2E4PA

Crystal structure of bpha3 (oxidized form)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
TFTKACSVDEVPPGEALQVSHDAQKVAIFNVDGEFFATQDQCTHGEWSLSEGGYLDGDVVECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGRDVLVDFSRAALHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Biphenyl dioxygenase ferredoxin subunit
publication title Molecular Mechanism of the Redox-dependent Interaction between NADH-dependent Ferredoxin Reductase and Rieske-type [2Fe-2S] Ferredoxin
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 19
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e4pA00
1NTME 2IBZE 2NUMA 3GB4A 1KYOE 1WQLA 2A06E 1EG9A 5CXMA 2E4QA 2FYNC 2GBXA 2HMOA 4NBDD 2E74D 4H13D 1NTZE 4AIVA 2E76D 3DQYA 3N0QA 3H1KE 1UUWA 3H1LE 3L73E 1O7NA 2XR8A 2JZAA 4QUQA 2NWFA 1NTKE 2I7FA 4HM0A 4HM1A 3GL0A 2YFJA 1PPJE 2BMOA 2B24A 1EZVE 1JM1A 2D2CD 1FQTA 2XSHA 4HM4A 2YVJB 4HM8A 5KLIC 3GZYA 1BCCE 1KB9E 2YIUC 3H1IE 4P1CH 2NVGA 3FOUA 1O7HA 5KKZC 4HM3A 2XRXA 3GOBA 1O7PA 3L74E 4PV1D 2YFIA 4AAYB 1NDOA 4NBBD 1Q90C 2E4PA 2Q3WA 1O7MA 4NB8D 4U3FE 1NU1E 4H44D 1SJGA 3H1HE 2QJPC 4HM7A 4EMJB 2JO6A 1L0NE 2XSOA 1BE3E 3GTEA 1PP9E 2ZYLA 3TGUE 1ZRTE 2HMMA 2DE6D 3AZCA 4QUPA 4P1BH 2NVEA 1L0LE 4QDDA 3H1JE 4QCKA 3VMID 1G8JB 3CX5E 4QDCA 2QPZA 2CKFA 1UUVA 3L71E 2DE5D 2YFLA 4NBCD 4PD4E 2HMLA 3D89A 2HMNA 1O7GA 3L75E 4NBHD 3EN1A 3VCPA 1RIEA 2FYUE 4HM2A 2NUKA 3GTSA 3VCAA 2BMQA 3GZXA 3CXHE 2GBWA 4QURA 5AEUA 4NBFD 1O7WA 2HMJA 2BMRA 3VMHD 5HL4A 2DE7D 2QJKC 5AEWA 1VCKA 3GCEA 4HKVA 2B1XA 1ULIA 3EQQA 3L72E 1ULJA 1P84E 4NB9D 1SQPE 2E75D 1G8KB 5KLVE 4OGQD 3GKEA 3BCCE 2QJYC 3GL2A 1RFSA 3L70E 3CWBE 4NBED 1SQXE 4HJLA 2ZT9D 4NBGD 4QDFB 5BOKA 2HMKA 1VF5D 1VM9A 4H0LD 3C0DA 4HM6A 1SQQE 4QDFA 3VMGD 1SQVE 2NVFA 1NYKA 4NBAD 1SQBE 4HM5A 2BCCE
chains in the Genus database with same CATH superfamily
1NTME 2IBZE 2NUMA 3GB4A 1KYOE 1WQLA 2A06E 1EG9A 5CXMA 2E4QA 2FYNC 2GBXA 2HMOA 4NBDD 2E74D 4H13D 1NTZE 4AIVA 2E76D 3DQYA 3N0QA 3H1KE 1UUWA 3H1LE 3L73E 1O7NA 2XR8A 2JZAA 4QUQA 2NWFA 1NTKE 2I7FA 4HM0A 4HM1A 3GL0A 2YFJA 1PPJE 2BMOA 2B24A 1EZVE 1JM1A 2D2CD 1FQTA 2XSHA 4HM4A 2YVJB 4HM8A 5KLIC 3GZYA 1BCCE 1KB9E 2YIUC 3H1IE 4P1CH 2NVGA 3FOUA 1O7HA 5KKZC 4HM3A 2XRXA 3GOBA 1O7PA 3L74E 4PV1D 2YFIA 4AAYB 1NDOA 4NBBD 1Q90C 2E4PA 2Q3WA 1O7MA 4NB8D 4U3FE 1NU1E 4H44D 1SJGA 3H1HE 2QJPC 4HM7A 4EMJB 2JO6A 1L0NE 2XSOA 1BE3E 3GTEA 1PP9E 2ZYLA 3TGUE 1ZRTE 2HMMA 2DE6D 3AZCA 4QUPA 4P1BH 2NVEA 1L0LE 4QDDA 3H1JE 4QCKA 3VMID 1G8JB 3CX5E 4QDCA 2QPZA 2CKFA 1UUVA 3L71E 2DE5D 2YFLA 4NBCD 4PD4E 2HMLA 3D89A 2HMNA 1O7GA 3L75E 4NBHD 3EN1A 3VCPA 1RIEA 2FYUE 4HM2A 2NUKA 3GTSA 3VCAA 2BMQA 3GZXA 3CXHE 2GBWA 4QURA 5AEUA 4NBFD 1O7WA 2HMJA 2BMRA 3VMHD 5HL4A 2DE7D 2QJKC 5AEWA 1VCKA 3GCEA 4HKVA 2B1XA 1ULIA 3EQQA 3L72E 1ULJA 1P84E 4NB9D 1SQPE 2E75D 1G8KB 5KLVE 4OGQD 3GKEA 3BCCE 2QJYC 3GL2A 1RFSA 3L70E 3CWBE 4NBED 1SQXE 4HJLA 2ZT9D 4NBGD 4QDFB 5BOKA 2HMKA 1VF5D 1VM9A 4H0LD 3C0DA 4HM6A 1SQQE 4QDFA 3VMGD 1SQVE 2NVFA 1NYKA 4NBAD 1SQBE 4HM5A 2BCCE
chains in the Genus database with same CATH topology
1NTME 2IBZE 2NUMA 3GB4A 1KYOE 1WQLA 2A06E 1EG9A 5CXMA 2E4QA 2FYNC 2GBXA 2HMOA 4NBDD 2E74D 4H13D 1NTZE 4AIVA 2E76D 3DQYA 3N0QA 3H1KE 1UUWA 3H1LE 3L73E 1O7NA 2XR8A 2JZAA 4QUQA 2NWFA 1NTKE 2I7FA 4HM0A 4HM1A 3GL0A 2YFJA 1PPJE 2BMOA 2B24A 1EZVE 1JM1A 2D2CD 1FQTA 2XSHA 4HM4A 2YVJB 4HM8A 5KLIC 3GZYA 1BCCE 1KB9E 2YIUC 3H1IE 4P1CH 2NVGA 3FOUA 1O7HA 5KKZC 4HM3A 2XRXA 3GOBA 1O7PA 3L74E 4PV1D 2YFIA 4AAYB 1NDOA 4NBBD 1Q90C 2E4PA 2Q3WA 1O7MA 4NB8D 4U3FE 1NU1E 4H44D 1SJGA 3H1HE 2QJPC 4HM7A 4EMJB 2JO6A 1L0NE 2XSOA 1BE3E 3GTEA 1PP9E 2ZYLA 3TGUE 1ZRTE 2HMMA 2DE6D 3AZCA 4QUPA 4P1BH 2NVEA 1L0LE 4QDDA 3H1JE 4QCKA 3VMID 1G8JB 3CX5E 4QDCA 2QPZA 2CKFA 1UUVA 3L71E 2DE5D 2YFLA 4NBCD 4PD4E 2HMLA 3D89A 2HMNA 1O7GA 3L75E 4NBHD 3EN1A 3VCPA 1RIEA 2FYUE 4HM2A 2NUKA 3GTSA 3VCAA 2BMQA 3GZXA 3CXHE 2GBWA 4QURA 5AEUA 4NBFD 1O7WA 2HMJA 2BMRA 3VMHD 5HL4A 2DE7D 2QJKC 5AEWA 1VCKA 3GCEA 4HKVA 2B1XA 1ULIA 3EQQA 3L72E 1ULJA 1P84E 4NB9D 1SQPE 2E75D 1G8KB 5KLVE 4OGQD 3GKEA 3BCCE 2QJYC 3GL2A 1RFSA 3L70E 3CWBE 4NBED 1SQXE 4HJLA 2ZT9D 4NBGD 4QDFB 5BOKA 2HMKA 1VF5D 1VM9A 4H0LD 3C0DA 4HM6A 1SQQE 4QDFA 3VMGD 1SQVE 2NVFA 1NYKA 4NBAD 1SQBE 4HM5A 2BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM E;  2IBZ E;  2NUM A;  3GB4 A;  1KYO E;  1WQL A;  2A06 E;  1EG9 A;  5CXM A;  2E4Q A;  2FYN C;  2GBX A;  2HMO A;  4NBD D;  2E74 D;  4H13 D;  1NTZ E;  4AIV A;  2E76 D;  3DQY A;  3N0Q A;  3H1K E;  1UUW A;  3H1L E;  3L73 E;  1O7N A;  2XR8 A;  2JZA A;  4QUQ A;  2NWF A;  1NTK E;  2I7F A;  4HM0 A;  4HM1 A;  3GL0 A;  2YFJ A;  1PPJ E;  2BMO A;  2B24 A;  1EZV E;  1JM1 A;  2D2C D;  1FQT A;  2XSH A;  4HM4 A;  2YVJ B;  4HM8 A;  5KLI C;  3GZY A;  1BCC E;  1KB9 E;  2YIU C;  3H1I E;  4P1C H;  2NVG A;  3FOU A;  1O7H A;  5KKZ C;  4HM3 A;  2XRX A;  3GOB A;  1O7P A;  3L74 E;  4PV1 D;  2YFI A;  4AAY B;  1NDO A;  4NBB D;  1Q90 C;  2E4P A;  2Q3W A;  1O7M A;  4NB8 D;  4U3F E;  1NU1 E;  4H44 D;  1SJG A;  3H1H E;  2QJP C;  4HM7 A;  4EMJ B;  2JO6 A;  1L0N E;  2XSO A;  1BE3 E;  3GTE A;  1PP9 E;  2ZYL A;  3TGU E;  1ZRT E;  2HMM A;  2DE6 D;  3AZC A;  4QUP A;  4P1B H;  2NVE A;  1L0L E;  4QDD A;  3H1J E;  4QCK A;  3VMI D;  1G8J B;  3CX5 E;  4QDC A;  2QPZ A;  2CKF A;  1UUV A;  3L71 E;  2DE5 D;  2YFL A;  4NBC D;  4PD4 E;  2HML A;  3D89 A;  2HMN A;  1O7G A;  3L75 E;  4NBH D;  3EN1 A;  3VCP A;  1RIE A;  2FYU E;  4HM2 A;  2NUK A;  3GTS A;  3VCA A;  2BMQ A;  3GZX A;  3CXH E;  2GBW A;  4QUR A;  5AEU A;  4NBF D;  1O7W A;  2HMJ A;  2BMR A;  3VMH D;  5HL4 A;  2DE7 D;  2QJK C;  5AEW A;  1VCK A;  3GCE A;  4HKV A;  2B1X A;  1ULI A;  3EQQ A;  3L72 E;  1ULJ A;  1P84 E;  4NB9 D;  1SQP E;  2E75 D;  1G8K B;  5KLV E;  4OGQ D;  3GKE A;  3BCC E;  2QJY C;  3GL2 A;  1RFS A;  3L70 E;  3CWB E;  4NBE D;  1SQX E;  4HJL A;  2ZT9 D;  4NBG D;  4QDF B;  5BOK A;  2HMK A;  1VF5 D;  1VM9 A;  4H0L D;  3C0D A;  4HM6 A;  1SQQ E;  4QDF A;  3VMG D;  1SQV E;  2NVF A;  1NYK A;  4NBA D;  1SQB E;  4HM5 A;  2BCC E; 
#chains in the Genus database with same CATH topology
 1NTM E;  2IBZ E;  2NUM A;  3GB4 A;  1KYO E;  1WQL A;  2A06 E;  1EG9 A;  5CXM A;  2E4Q A;  2FYN C;  2GBX A;  2HMO A;  4NBD D;  2E74 D;  4H13 D;  1NTZ E;  4AIV A;  2E76 D;  3DQY A;  3N0Q A;  3H1K E;  1UUW A;  3H1L E;  3L73 E;  1O7N A;  2XR8 A;  2JZA A;  4QUQ A;  2NWF A;  1NTK E;  2I7F A;  4HM0 A;  4HM1 A;  3GL0 A;  2YFJ A;  1PPJ E;  2BMO A;  2B24 A;  1EZV E;  1JM1 A;  2D2C D;  1FQT A;  2XSH A;  4HM4 A;  2YVJ B;  4HM8 A;  5KLI C;  3GZY A;  1BCC E;  1KB9 E;  2YIU C;  3H1I E;  4P1C H;  2NVG A;  3FOU A;  1O7H A;  5KKZ C;  4HM3 A;  2XRX A;  3GOB A;  1O7P A;  3L74 E;  4PV1 D;  2YFI A;  4AAY B;  1NDO A;  4NBB D;  1Q90 C;  2E4P A;  2Q3W A;  1O7M A;  4NB8 D;  4U3F E;  1NU1 E;  4H44 D;  1SJG A;  3H1H E;  2QJP C;  4HM7 A;  4EMJ B;  2JO6 A;  1L0N E;  2XSO A;  1BE3 E;  3GTE A;  1PP9 E;  2ZYL A;  3TGU E;  1ZRT E;  2HMM A;  2DE6 D;  3AZC A;  4QUP A;  4P1B H;  2NVE A;  1L0L E;  4QDD A;  3H1J E;  4QCK A;  3VMI D;  1G8J B;  3CX5 E;  4QDC A;  2QPZ A;  2CKF A;  1UUV A;  3L71 E;  2DE5 D;  2YFL A;  4NBC D;  4PD4 E;  2HML A;  3D89 A;  2HMN A;  1O7G A;  3L75 E;  4NBH D;  3EN1 A;  3VCP A;  1RIE A;  2FYU E;  4HM2 A;  2NUK A;  3GTS A;  3VCA A;  2BMQ A;  3GZX A;  3CXH E;  2GBW A;  4QUR A;  5AEU A;  4NBF D;  1O7W A;  2HMJ A;  2BMR A;  3VMH D;  5HL4 A;  2DE7 D;  2QJK C;  5AEW A;  1VCK A;  3GCE A;  4HKV A;  2B1X A;  1ULI A;  3EQQ A;  3L72 E;  1ULJ A;  1P84 E;  4NB9 D;  1SQP E;  2E75 D;  1G8K B;  5KLV E;  4OGQ D;  3GKE A;  3BCC E;  2QJY C;  3GL2 A;  1RFS A;  3L70 E;  3CWB E;  4NBE D;  1SQX E;  4HJL A;  2ZT9 D;  4NBG D;  4QDF B;  5BOK A;  2HMK A;  1VF5 D;  1VM9 A;  4H0L D;  3C0D A;  4HM6 A;  1SQQ E;  4QDF A;  3VMG D;  1SQV E;  2NVF A;  1NYK A;  4NBA D;  1SQB E;  4HM5 A;  2BCC E; 
#chains in the Genus database with same CATH homology
 1NTM E;  2IBZ E;  2NUM A;  3GB4 A;  1KYO E;  1WQL A;  2A06 E;  1EG9 A;  5CXM A;  2E4Q A;  2FYN C;  2GBX A;  2HMO A;  4NBD D;  2E74 D;  4H13 D;  1NTZ E;  4AIV A;  2E76 D;  3DQY A;  3N0Q A;  3H1K E;  1UUW A;  3H1L E;  3L73 E;  1O7N A;  2XR8 A;  2JZA A;  4QUQ A;  2NWF A;  1NTK E;  2I7F A;  4HM0 A;  4HM1 A;  3GL0 A;  2YFJ A;  1PPJ E;  2BMO A;  2B24 A;  1EZV E;  1JM1 A;  2D2C D;  1FQT A;  2XSH A;  4HM4 A;  2YVJ B;  4HM8 A;  5KLI C;  3GZY A;  1BCC E;  1KB9 E;  2YIU C;  3H1I E;  4P1C H;  2NVG A;  3FOU A;  1O7H A;  5KKZ C;  4HM3 A;  2XRX A;  3GOB A;  1O7P A;  3L74 E;  4PV1 D;  2YFI A;  4AAY B;  1NDO A;  4NBB D;  1Q90 C;  2E4P A;  2Q3W A;  1O7M A;  4NB8 D;  4U3F E;  1NU1 E;  4H44 D;  1SJG A;  3H1H E;  2QJP C;  4HM7 A;  4EMJ B;  2JO6 A;  1L0N E;  2XSO A;  1BE3 E;  3GTE A;  1PP9 E;  2ZYL A;  3TGU E;  1ZRT E;  2HMM A;  2DE6 D;  3AZC A;  4QUP A;  4P1B H;  2NVE A;  1L0L E;  4QDD A;  3H1J E;  4QCK A;  3VMI D;  1G8J B;  3CX5 E;  4QDC A;  2QPZ A;  2CKF A;  1UUV A;  3L71 E;  2DE5 D;  2YFL A;  4NBC D;  4PD4 E;  2HML A;  3D89 A;  2HMN A;  1O7G A;  3L75 E;  4NBH D;  3EN1 A;  3VCP A;  1RIE A;  2FYU E;  4HM2 A;  2NUK A;  3GTS A;  3VCA A;  2BMQ A;  3GZX A;  3CXH E;  2GBW A;  4QUR A;  5AEU A;  4NBF D;  1O7W A;  2HMJ A;  2BMR A;  3VMH D;  5HL4 A;  2DE7 D;  2QJK C;  5AEW A;  1VCK A;  3GCE A;  4HKV A;  2B1X A;  1ULI A;  3EQQ A;  3L72 E;  1ULJ A;  1P84 E;  4NB9 D;  1SQP E;  2E75 D;  1G8K B;  5KLV E;  4OGQ D;  3GKE A;  3BCC E;  2QJY C;  3GL2 A;  1RFS A;  3L70 E;  3CWB E;  4NBE D;  1SQX E;  4HJL A;  2ZT9 D;  4NBG D;  4QDF B;  5BOK A;  2HMK A;  1VF5 D;  1VM9 A;  4H0L D;  3C0D A;  4HM6 A;  1SQQ E;  4QDF A;  3VMG D;  1SQV E;  2NVF A;  1NYK A;  4NBA D;  1SQB E;  4HM5 A;  2BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...