4H13D 1SQQE 3GZXA 3EQQA 2A06E 2B24A 2GBXA 5AEWA 2HMOA 3VMGD 3GB4A 4PD4E 4H0LD 4NBHD 2BCCE 2E76D 5CXMA 3TGUE 2NUMA 3GL0A 1EZVE 4PV1D 2XSHA 4HM1A 2HMNA 1L0LE 1ULJA 3CWBE 1WQLA 4AIVA 2YIUC 4QDFB 1NTME 1FQTA 2I7FA 4H44D 2HMLA 3GCEA 2JZAA 3H1IE 3H1HE 1O7WA 1BCCE 4QDDA 3VCPA 2E4PA 4HM0A 4HJLA 1UUVA 2E75D 2XR8A 3GOBA 3L72E 1RFSA 2FYUE 2GBWA 3CX5E 1P84E 3VCAA 2XSOA 3CXHE 2YFLA 1PPJE 1SQPE 2JO6A 2NVEA 2QJPC 5KLVE 4NBDD 5BOKA 4HM5A 2B1XA 4P1BH 1O7HA 2QJKC 4QURA 3H1LE 2ZT9D 1SJGA 2YVJB 4AAYB 1O7NA 1ULIA 2QJYC 4HM8A 4NBCD 3D89A 1SQBE 3C0DA 3GTSA 4QDCA 3EN1A 4U3FE 1NU1E 2NVGA 2YFIA 2HMMA 5HL4A 2ZYLA 1EG9A 3GL2A 1NTKE 4HKVA 1NDOA 2DE5D 1Q90C 3FOUA 3GKEA 1SQVE 4HM6A 1SQXE 5AEUA 3GTEA 4NB9D 3L73E 2DE7D 5KLIC 2HMKA 4NBAD 2BMOA 2D2CD 1JM1A 3DQYA 4NBBD 4NBGD 3AZCA 4QDFA 1G8KB 2E4QA 4QUQA 3N0QA 1KB9E 4OGQD 3VMID 4P1CH 3H1JE 2QPZA 2FYNC 4EMJB 1O7MA 1PP9E 1L0NE 3BCCE 1VM9A 2CKFA 2YFJA 1O7GA 3L74E 2E74D 1KYOE 1VF5D 1NTZE 1VCKA 1UUWA 2HMJA 1NYKA 1G8JB 2IBZE 2NUKA 4NBED 4HM2A 5KKZC 4HM7A 1ZRTE 4NBFD 1RIEA 4HM4A 2BMQA 2XRXA 4QUPA 4HM3A 2Q3WA 2NVFA 3H1KE 3L71E 2NWFA 1O7PA 2BMRA
chains in the Genus database with same CATH superfamily
3GZYA 3VMHD 2DE6D 1BE3E 4QCKA 3L70E 3L75E 4NB8D 4H13D 1SQQE 3GZXA 3EQQA 2A06E 2B24A 2GBXA 5AEWA 2HMOA 3VMGD 3GB4A 4PD4E 4H0LD 4NBHD 2BCCE 2E76D 5CXMA 3TGUE 2NUMA 3GL0A 1EZVE 4PV1D 2XSHA 4HM1A 2HMNA 1L0LE 1ULJA 3CWBE 1WQLA 4AIVA 2YIUC 4QDFB 1NTME 1FQTA 2I7FA 4H44D 2HMLA 3GCEA 2JZAA 3H1IE 3H1HE 1O7WA 1BCCE 4QDDA 3VCPA 2E4PA 4HM0A 4HJLA 1UUVA 2E75D 2XR8A 3GOBA 3L72E 1RFSA 2FYUE 2GBWA 3CX5E 1P84E 3VCAA 2XSOA 3CXHE 2YFLA 1PPJE 1SQPE 2JO6A 2NVEA 2QJPC 5KLVE 4NBDD 5BOKA 4HM5A 2B1XA 4P1BH 1O7HA 2QJKC 4QURA 3H1LE 2ZT9D 1SJGA 2YVJB 4AAYB 1O7NA 1ULIA 2QJYC 4HM8A 4NBCD 3D89A 1SQBE 3C0DA 3GTSA 4QDCA 3EN1A 4U3FE 1NU1E 2NVGA 2YFIA 2HMMA 5HL4A 2ZYLA 1EG9A 3GL2A 1NTKE 4HKVA 1NDOA 2DE5D 1Q90C 3FOUA 3GKEA 1SQVE 4HM6A 1SQXE 5AEUA 3GTEA 4NB9D 3L73E 2DE7D 5KLIC 2HMKA 4NBAD 2BMOA 2D2CD 1JM1A 3DQYA 4NBBD 4NBGD 3AZCA 4QDFA 1G8KB 2E4QA 4QUQA 3N0QA 1KB9E 4OGQD 3VMID 4P1CH 3H1JE 2QPZA 2FYNC 4EMJB 1O7MA 1PP9E 1L0NE 3BCCE 1VM9A 2CKFA 2YFJA 1O7GA 3L74E 2E74D 1KYOE 1VF5D 1NTZE 1VCKA 1UUWA 2HMJA 1NYKA 1G8JB 2IBZE 2NUKA 4NBED 4HM2A 5KKZC 4HM7A 1ZRTE 4NBFD 1RIEA 4HM4A 2BMQA 2XRXA 4QUPA 4HM3A 2Q3WA 2NVFA 3H1KE 3L71E 2NWFA 1O7PA 2BMRA
chains in the Genus database with same CATH topology
3GZYA 3VMHD 2DE6D 1BE3E 4QCKA 3L70E 3L75E 4NB8D 4H13D 1SQQE 3GZXA 3EQQA 2A06E 2B24A 2GBXA 5AEWA 2HMOA 3VMGD 3GB4A 4PD4E 4H0LD 4NBHD 2BCCE 2E76D 5CXMA 3TGUE 2NUMA 3GL0A 1EZVE 4PV1D 2XSHA 4HM1A 2HMNA 1L0LE 1ULJA 3CWBE 1WQLA 4AIVA 2YIUC 4QDFB 1NTME 1FQTA 2I7FA 4H44D 2HMLA 3GCEA 2JZAA 3H1IE 3H1HE 1O7WA 1BCCE 4QDDA 3VCPA 2E4PA 4HM0A 4HJLA 1UUVA 2E75D 2XR8A 3GOBA 3L72E 1RFSA 2FYUE 2GBWA 3CX5E 1P84E 3VCAA 2XSOA 3CXHE 2YFLA 1PPJE 1SQPE 2JO6A 2NVEA 2QJPC 5KLVE 4NBDD 5BOKA 4HM5A 2B1XA 4P1BH 1O7HA 2QJKC 4QURA 3H1LE 2ZT9D 1SJGA 2YVJB 4AAYB 1O7NA 1ULIA 2QJYC 4HM8A 4NBCD 3D89A 1SQBE 3C0DA 3GTSA 4QDCA 3EN1A 4U3FE 1NU1E 2NVGA 2YFIA 2HMMA 5HL4A 2ZYLA 1EG9A 3GL2A 1NTKE 4HKVA 1NDOA 2DE5D 1Q90C 3FOUA 3GKEA 1SQVE 4HM6A 1SQXE 5AEUA 3GTEA 4NB9D 3L73E 2DE7D 5KLIC 2HMKA 4NBAD 2BMOA 2D2CD 1JM1A 3DQYA 4NBBD 4NBGD 3AZCA 4QDFA 1G8KB 2E4QA 4QUQA 3N0QA 1KB9E 4OGQD 3VMID 4P1CH 3H1JE 2QPZA 2FYNC 4EMJB 1O7MA 1PP9E 1L0NE 3BCCE 1VM9A 2CKFA 2YFJA 1O7GA 3L74E 2E74D 1KYOE 1VF5D 1NTZE 1VCKA 1UUWA 2HMJA 1NYKA 1G8JB 2IBZE 2NUKA 4NBED 4HM2A 5KKZC 4HM7A 1ZRTE 4NBFD 1RIEA 4HM4A 2BMQA 2XRXA 4QUPA 4HM3A 2Q3WA 2NVFA 3H1KE 3L71E 2NWFA 1O7PA 2BMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZY A;  3VMH D;  2DE6 D;  1BE3 E;  4QCK A;  3L70 E;  3L75 E;  4NB8 D;  4H13 D;  1SQQ E;  3GZX A;  3EQQ A;  2A06 E;  2B24 A;  2GBX A;  5AEW A;  2HMO A;  3VMG D;  3GB4 A;  4PD4 E;  4H0L D;  4NBH D;  2BCC E;  2E76 D;  5CXM A;  3TGU E;  2NUM A;  3GL0 A;  1EZV E;  4PV1 D;  2XSH A;  4HM1 A;  2HMN A;  1L0L E;  1ULJ A;  3CWB E;  1WQL A;  4AIV A;  2YIU C;  4QDF B;  1NTM E;  1FQT A;  2I7F A;  4H44 D;  2HML A;  3GCE A;  2JZA A;  3H1I E;  3H1H E;  1O7W A;  1BCC E;  4QDD A;  3VCP A;  2E4P A;  4HM0 A;  4HJL A;  1UUV A;  2E75 D;  2XR8 A;  3GOB A;  3L72 E;  1RFS A;  2FYU E;  2GBW A;  3CX5 E;  1P84 E;  3VCA A;  2XSO A;  3CXH E;  2YFL A;  1PPJ E;  1SQP E;  2JO6 A;  2NVE A;  2QJP C;  5KLV E;  4NBD D;  5BOK A;  4HM5 A;  2B1X A;  4P1B H;  1O7H A;  2QJK C;  4QUR A;  3H1L E;  2ZT9 D;  1SJG A;  2YVJ B;  4AAY B;  1O7N A;  1ULI A;  2QJY C;  4HM8 A;  4NBC D;  3D89 A;  1SQB E;  3C0D A;  3GTS A;  4QDC A;  3EN1 A;  4U3F E;  1NU1 E;  2NVG A;  2YFI A;  2HMM A;  5HL4 A;  2ZYL A;  1EG9 A;  3GL2 A;  1NTK E;  4HKV A;  1NDO A;  2DE5 D;  1Q90 C;  3FOU A;  3GKE A;  1SQV E;  4HM6 A;  1SQX E;  5AEU A;  3GTE A;  4NB9 D;  3L73 E;  2DE7 D;  5KLI C;  2HMK A;  4NBA D;  2BMO A;  2D2C D;  1JM1 A;  3DQY A;  4NBB D;  4NBG D;  3AZC A;  4QDF A;  1G8K B;  2E4Q A;  4QUQ A;  3N0Q A;  1KB9 E;  4OGQ D;  3VMI D;  4P1C H;  3H1J E;  2QPZ A;  2FYN C;  4EMJ B;  1O7M A;  1PP9 E;  1L0N E;  3BCC E;  1VM9 A;  2CKF A;  2YFJ A;  1O7G A;  3L74 E;  2E74 D;  1KYO E;  1VF5 D;  1NTZ E;  1VCK A;  1UUW A;  2HMJ A;  1NYK A;  1G8J B;  2IBZ E;  2NUK A;  4NBE D;  4HM2 A;  5KKZ C;  4HM7 A;  1ZRT E;  4NBF D;  1RIE A;  4HM4 A;  2BMQ A;  2XRX A;  4QUP A;  4HM3 A;  2Q3W A;  2NVF A;  3H1K E;  3L71 E;  2NWF A;  1O7P A;  2BMR A; 
#chains in the Genus database with same CATH topology
 3GZY A;  3VMH D;  2DE6 D;  1BE3 E;  4QCK A;  3L70 E;  3L75 E;  4NB8 D;  4H13 D;  1SQQ E;  3GZX A;  3EQQ A;  2A06 E;  2B24 A;  2GBX A;  5AEW A;  2HMO A;  3VMG D;  3GB4 A;  4PD4 E;  4H0L D;  4NBH D;  2BCC E;  2E76 D;  5CXM A;  3TGU E;  2NUM A;  3GL0 A;  1EZV E;  4PV1 D;  2XSH A;  4HM1 A;  2HMN A;  1L0L E;  1ULJ A;  3CWB E;  1WQL A;  4AIV A;  2YIU C;  4QDF B;  1NTM E;  1FQT A;  2I7F A;  4H44 D;  2HML A;  3GCE A;  2JZA A;  3H1I E;  3H1H E;  1O7W A;  1BCC E;  4QDD A;  3VCP A;  2E4P A;  4HM0 A;  4HJL A;  1UUV A;  2E75 D;  2XR8 A;  3GOB A;  3L72 E;  1RFS A;  2FYU E;  2GBW A;  3CX5 E;  1P84 E;  3VCA A;  2XSO A;  3CXH E;  2YFL A;  1PPJ E;  1SQP E;  2JO6 A;  2NVE A;  2QJP C;  5KLV E;  4NBD D;  5BOK A;  4HM5 A;  2B1X A;  4P1B H;  1O7H A;  2QJK C;  4QUR A;  3H1L E;  2ZT9 D;  1SJG A;  2YVJ B;  4AAY B;  1O7N A;  1ULI A;  2QJY C;  4HM8 A;  4NBC D;  3D89 A;  1SQB E;  3C0D A;  3GTS A;  4QDC A;  3EN1 A;  4U3F E;  1NU1 E;  2NVG A;  2YFI A;  2HMM A;  5HL4 A;  2ZYL A;  1EG9 A;  3GL2 A;  1NTK E;  4HKV A;  1NDO A;  2DE5 D;  1Q90 C;  3FOU A;  3GKE A;  1SQV E;  4HM6 A;  1SQX E;  5AEU A;  3GTE A;  4NB9 D;  3L73 E;  2DE7 D;  5KLI C;  2HMK A;  4NBA D;  2BMO A;  2D2C D;  1JM1 A;  3DQY A;  4NBB D;  4NBG D;  3AZC A;  4QDF A;  1G8K B;  2E4Q A;  4QUQ A;  3N0Q A;  1KB9 E;  4OGQ D;  3VMI D;  4P1C H;  3H1J E;  2QPZ A;  2FYN C;  4EMJ B;  1O7M A;  1PP9 E;  1L0N E;  3BCC E;  1VM9 A;  2CKF A;  2YFJ A;  1O7G A;  3L74 E;  2E74 D;  1KYO E;  1VF5 D;  1NTZ E;  1VCK A;  1UUW A;  2HMJ A;  1NYK A;  1G8J B;  2IBZ E;  2NUK A;  4NBE D;  4HM2 A;  5KKZ C;  4HM7 A;  1ZRT E;  4NBF D;  1RIE A;  4HM4 A;  2BMQ A;  2XRX A;  4QUP A;  4HM3 A;  2Q3W A;  2NVF A;  3H1K E;  3L71 E;  2NWF A;  1O7P A;  2BMR A; 
#chains in the Genus database with same CATH homology
 3GZY A;  3VMH D;  2DE6 D;  1BE3 E;  4QCK A;  3L70 E;  3L75 E;  4NB8 D;  4H13 D;  1SQQ E;  3GZX A;  3EQQ A;  2A06 E;  2B24 A;  2GBX A;  5AEW A;  2HMO A;  3VMG D;  3GB4 A;  4PD4 E;  4H0L D;  4NBH D;  2BCC E;  2E76 D;  5CXM A;  3TGU E;  2NUM A;  3GL0 A;  1EZV E;  4PV1 D;  2XSH A;  4HM1 A;  2HMN A;  1L0L E;  1ULJ A;  3CWB E;  1WQL A;  4AIV A;  2YIU C;  4QDF B;  1NTM E;  1FQT A;  2I7F A;  4H44 D;  2HML A;  3GCE A;  2JZA A;  3H1I E;  3H1H E;  1O7W A;  1BCC E;  4QDD A;  3VCP A;  2E4P A;  4HM0 A;  4HJL A;  1UUV A;  2E75 D;  2XR8 A;  3GOB A;  3L72 E;  1RFS A;  2FYU E;  2GBW A;  3CX5 E;  1P84 E;  3VCA A;  2XSO A;  3CXH E;  2YFL A;  1PPJ E;  1SQP E;  2JO6 A;  2NVE A;  2QJP C;  5KLV E;  4NBD D;  5BOK A;  4HM5 A;  2B1X A;  4P1B H;  1O7H A;  2QJK C;  4QUR A;  3H1L E;  2ZT9 D;  1SJG A;  2YVJ B;  4AAY B;  1O7N A;  1ULI A;  2QJY C;  4HM8 A;  4NBC D;  3D89 A;  1SQB E;  3C0D A;  3GTS A;  4QDC A;  3EN1 A;  4U3F E;  1NU1 E;  2NVG A;  2YFI A;  2HMM A;  5HL4 A;  2ZYL A;  1EG9 A;  3GL2 A;  1NTK E;  4HKV A;  1NDO A;  2DE5 D;  1Q90 C;  3FOU A;  3GKE A;  1SQV E;  4HM6 A;  1SQX E;  5AEU A;  3GTE A;  4NB9 D;  3L73 E;  2DE7 D;  5KLI C;  2HMK A;  4NBA D;  2BMO A;  2D2C D;  1JM1 A;  3DQY A;  4NBB D;  4NBG D;  3AZC A;  4QDF A;  1G8K B;  2E4Q A;  4QUQ A;  3N0Q A;  1KB9 E;  4OGQ D;  3VMI D;  4P1C H;  3H1J E;  2QPZ A;  2FYN C;  4EMJ B;  1O7M A;  1PP9 E;  1L0N E;  3BCC E;  1VM9 A;  2CKF A;  2YFJ A;  1O7G A;  3L74 E;  2E74 D;  1KYO E;  1VF5 D;  1NTZ E;  1VCK A;  1UUW A;  2HMJ A;  1NYK A;  1G8J B;  2IBZ E;  2NUK A;  4NBE D;  4HM2 A;  5KKZ C;  4HM7 A;  1ZRT E;  4NBF D;  1RIE A;  4HM4 A;  2BMQ A;  2XRX A;  4QUP A;  4HM3 A;  2Q3W A;  2NVF A;  3H1K E;  3L71 E;  2NWF A;  1O7P A;  2BMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...