1BCCE

Cytochrome bc1 complex from chicken
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 44
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1bccE02
4QDFB 4NB9D 5BOKA 1RFSA 2BMOA 3TGUE 2YFJA 2D2CD 2E4QA 4HM6A 3CWBE 4AIVA 2DE7D 3VMGD 4EMJB 1NU1E 1L0LE 4D6TE 1NTKE 3GZXA 3H1KE 1Q90C 4QDFA 1VF5D 1EG9A 2YFLA 3GTEA 3VMID 4HM5A 2FYNC 2YIUC 5CXMA 2XRXA 3DQYA 3H1HE 3GOBA 4HM4A 5KLVE 3GKEA 4OGQD 4AAYB 3D89A 4QDDA 2E76D 3FOUA 2A06E 4HM7A 2BMRA 5AEUA 4P1CH 1O7HA 4QUPA 1PP9E 1P84E 1NDOA 1BE3E 1O7PA 2DE6D 4H0LD 1NTME 1BCCE 3GL2A 2JO6A 3H1IE 1NYKA 1SJGA 1SQQE 3GB4A 1L0NE 4QCKA 4HJLA 1O7MA 1G8KB 1ULIA 1O7NA 4HM2A 2HMJA 1UUVA 4H44D 2BMQA 3L74E 1ULJA 2BCCE 4NBGD 2JZAA 3L75E 3VMHD 1UUWA 2ZT9D 2E4PA 1SQVE 2E74D 3H1LE 3AZCA 2HMMA 3L73E 4PV1D 3VCAA 2FYUE 2GBWA 2GBXA 4NBCD 1SQXE 1SQBE 3CXHE 2QJYC 1KYOE 3BCCE 2NVEA 2XR8A 4QDCA 3N0QA 2HMLA 2HMOA 2YFIA 4HM8A 4NBAD 4QUQA 3CX5E 3VCPA 2XSHA 2DE5D 3GL0A 1G8JB 1PPJE 1BGYE 4HM0A 4NBDD 2NWFA 2QJPC 1EZVE 2QJKC 5HL4A 3L70E 1O7GA 4NBFD 2HMKA 4H13D 1ZRTE 2NVFA 1RIEA 5KLIC 3H1JE 2E75D 4PD4E 3GCEA 3C0DA 1O7WA 4HKVA 4HM1A 2IBZE 3GZYA 2NVGA 2I7FA 1SQPE 1NTZE 1WQLA 4NBHD 2XSOA 4U3FE 2NUMA 4NBED 5AEWA 4P1BH 2YVJB 2NUKA 3EN1A 2B1XA 4HM3A 1VM9A 4NB8D 2HMNA 1FQTA 3L71E 1VCKA 4NBBD 2Q3WA 3L72E 3EQQA 2B24A 1KB9E 3GTSA 2QPZA 5KKZC 4QURA 1JM1A 2ZYLA 2CKFA
chains in the Genus database with same CATH superfamily
4NB9D 4PV1B 3HTKA 1IO4A 2ZYDA 1YITP 3R4YA 2IDBA 3Q1MA 2OYIA 2E43A 2E75C 3M9BA 3QH9A 2KOGA 1NAYA 2FYNC 3BCCJ 3PTZA 1IK7A 3H1IJ 2IFNA 1GL2D 2P7JA 3WMM0 1SFCB 3OW2O 3Q5SA 3CXHD 3CX5H 3GL2A 1SQVJ 4IOIH 1NTMG 2VRSA 2KNCA 1O7MA 1SQXJ 1O7NA 3MP7B 3Q2YA 2JEEA 2N9YB 1SQBK 3RK3E 2BCCG 1S4XA 2HMMA 2FYUD 3OAKA 5KJ7A 1HTLC 3L35A 4Y28J 2WTYA 4HM8A 2R5DA 3TGUJ 2HMLA 2HMOA 1WT6A 4NPFX 2DE5D 1NTZJ 1G8JB 3HE4B 1HWTC 3ZDMA 1CI6A 1MZ9A 2WSFJ 3FWLA 3H1JE 5KLVJ 4NBHD 1FE6A 4N78E 4NBED 2WSFH 1OIPA 3V6IA 3PRJA 1LTAC 3USSA 3BASA 4D6TD 1NTKD 1FJPA 2WMMA 4H44B 1JM1A 2M5AB 1KC8Q 2CKFA 1M7LA 3VMAA 2D2CD 1DH3A 3V2QA 3D70A 1HBWA 2DE7D 2OYHA 1UIIA 1L0LE 2N1TB 3MHVA 1JUNA 3CWBG 2HFED 1NU1G 2QSIA 3RL0D 3GF3A 1U7JA 4GODA 4HH2A 5BVZA 1KFMA 5AW7B 1VQOP 1PP9E 1O7PA 2XU6A 1JY3P 3EFGA 1JCDA 3BCCG 3H1IG 1SFCA 2YKOA 3RBZA 1RF0A 2R44A 3FX0A 2E4PA 2HODB 3L73E 2L91A 1SQVG 2I1KA 1SQQK 1SQBE 3VMZA 1QL2A 1SQXG 1AQTA 2J59M 1S1CX 1NYHA 2QJKC 2YKQA 2FFDB 2XNXA 4M3LA 2FBWC 3PH0A 1Q90D 3HE4A 1FZAA 3TGUG 1NTZG 2KUBA 1W2BO 2WVRA 1S5LX 1ZR2A 1KMIZ 1J1EB 3Q5PA 1EDJA 1H0TA 5KLVG 2JWDA 3B4SA 1JMBA 1BE3D 3PLNA 5GTHE 1OW7A 1T3UA 1MKMA 2O3JA 2GM4A 3VYIA 1URQD 2P10A 1EG9A 3I5CA 3Q5RA 3CI9A 3TNUB 1QVGO 1KTMA 2YIUB 4R4LA 1YTZT 2OARA 1ZOYC 3H1JJ 1FZFA 1L0NK 1KYOD 2JO6A 3SWFA 2KSJA 4W7ZA 4ZNCA 2QJYB 1IFNA 1PGOA 1S9KD 1GL2B 1T6AA 3L74E 1NOHA 3A0BE 4Y99C 3HRNA 1R5SA 2WQYC 3V2NA 3VCAA 1KN7A 4JPZB 2B89A 2CK3H 5AW4B 2XSHA 2HODA 4Z1MH 2WPVB 3KYQA 2E76B 3HD7D 4JBZA 2Z4EA 4PD4D 2B88A 4YXDC 5APXA 1Y8AA 5AVZB 3GZYA 2XSOA 2FFDA 2N9BA 5B66H 4CPGA 3M0DC 1M1JB 4GIFA 2WPRA 2PGDA 1EC5A 1T2KD 4YPCA 5AW2B 3FXEA 2QPZA 3MUDC 2Y9ZA 4QDFB 3HUSB 3UIAA 2BMOA 3GHGA 2E4QA 3VMGD 2KS1A 2HG5D 2B9BA 4RO0A 1KILC 3RBXA 1T3JA 3U59A 1SQBJ 4U7JA 5CBNA 1LP1A 1MFZA 3E1RA 2PP6A 4I1LA 3WUTA 1GMJA 2HR3A 5BU8B 1DIPA 2D2CB 3GMAA 1LT9C 1N7SD 1RE4C 4H0LD 4IL6X 1IK9A 1LTJB 1IFJA 1G1JA 1RF1A 1L0NE 2B87B 4B86A 1G8KB 2HMJA 2YO3A 1OW6A 1FDMA 4NBGD 4UB6E 1RHZB 1PIXA 1FZCC 3H1JG 1SQPD 4DOJA 2FYUE 3VP8A 1GL2A 3RK2B 2NVEA 1ZN5A 3GL0A 4TLFA 1PPJE 3AE9C 2E75D 3RL0g 1MUUA 2I7FA 1FBMA 1AVYA 1J1DB 2M3BA 1K04A 2LXCB 1QVFO 1AFOA 3H1KD 2NRGA 1ZP0C 3CCRP 4NBBD 3L72E 1K9MQ 1VQMP 1NWQA 4EOTA 2H8PD 1M1JA 1KZUB 2XKMA 2P1JA 1M57D 3L74J 3WU2H 1A02J 1S5LE 3VTPC 1QGKB 3CMEP 4L73A 3AE1C 2R3SA 5KAIE 1IJDB 4QDFA 3VMID 3HUSA 3A0BH 4WY4C 5KAFH 2XRXA 1BDCA 5EFWB 1GU5A 3I56P 1SQQJ 4HM7A 1LWUC 1H89A 1MV8A 3JCUE 4PJ0E 1KV4A 2W8ZA 1VQNP 3L37A 3PP5A 3KHUA 1URQB 1VQ7P 3H1LJ 2Q1KA 1S3JA 1SQBG 3CLQA 2GUSA 1LTSC 4ASWA 3GLMA 4HJGH 1ULJA 1VDFA 2Q7CA 1BGYJ 2DW3A 3I55P 1GZLA 4U3FD 3B5NC 1EQ7A 4OGQC 2G8YA 2Q3EA 3G4SP 2KZIA 1LTIC 1DD3A 1PZQA 1IFDA 2NPSC 2QJPC 1UIXA 1ZW0A 5AVSB 1QX8A 4HM1A 1CI6B 4YXWH 4I2LC 2AEJA 5AEWA 1KILA 4WVZA 4C46A 1KB9H 3SSUA 1VQ4P 3L71E 3EQQA 4PV1C 1LT9A 2IFMA 2QEXP 1L0NJ 1G2CA 1RFSA 3C9IA 1VQ5P 4EMJB 1N73C 2C0WA 3WUVA 1LJ2A 2AEMA 3NFQA 2RKLA 1BCCJ 4UB6H 3DQYA 2W83C 3L74G 4XE5B 1N8RQ 3R2PA 2W27A 4A7PA 1L0LK 2A06G 4C7RA 1NTMD 3L75J 4PD4I 3CCUP 1OX3A 3H32B 2C0XA 4HJLA 1KFNA 4IL6E 2CPSA 1SQQG 2BCCD 1URQA 1IFIA 4R4MA 4H0LB 3QWOC 4I6MC 2OQQA 5KLIB 3H1LG 2Q3IA 4NBCD 4QDCA 1FZBA 3P7KA 2H89C 1BGYG 3CMAP 1YHQP 4DJGA 4PD4E 4UB8H 1S5LH 1HGVA 1JNMA 1FOSE 3E1IA 5H2FE 1EXIA 1E5WA 4H44C 5KAIH 1USDA 4YTPC 3EN1A 1OW8A 4AYCA 3P8CD 1TU3F 4QURA 1JEKA 3JCUH 2ZYLA 2Y0EA 5B5EH 2FYNB 1JY3O 1P84D 3HD7A 3IN6A 4LGDE 1BCCD 5DJTB 3CWBD 2AXTE 2QVAA 1AV1A 1NU1D 1ZXGA 1M8OB 1H0TB 3B71A 2LXBA 3NMDA 1NAFA 4BWNA 2RN0A 1L0NG 3H1HE 4HM4A 3L75D 3D89A 1LTGC 1YIJP 1O7HA 1ZV8A 1YJWP 4HB1A 2YNYA 3BCCD 2IYPA 4AQRD 1HJBA 3H1ID 1NYKA 2NPSA 2K9YA 3CX5D 1NO4A 2XDJA 1BCCG 2FY8A 4IFFA 1M90Q 1FJKA 3F89A 3PHLA 1UUVA 1PPJG 2O01J 3L71J 4XA4A 5E79H 1NKNA 1SQVD 2HPCB 5CCHC 3SWKA 3H32A 3L75G 4EI2A 1X0TA 2YXQB 2JJLA 3M0AA 1S2EA 2HLOA 1SQXD 2O01H 3V4WA 1VF5B 1N7SA 1T8ZA 2WPQA 3KDPB 1JCCA 3L70E 4JF7A 1JY2P 1SS1A 1GK4A 1Z56A 1KILD 3ITKA 3TGUD 1NTZD 1N73A 5APWA 4I7ZC 3KPEA 5GTIE 5KLVD 1WMKA 2E74B 5APUA 1VQ8P 3TK1A 1ZMEC 5KKZB 3CC7P 1W2EA 2POHA 3SWYA 2KP8A 3GZXA 2OTJP 3A2AA 2YFLA 2I1JA 2YIUC 3GHGB 2KK7A 3FGAD 3V4QA 1RQUA 2KS1B 1EDLA 4AAYB 2GA1A 2P2UA 2BMRA 1EZVI 1FDIA 2Y9YA 4W80A 1XTGB 1KORA 1LP1B 2JWAA 1JTHB 3BATA 2IBZI 1JOCA 3CCVP 1OWAA 4L74A 3L36A 1R5LA 3CCQP 2W90A 5AVRB 1PGQA 1RF1B 2GBXA 3LIEA 2XR8A 2E76C 4N3YB 2HPCA 3V5BA 5CHXA 1OVVA 2WSSH 2KI7B 1EZVE 3S1KA 1O7GA 3P32A 4NBFD 1HF9A 5APVA 1SVFA 2FYUK 4JYBA 3AEEC 2IBZE 3RGUA 2AXTH 4WY4D 2ZJSE 5CCGC 2NUKA 2ZT9C 3AE2C 2RH0A 3GTSA 1NGMB 1L0LJ 1NHLA 4EYYQ 1PL5A 1NTKK 2QM8A 1PP9J 2LR2A 2M8RA 4KT0J 1KQFB 4O9BA 3CXHI 1RQVA 3B5ND 1IFPA 3KQGA 4OGQD 5AEUA 1U7MA 3L70J 1LTJC 5AVTB 1K8AQ 1RE3C 1DEBA 2NPSD 1EXJA 1NTME 3AEFC 2Y0CA 3A7OA 4NPEA 3TYYA 3AE3C 3L73J 4GOEA 4L76A 4RJTA 1GK6A 3H6PA 4HM2A 1FOSF 4JQ0D 5M1BA 2BCCE 3H1JD 1JTHA 3RK2C 1FC2C 3AE6C 4C7NA 1QEXA 3AZCA 4PV1D 5AVWB 1WRGA 4N78D 1KD1Q 2GBWA 1X79B 3CXHE 3AEBC 4NBAD 3RL0B 2WZ7A 3U1AA 4NBDD 2RMZA 1R8EA 3CC2P 3NXSA 1J1DC 3GCEA 3C0DA 1JM0A 1VQ6P 1VPCA 2JO1A 1USEA 1YTZI 1BSHA 1HUCA 1FQTA 2W6AA 3E7KA 3P8CE 4W7YA 2ZXXA 1GW3A 1KILB 5GTHH 2QE7H 4IFMA 2XV5A 1M56D 2M0BA 5TJHA 4H13C 3CWBE 1LT9B 1DD4A 1NU1E 2OYIC 2E5TA 3NTNA 4GT1A 4WBAA 4D6TE 1G2CB 1NTKE 4WB4A 1L0LG 3VOPA 2GUVA 1L4AC 5AW3B 4HYTB 1JY3N 3N7NA 1X22A 4DCKA 2ZVNB 2W6BA 1PP9G 1SQBD 2K37A 3JC22 2K88A 1FZCB 3H1IE 3KXDA 3HE5A 3S9OA 4H44D 1EDIA 3W68A 4QMAA 2JZAA 2LKMA 1SQVE 3CCSP 2KLVA 1SQXE 3L73G 2ZAEB 5KJ7C 1VQKP 2QM7A 2Z5IA 5HL4A 1EDKA 5AW1B 5CJ0A 2WWWA 1KILE 3BVHA 2FXPA 2NVGA 1K05A 1NTZE 2JR8A 3M0DA 2NUMA 4GDOA 1VQLP 3OA7A 2YVJB 1PFIA 3V2PA 3IAOA 1YJ9P 3RK3C 5AW8B 1VCKA 3CCMP 3IR9A 4LC1A 1HH0A 3MUDA 2M3EA 1KQSO 1Q82Q 2E5YA 2H88C 4WY4B 1GU4A 1L2PA 3VMXA 1SP4A 1YYCA 1LWUB 4OH8B 2KXPB 2OYHC 3OJAB 5CCHD 1U57A 1YQ4C 2C9LY 3HD7B 1KYOI 2R3CA 3L74D 2Q9IA 1AJYA 4MN4C 4QDDA 3AECC 2A06D 1RE4A 4NPDA 1BE3E 3CXHH 2KLUA 2JP3A 2SPZA 1RH5B 1VQPP 4XFJA 4K3AA 3A3YB 3SFDC 2YMKA 2FYUJ 1SQQD 3GB4A 4OGQB 1ULIA 2UWJE 3VMYA 1IZNB 4L75A 1SFCC 1FZCA 3VMHD 1RF0C 2NPSB 2QJPB 2J5UA 3H1LD 3T97B 3K5BA 1KYOE 2PRRA 2YFIA 2OYOA 3ABVC 1BGYD 2NWFA 5AW0B 3G3ZA 1S9KE 4D6TJ 1NTKJ 1ZRTD 1SQPK 2ZXEB 4ZKUA 1N7SB 5APSA 1FZEA 3MZWB 3L72J 4HKVA 1HVVA 4ZMDA 3G6EP 2PFXA 4NB8D 3CCLP 1HJ0A 2YKPA 1KB9D 1L4AA 1N73B 1YQ3C 1QL1A 1AVOA 1H8AA 2WITA 3W67A 1CSBA 4HM6A 1N7LA 2YXRB 5BU5A 4ASVA 1SLQA 2K1AA 4WY4A 1L0ND 1NVOA 2C9NY 2K9JB 2E75B 1LWUA 4LLHA 4PJ0H 2E76D 3C1LA 4P1CH 2N1TC 3LIDA 1IC2A 1YI2P 3PJSK 4DT0A 1LNQA 1GD2E 1PPJD 2WSEJ 1JY2O 2BASA 3FXDA 5CCGD 3AEAC 2ZYAA 2ZT9D 3IFMA 1VF5C 2Y0DA 3B5NA 2WSEH 2R32A 2R5BA 3AEGC 1LGHB 2P58A 2XZRA 2FYUG 1DEEG 2K3RA 3VCPA 3L72D 3T97A 2HMKA 1RY3A 1BDDA 2WT7A 1YJNP 1FU1A 1NKZB 1SQPE 3GG2A 3CPWO 2FFDC 1BE3J 5B66E 1OMIA 3SFEC 3EWKA 2E74C 3G71P 3MIWA 4D6TG 1NTKG 5APQA 4OVNF 5KKZC 1NH4A 3L72G 2QIWA 3S4RA 1FZGA 5BOKA 2YFJA 5AVUB 1FDOA 1ZR4A 3EQ2A 3GHGC 3VN0A 2ZVOB 3RK2D 1J1EC 2G3AA 3H1KE 1Q2NA 3GTEA 1Q7YQ 3M91A 2A45I 3GOBA 3GKEA 3FOUA 4QUPA 1KYOH 2IZ0A 2DE6D 2K9JA 2OTKE 2L5GB 4IL6H 2QRXA 1GDTA 1DX7A 1RF1C 2MJZA 2PAJA 1D7MA 2JDIH 1NTMK 5DJUB 4DZOA 2WSCJ 1PGPA 2QJYC 1S72P 3D71A 1ZLLA 4N6JA 1GL2C 4QUQA 5CBOA 3L71D 4C7NB 2V4HA 2WSCH 5AW6B 1LTBC 2CPBA 4H13D 4PD4H 4I7ZB 3AE4C 5H2FH 2QJKB 5AVVB 1WQLA 4U3FE 3D6YA 2M5AA 4EDFA 1L4AD 3MGNA 1H88A 1GTWA 2ITAA 3L71G 2N1TA 2O1KA 3C8VA 1OVRA 2BEQD 1M1JC 5KTBA 3H1HJ 1N2DC 1BE3G 1E79H 3WU2E 3M06A 2FKWB 3A5TA 2V7QJ 5CXMA 3HUSC 4RESB 3G9RA 5KAFE 5KJ7D 2A06E 2V7QH 1NU1K 3Q3DA 3CC4P 4K35A 1SQPJ 1SQQE 4QCKA 4BXLA 2D2CC 3FWNA 2AEFA 3IF4A 2QG4A 2BMQA 3N4XA 2AXCA 5CCHA 2ZFCA 3HE5B 1KB9I 3RK3D 3H1LE 1YBKA 3L4FA 2MKVA 4GOFA 3RL0C 4EIJA 1VQ9P 4Y99B 1Q81Q 3F5HA 3GW6A 5CMZA 5L8RJ 2O1JA 3M9QA 1BGYE 1SQVK 2ZT9B 1ZRTE 3H1KJ 1RIEA 3VP9A 1CW5A 5AVQB 4BRYB 5AW5B 4AUWA 1JB0J 1SQXK 3TDKA 1FS0E 3M9HA 1HGZA 3P8MC 1P84I 2IYOA 4HM3A 2NZ2A 3AEDC 5GTIH 1KB9E 3H1HD 1X8YA 2KZJA 1NTZK 1IFMA 2XNDH 1NJIQ 2Q6QA 4AIVA 3TNUA 1SFCD 1L0LD 1JMMA 1Q90C 5KLVK 3II6A 4HM5A 1X9VA 4KHXA 1N86A 3BRTB 5K5GB 1GW4A 3AE5C 3CX5I 3JSVC 2FYZA 1LT1A 3H1HG 1BSNA 3KZIE 1KQGB 1MFTA 3A0HE 5TISE 1PP9D 1P84E 3AE8C 2BEZF 2A45H 2IPPA 1Q86Q 1G1IA 1BCCE 3LW5J 1AQ5A 1Y47A 3U1CA 4U3FJ 3L70D 2FXOA 3O6QB 3LW5H 3L75E 3GF7A 1URQC 2P67A 3MD0A 4OWFA 3L73D 2W6JH 1AA0A 1SQPG 2KYVA 3BCCE 3N0QA 1J2JB 4JYCA 2KSEA 3CX5E 4HM0A 1JY2N 3CCJP 2IZ1A 1XTCC 1PV3A 3L70G 2I8DA 4UB8E 4HKZH 4RKUJ 5CCGA 3BRVB 2H7HA 5APYA 1QLED 2HYNA 3B8EB 4BRYA 2O01N 1VM9A 3HTKB 3MTUE 4H13B 2N1TD 2Q3WA 3H1KG 2B24A 2OYIB 3O8ZA 5AVXB 2IX7C 1VL2A 3D6ZA 5AW9B 1OZHA 1LTTC 2YO2A 5B5EE 3TGUE 1OVUA 1JO5A 3TF5A 1L4AB 4GKGA 3HD7C 3CCEP 1KQLA 1VF5D 2Q5UA 1NTMJ 4IFDK 2YMYA 4TT3H 5KLVE 1LTJA 5AVYB 1RE3A 3CD6P 2KNCB 2B87A 1NDOA 1T2KC 2BCCJ 2KB7P 2FXMA 2WPSA 2JKVA 3EFFK 2OGUA 1SJGA 3AE7C 2A45G 1EZVD 2J58A 1M1KQ 5C39A 1UUWA 1Y9BA 2E74D 1CZQA 2IBZD 5E79E 5CJ4A 2Z5HA 2OTLP 3O6QA 4U3FG 5APTA 3B5NB 2H43A 1N7SC 4H0LC 1W5CE 2NVFA 1OXZA 3RK3B 1EZVG 5KLIC 1OFCX 1O7WA 3TSIA 1FAVA 2QA4P 2E42A 2KIKA 2IBZG 4P1BH 3H25A 4KJMA 1A02F 3CL3D 2WT7B 2B1XA 4ZKPA 2HMNA 4WWIA 1PGJA 3CWBJ 3V2RA 1K73Q 1NU1J 3KZIH 2OYHB 3A0HH 5TISH 1P84H 3WUUA 2ZYGA
chains in the Genus database with same CATH topology
4QDFB 4NB9D 5BOKA 1RFSA 2BMOA 3TGUE 2YFJA 2D2CD 2E4QA 4HM6A 3CWBE 4AIVA 2DE7D 3VMGD 4EMJB 1NU1E 1L0LE 4D6TE 1NTKE 3GZXA 3H1KE 1Q90C 4QDFA 1VF5D 1EG9A 2YFLA 3GTEA 3VMID 4HM5A 2FYNC 2YIUC 5CXMA 2XRXA 3DQYA 3H1HE 3GOBA 4HM4A 5KLVE 3GKEA 4OGQD 4AAYB 3D89A 4QDDA 2E76D 3FOUA 2A06E 4HM7A 2BMRA 5AEUA 4P1CH 1O7HA 4QUPA 1PP9E 1P84E 1NDOA 1BE3E 1O7PA 2DE6D 4H0LD 1NTME 1BCCE 3GL2A 2JO6A 3H1IE 1NYKA 1SJGA 1SQQE 3GB4A 1L0NE 4QCKA 4HJLA 1O7MA 1G8KB 1ULIA 1O7NA 4HM2A 2HMJA 1UUVA 4H44D 2BMQA 3L74E 1ULJA 2BCCE 4NBGD 2JZAA 3L75E 3VMHD 1UUWA 2ZT9D 2E4PA 1SQVE 2E74D 3H1LE 3AZCA 2HMMA 3L73E 4PV1D 3VCAA 2FYUE 2GBWA 2GBXA 4NBCD 1SQXE 1SQBE 3CXHE 2QJYC 1KYOE 3BCCE 2NVEA 2XR8A 4QDCA 3N0QA 2HMLA 2HMOA 2YFIA 4HM8A 4NBAD 4QUQA 3CX5E 3VCPA 2XSHA 2DE5D 3GL0A 1G8JB 1PPJE 1BGYE 4HM0A 4NBDD 2NWFA 2QJPC 1EZVE 2QJKC 5HL4A 3L70E 1O7GA 4NBFD 2HMKA 4H13D 1ZRTE 2NVFA 1RIEA 5KLIC 3H1JE 2E75D 4PD4E 3GCEA 3C0DA 1O7WA 4HKVA 4HM1A 2IBZE 3GZYA 2NVGA 2I7FA 1SQPE 1NTZE 1WQLA 4NBHD 2XSOA 4U3FE 2NUMA 4NBED 5AEWA 4P1BH 2YVJB 2NUKA 3EN1A 2B1XA 4HM3A 1VM9A 4NB8D 2HMNA 1FQTA 3L71E 1VCKA 4NBBD 2Q3WA 3L72E 3EQQA 2B24A 1KB9E 3GTSA 2QPZA 5KKZC 4QURA 1JM1A 2ZYLA 2CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QDF B;  4NB9 D;  5BOK A;  1RFS A;  2BMO A;  3TGU E;  2YFJ A;  2D2C D;  2E4Q A;  4HM6 A;  3CWB E;  4AIV A;  2DE7 D;  3VMG D;  4EMJ B;  1NU1 E;  1L0L E;  4D6T E;  1NTK E;  3GZX A;  3H1K E;  1Q90 C;  4QDF A;  1VF5 D;  1EG9 A;  2YFL A;  3GTE A;  3VMI D;  4HM5 A;  2FYN C;  2YIU C;  5CXM A;  2XRX A;  3DQY A;  3H1H E;  3GOB A;  4HM4 A;  5KLV E;  3GKE A;  4OGQ D;  4AAY B;  3D89 A;  4QDD A;  2E76 D;  3FOU A;  2A06 E;  4HM7 A;  2BMR A;  5AEU A;  4P1C H;  1O7H A;  4QUP A;  1PP9 E;  1P84 E;  1NDO A;  1BE3 E;  1O7P A;  2DE6 D;  4H0L D;  1NTM E;  1BCC E;  3GL2 A;  2JO6 A;  3H1I E;  1NYK A;  1SJG A;  1SQQ E;  3GB4 A;  1L0N E;  4QCK A;  4HJL A;  1O7M A;  1G8K B;  1ULI A;  1O7N A;  4HM2 A;  2HMJ A;  1UUV A;  4H44 D;  2BMQ A;  3L74 E;  1ULJ A;  2BCC E;  4NBG D;  2JZA A;  3L75 E;  3VMH D;  1UUW A;  2ZT9 D;  2E4P A;  1SQV E;  2E74 D;  3H1L E;  3AZC A;  2HMM A;  3L73 E;  4PV1 D;  3VCA A;  2FYU E;  2GBW A;  2GBX A;  4NBC D;  1SQX E;  1SQB E;  3CXH E;  2QJY C;  1KYO E;  3BCC E;  2NVE A;  2XR8 A;  4QDC A;  3N0Q A;  2HML A;  2HMO A;  2YFI A;  4HM8 A;  4NBA D;  4QUQ A;  3CX5 E;  3VCP A;  2XSH A;  2DE5 D;  3GL0 A;  1G8J B;  1PPJ E;  1BGY E;  4HM0 A;  4NBD D;  2NWF A;  2QJP C;  1EZV E;  2QJK C;  5HL4 A;  3L70 E;  1O7G A;  4NBF D;  2HMK A;  4H13 D;  1ZRT E;  2NVF A;  1RIE A;  5KLI C;  3H1J E;  2E75 D;  4PD4 E;  3GCE A;  3C0D A;  1O7W A;  4HKV A;  4HM1 A;  2IBZ E;  3GZY A;  2NVG A;  2I7F A;  1SQP E;  1NTZ E;  1WQL A;  4NBH D;  2XSO A;  4U3F E;  2NUM A;  4NBE D;  5AEW A;  4P1B H;  2YVJ B;  2NUK A;  3EN1 A;  2B1X A;  4HM3 A;  1VM9 A;  4NB8 D;  2HMN A;  1FQT A;  3L71 E;  1VCK A;  4NBB D;  2Q3W A;  3L72 E;  3EQQ A;  2B24 A;  1KB9 E;  3GTS A;  2QPZ A;  5KKZ C;  4QUR A;  1JM1 A;  2ZYL A;  2CKF A; 
#chains in the Genus database with same CATH topology
 4NB9 D;  4PV1 B;  3HTK A;  1IO4 A;  2ZYD A;  1YIT P;  3R4Y A;  2IDB A;  3Q1M A;  2OYI A;  2E43 A;  2E75 C;  3M9B A;  3QH9 A;  2KOG A;  1NAY A;  2FYN C;  3BCC J;  3PTZ A;  1IK7 A;  3H1I J;  2IFN A;  1GL2 D;  2P7J A;  3WMM 0;  1SFC B;  3OW2 O;  3Q5S A;  3CXH D;  3CX5 H;  3GL2 A;  1SQV J;  4IOI H;  1NTM G;  2VRS A;  2KNC A;  1O7M A;  1SQX J;  1O7N A;  3MP7 B;  3Q2Y A;  2JEE A;  2N9Y B;  1SQB K;  3RK3 E;  2BCC G;  1S4X A;  2HMM A;  2FYU D;  3OAK A;  5KJ7 A;  1HTL C;  3L35 A;  4Y28 J;  2WTY A;  4HM8 A;  2R5D A;  3TGU J;  2HML A;  2HMO A;  1WT6 A;  4NPF X;  2DE5 D;  1NTZ J;  1G8J B;  3HE4 B;  1HWT C;  3ZDM A;  1CI6 A;  1MZ9 A;  2WSF J;  3FWL A;  3H1J E;  5KLV J;  4NBH D;  1FE6 A;  4N78 E;  4NBE D;  2WSF H;  1OIP A;  3V6I A;  3PRJ A;  1LTA C;  3USS A;  3BAS A;  4D6T D;  1NTK D;  1FJP A;  2WMM A;  4H44 B;  1JM1 A;  2M5A B;  1KC8 Q;  2CKF A;  1M7L A;  3VMA A;  2D2C D;  1DH3 A;  3V2Q A;  3D70 A;  1HBW A;  2DE7 D;  2OYH A;  1UII A;  1L0L E;  2N1T B;  3MHV A;  1JUN A;  3CWB G;  2HFE D;  1NU1 G;  2QSI A;  3RL0 D;  3GF3 A;  1U7J A;  4GOD A;  4HH2 A;  5BVZ A;  1KFM A;  5AW7 B;  1VQO P;  1PP9 E;  1O7P A;  2XU6 A;  1JY3 P;  3EFG A;  1JCD A;  3BCC G;  3H1I G;  1SFC A;  2YKO A;  3RBZ A;  1RF0 A;  2R44 A;  3FX0 A;  2E4P A;  2HOD B;  3L73 E;  2L91 A;  1SQV G;  2I1K A;  1SQQ K;  1SQB E;  3VMZ A;  1QL2 A;  1SQX G;  1AQT A;  2J59 M;  1S1C X;  1NYH A;  2QJK C;  2YKQ A;  2FFD B;  2XNX A;  4M3L A;  2FBW C;  3PH0 A;  1Q90 D;  3HE4 A;  1FZA A;  3TGU G;  1NTZ G;  2KUB A;  1W2B O;  2WVR A;  1S5L X;  1ZR2 A;  1KMI Z;  1J1E B;  3Q5P A;  1EDJ A;  1H0T A;  5KLV G;  2JWD A;  3B4S A;  1JMB A;  1BE3 D;  3PLN A;  5GTH E;  1OW7 A;  1T3U A;  1MKM A;  2O3J A;  2GM4 A;  3VYI A;  1URQ D;  2P10 A;  1EG9 A;  3I5C A;  3Q5R A;  3CI9 A;  3TNU B;  1QVG O;  1KTM A;  2YIU B;  4R4L A;  1YTZ T;  2OAR A;  1ZOY C;  3H1J J;  1FZF A;  1L0N K;  1KYO D;  2JO6 A;  3SWF A;  2KSJ A;  4W7Z A;  4ZNC A;  2QJY B;  1IFN A;  1PGO A;  1S9K D;  1GL2 B;  1T6A A;  3L74 E;  1NOH A;  3A0B E;  4Y99 C;  3HRN A;  1R5S A;  2WQY C;  3V2N A;  3VCA A;  1KN7 A;  4JPZ B;  2B89 A;  2CK3 H;  5AW4 B;  2XSH A;  2HOD A;  4Z1M H;  2WPV B;  3KYQ A;  2E76 B;  3HD7 D;  4JBZ A;  2Z4E A;  4PD4 D;  2B88 A;  4YXD C;  5APX A;  1Y8A A;  5AVZ B;  3GZY A;  2XSO A;  2FFD A;  2N9B A;  5B66 H;  4CPG A;  3M0D C;  1M1J B;  4GIF A;  2WPR A;  2PGD A;  1EC5 A;  1T2K D;  4YPC A;  5AW2 B;  3FXE A;  2QPZ A;  3MUD C;  2Y9Z A;  4QDF B;  3HUS B;  3UIA A;  2BMO A;  3GHG A;  2E4Q A;  3VMG D;  2KS1 A;  2HG5 D;  2B9B A;  4RO0 A;  1KIL C;  3RBX A;  1T3J A;  3U59 A;  1SQB J;  4U7J A;  5CBN A;  1LP1 A;  1MFZ A;  3E1R A;  2PP6 A;  4I1L A;  3WUT A;  1GMJ A;  2HR3 A;  5BU8 B;  1DIP A;  2D2C B;  3GMA A;  1LT9 C;  1N7S D;  1RE4 C;  4H0L D;  4IL6 X;  1IK9 A;  1LTJ B;  1IFJ A;  1G1J A;  1RF1 A;  1L0N E;  2B87 B;  4B86 A;  1G8K B;  2HMJ A;  2YO3 A;  1OW6 A;  1FDM A;  4NBG D;  4UB6 E;  1RHZ B;  1PIX A;  1FZC C;  3H1J G;  1SQP D;  4DOJ A;  2FYU E;  3VP8 A;  1GL2 A;  3RK2 B;  2NVE A;  1ZN5 A;  3GL0 A;  4TLF A;  1PPJ E;  3AE9 C;  2E75 D;  3RL0 g;  1MUU A;  2I7F A;  1FBM A;  1AVY A;  1J1D B;  2M3B A;  1K04 A;  2LXC B;  1QVF O;  1AFO A;  3H1K D;  2NRG A;  1ZP0 C;  3CCR P;  4NBB D;  3L72 E;  1K9M Q;  1VQM P;  1NWQ A;  4EOT A;  2H8P D;  1M1J A;  1KZU B;  2XKM A;  2P1J A;  1M57 D;  3L74 J;  3WU2 H;  1A02 J;  1S5L E;  3VTP C;  1QGK B;  3CME P;  4L73 A;  3AE1 C;  2R3S A;  5KAI E;  1IJD B;  4QDF A;  3VMI D;  3HUS A;  3A0B H;  4WY4 C;  5KAF H;  2XRX A;  1BDC A;  5EFW B;  1GU5 A;  3I56 P;  1SQQ J;  4HM7 A;  1LWU C;  1H89 A;  1MV8 A;  3JCU E;  4PJ0 E;  1KV4 A;  2W8Z A;  1VQN P;  3L37 A;  3PP5 A;  3KHU A;  1URQ B;  1VQ7 P;  3H1L J;  2Q1K A;  1S3J A;  1SQB G;  3CLQ A;  2GUS A;  1LTS C;  4ASW A;  3GLM A;  4HJG H;  1ULJ A;  1VDF A;  2Q7C A;  1BGY J;  2DW3 A;  3I55 P;  1GZL A;  4U3F D;  3B5N C;  1EQ7 A;  4OGQ C;  2G8Y A;  2Q3E A;  3G4S P;  2KZI A;  1LTI C;  1DD3 A;  1PZQ A;  1IFD A;  2NPS C;  2QJP C;  1UIX A;  1ZW0 A;  5AVS B;  1QX8 A;  4HM1 A;  1CI6 B;  4YXW H;  4I2L C;  2AEJ A;  5AEW A;  1KIL A;  4WVZ A;  4C46 A;  1KB9 H;  3SSU A;  1VQ4 P;  3L71 E;  3EQQ A;  4PV1 C;  1LT9 A;  2IFM A;  2QEX P;  1L0N J;  1G2C A;  1RFS A;  3C9I A;  1VQ5 P;  4EMJ B;  1N73 C;  2C0W A;  3WUV A;  1LJ2 A;  2AEM A;  3NFQ A;  2RKL A;  1BCC J;  4UB6 H;  3DQY A;  2W83 C;  3L74 G;  4XE5 B;  1N8R Q;  3R2P A;  2W27 A;  4A7P A;  1L0L K;  2A06 G;  4C7R A;  1NTM D;  3L75 J;  4PD4 I;  3CCU P;  1OX3 A;  3H32 B;  2C0X A;  4HJL A;  1KFN A;  4IL6 E;  2CPS A;  1SQQ G;  2BCC D;  1URQ A;  1IFI A;  4R4M A;  4H0L B;  3QWO C;  4I6M C;  2OQQ A;  5KLI B;  3H1L G;  2Q3I A;  4NBC D;  4QDC A;  1FZB A;  3P7K A;  2H89 C;  1BGY G;  3CMA P;  1YHQ P;  4DJG A;  4PD4 E;  4UB8 H;  1S5L H;  1HGV A;  1JNM A;  1FOS E;  3E1I A;  5H2F E;  1EXI A;  1E5W A;  4H44 C;  5KAI H;  1USD A;  4YTP C;  3EN1 A;  1OW8 A;  4AYC A;  3P8C D;  1TU3 F;  4QUR A;  1JEK A;  3JCU H;  2ZYL A;  2Y0E A;  5B5E H;  2FYN B;  1JY3 O;  1P84 D;  3HD7 A;  3IN6 A;  4LGD E;  1BCC D;  5DJT B;  3CWB D;  2AXT E;  2QVA A;  1AV1 A;  1NU1 D;  1ZXG A;  1M8O B;  1H0T B;  3B71 A;  2LXB A;  3NMD A;  1NAF A;  4BWN A;  2RN0 A;  1L0N G;  3H1H E;  4HM4 A;  3L75 D;  3D89 A;  1LTG C;  1YIJ P;  1O7H A;  1ZV8 A;  1YJW P;  4HB1 A;  2YNY A;  3BCC D;  2IYP A;  4AQR D;  1HJB A;  3H1I D;  1NYK A;  2NPS A;  2K9Y A;  3CX5 D;  1NO4 A;  2XDJ A;  1BCC G;  2FY8 A;  4IFF A;  1M90 Q;  1FJK A;  3F89 A;  3PHL A;  1UUV A;  1PPJ G;  2O01 J;  3L71 J;  4XA4 A;  5E79 H;  1NKN A;  1SQV D;  2HPC B;  5CCH C;  3SWK A;  3H32 A;  3L75 G;  4EI2 A;  1X0T A;  2YXQ B;  2JJL A;  3M0A A;  1S2E A;  2HLO A;  1SQX D;  2O01 H;  3V4W A;  1VF5 B;  1N7S A;  1T8Z A;  2WPQ A;  3KDP B;  1JCC A;  3L70 E;  4JF7 A;  1JY2 P;  1SS1 A;  1GK4 A;  1Z56 A;  1KIL D;  3ITK A;  3TGU D;  1NTZ D;  1N73 A;  5APW A;  4I7Z C;  3KPE A;  5GTI E;  5KLV D;  1WMK A;  2E74 B;  5APU A;  1VQ8 P;  3TK1 A;  1ZME C;  5KKZ B;  3CC7 P;  1W2E A;  2POH A;  3SWY A;  2KP8 A;  3GZX A;  2OTJ P;  3A2A A;  2YFL A;  2I1J A;  2YIU C;  3GHG B;  2KK7 A;  3FGA D;  3V4Q A;  1RQU A;  2KS1 B;  1EDL A;  4AAY B;  2GA1 A;  2P2U A;  2BMR A;  1EZV I;  1FDI A;  2Y9Y A;  4W80 A;  1XTG B;  1KOR A;  1LP1 B;  2JWA A;  1JTH B;  3BAT A;  2IBZ I;  1JOC A;  3CCV P;  1OWA A;  4L74 A;  3L36 A;  1R5L A;  3CCQ P;  2W90 A;  5AVR B;  1PGQ A;  1RF1 B;  2GBX A;  3LIE A;  2XR8 A;  2E76 C;  4N3Y B;  2HPC A;  3V5B A;  5CHX A;  1OVV A;  2WSS H;  2KI7 B;  1EZV E;  3S1K A;  1O7G A;  3P32 A;  4NBF D;  1HF9 A;  5APV A;  1SVF A;  2FYU K;  4JYB A;  3AEE C;  2IBZ E;  3RGU A;  2AXT H;  4WY4 D;  2ZJS E;  5CCG C;  2NUK A;  2ZT9 C;  3AE2 C;  2RH0 A;  3GTS A;  1NGM B;  1L0L J;  1NHL A;  4EYY Q;  1PL5 A;  1NTK K;  2QM8 A;  1PP9 J;  2LR2 A;  2M8R A;  4KT0 J;  1KQF B;  4O9B A;  3CXH I;  1RQV A;  3B5N D;  1IFP A;  3KQG A;  4OGQ D;  5AEU A;  1U7M A;  3L70 J;  1LTJ C;  5AVT B;  1K8A Q;  1RE3 C;  1DEB A;  2NPS D;  1EXJ A;  1NTM E;  3AEF C;  2Y0C A;  3A7O A;  4NPE A;  3TYY A;  3AE3 C;  3L73 J;  4GOE A;  4L76 A;  4RJT A;  1GK6 A;  3H6P A;  4HM2 A;  1FOS F;  4JQ0 D;  5M1B A;  2BCC E;  3H1J D;  1JTH A;  3RK2 C;  1FC2 C;  3AE6 C;  4C7N A;  1QEX A;  3AZC A;  4PV1 D;  5AVW B;  1WRG A;  4N78 D;  1KD1 Q;  2GBW A;  1X79 B;  3CXH E;  3AEB C;  4NBA D;  3RL0 B;  2WZ7 A;  3U1A A;  4NBD D;  2RMZ A;  1R8E A;  3CC2 P;  3NXS A;  1J1D C;  3GCE A;  3C0D A;  1JM0 A;  1VQ6 P;  1VPC A;  2JO1 A;  1USE A;  1YTZ I;  1BSH A;  1HUC A;  1FQT A;  2W6A A;  3E7K A;  3P8C E;  4W7Y A;  2ZXX A;  1GW3 A;  1KIL B;  5GTH H;  2QE7 H;  4IFM A;  2XV5 A;  1M56 D;  2M0B A;  5TJH A;  4H13 C;  3CWB E;  1LT9 B;  1DD4 A;  1NU1 E;  2OYI C;  2E5T A;  3NTN A;  4GT1 A;  4WBA A;  4D6T E;  1G2C B;  1NTK E;  4WB4 A;  1L0L G;  3VOP A;  2GUV A;  1L4A C;  5AW3 B;  4HYT B;  1JY3 N;  3N7N A;  1X22 A;  4DCK A;  2ZVN B;  2W6B A;  1PP9 G;  1SQB D;  2K37 A;  3JC2 2;  2K88 A;  1FZC B;  3H1I E;  3KXD A;  3HE5 A;  3S9O A;  4H44 D;  1EDI A;  3W68 A;  4QMA A;  2JZA A;  2LKM A;  1SQV E;  3CCS P;  2KLV A;  1SQX E;  3L73 G;  2ZAE B;  5KJ7 C;  1VQK P;  2QM7 A;  2Z5I A;  5HL4 A;  1EDK A;  5AW1 B;  5CJ0 A;  2WWW A;  1KIL E;  3BVH A;  2FXP A;  2NVG A;  1K05 A;  1NTZ E;  2JR8 A;  3M0D A;  2NUM A;  4GDO A;  1VQL P;  3OA7 A;  2YVJ B;  1PFI A;  3V2P A;  3IAO A;  1YJ9 P;  3RK3 C;  5AW8 B;  1VCK A;  3CCM P;  3IR9 A;  4LC1 A;  1HH0 A;  3MUD A;  2M3E A;  1KQS O;  1Q82 Q;  2E5Y A;  2H88 C;  4WY4 B;  1GU4 A;  1L2P A;  3VMX A;  1SP4 A;  1YYC A;  1LWU B;  4OH8 B;  2KXP B;  2OYH C;  3OJA B;  5CCH D;  1U57 A;  1YQ4 C;  2C9L Y;  3HD7 B;  1KYO I;  2R3C A;  3L74 D;  2Q9I A;  1AJY A;  4MN4 C;  4QDD A;  3AEC C;  2A06 D;  1RE4 A;  4NPD A;  1BE3 E;  3CXH H;  2KLU A;  2JP3 A;  2SPZ A;  1RH5 B;  1VQP P;  4XFJ A;  4K3A A;  3A3Y B;  3SFD C;  2YMK A;  2FYU J;  1SQQ D;  3GB4 A;  4OGQ B;  1ULI A;  2UWJ E;  3VMY A;  1IZN B;  4L75 A;  1SFC C;  1FZC A;  3VMH D;  1RF0 C;  2NPS B;  2QJP B;  2J5U A;  3H1L D;  3T97 B;  3K5B A;  1KYO E;  2PRR A;  2YFI A;  2OYO A;  3ABV C;  1BGY D;  2NWF A;  5AW0 B;  3G3Z A;  1S9K E;  4D6T J;  1NTK J;  1ZRT D;  1SQP K;  2ZXE B;  4ZKU A;  1N7S B;  5APS A;  1FZE A;  3MZW B;  3L72 J;  4HKV A;  1HVV A;  4ZMD A;  3G6E P;  2PFX A;  4NB8 D;  3CCL P;  1HJ0 A;  2YKP A;  1KB9 D;  1L4A A;  1N73 B;  1YQ3 C;  1QL1 A;  1AVO A;  1H8A A;  2WIT A;  3W67 A;  1CSB A;  4HM6 A;  1N7L A;  2YXR B;  5BU5 A;  4ASV A;  1SLQ A;  2K1A A;  4WY4 A;  1L0N D;  1NVO A;  2C9N Y;  2K9J B;  2E75 B;  1LWU A;  4LLH A;  4PJ0 H;  2E76 D;  3C1L A;  4P1C H;  2N1T C;  3LID A;  1IC2 A;  1YI2 P;  3PJS K;  4DT0 A;  1LNQ A;  1GD2 E;  1PPJ D;  2WSE J;  1JY2 O;  2BAS A;  3FXD A;  5CCG D;  3AEA C;  2ZYA A;  2ZT9 D;  3IFM A;  1VF5 C;  2Y0D A;  3B5N A;  2WSE H;  2R32 A;  2R5B A;  3AEG C;  1LGH B;  2P58 A;  2XZR A;  2FYU G;  1DEE G;  2K3R A;  3VCP A;  3L72 D;  3T97 A;  2HMK A;  1RY3 A;  1BDD A;  2WT7 A;  1YJN P;  1FU1 A;  1NKZ B;  1SQP E;  3GG2 A;  3CPW O;  2FFD C;  1BE3 J;  5B66 E;  1OMI A;  3SFE C;  3EWK A;  2E74 C;  3G71 P;  3MIW A;  4D6T G;  1NTK G;  5APQ A;  4OVN F;  5KKZ C;  1NH4 A;  3L72 G;  2QIW A;  3S4R A;  1FZG A;  5BOK A;  2YFJ A;  5AVU B;  1FDO A;  1ZR4 A;  3EQ2 A;  3GHG C;  3VN0 A;  2ZVO B;  3RK2 D;  1J1E C;  2G3A A;  3H1K E;  1Q2N A;  3GTE A;  1Q7Y Q;  3M91 A;  2A45 I;  3GOB A;  3GKE A;  3FOU A;  4QUP A;  1KYO H;  2IZ0 A;  2DE6 D;  2K9J A;  2OTK E;  2L5G B;  4IL6 H;  2QRX A;  1GDT A;  1DX7 A;  1RF1 C;  2MJZ A;  2PAJ A;  1D7M A;  2JDI H;  1NTM K;  5DJU B;  4DZO A;  2WSC J;  1PGP A;  2QJY C;  1S72 P;  3D71 A;  1ZLL A;  4N6J A;  1GL2 C;  4QUQ A;  5CBO A;  3L71 D;  4C7N B;  2V4H A;  2WSC H;  5AW6 B;  1LTB C;  2CPB A;  4H13 D;  4PD4 H;  4I7Z B;  3AE4 C;  5H2F H;  2QJK B;  5AVV B;  1WQL A;  4U3F E;  3D6Y A;  2M5A A;  4EDF A;  1L4A D;  3MGN A;  1H88 A;  1GTW A;  2ITA A;  3L71 G;  2N1T A;  2O1K A;  3C8V A;  1OVR A;  2BEQ D;  1M1J C;  5KTB A;  3H1H J;  1N2D C;  1BE3 G;  1E79 H;  3WU2 E;  3M06 A;  2FKW B;  3A5T A;  2V7Q J;  5CXM A;  3HUS C;  4RES B;  3G9R A;  5KAF E;  5KJ7 D;  2A06 E;  2V7Q H;  1NU1 K;  3Q3D A;  3CC4 P;  4K35 A;  1SQP J;  1SQQ E;  4QCK A;  4BXL A;  2D2C C;  3FWN A;  2AEF A;  3IF4 A;  2QG4 A;  2BMQ A;  3N4X A;  2AXC A;  5CCH A;  2ZFC A;  3HE5 B;  1KB9 I;  3RK3 D;  3H1L E;  1YBK A;  3L4F A;  2MKV A;  4GOF A;  3RL0 C;  4EIJ A;  1VQ9 P;  4Y99 B;  1Q81 Q;  3F5H A;  3GW6 A;  5CMZ A;  5L8R J;  2O1J A;  3M9Q A;  1BGY E;  1SQV K;  2ZT9 B;  1ZRT E;  3H1K J;  1RIE A;  3VP9 A;  1CW5 A;  5AVQ B;  4BRY B;  5AW5 B;  4AUW A;  1JB0 J;  1SQX K;  3TDK A;  1FS0 E;  3M9H A;  1HGZ A;  3P8M C;  1P84 I;  2IYO A;  4HM3 A;  2NZ2 A;  3AED C;  5GTI H;  1KB9 E;  3H1H D;  1X8Y A;  2KZJ A;  1NTZ K;  1IFM A;  2XND H;  1NJI Q;  2Q6Q A;  4AIV A;  3TNU A;  1SFC D;  1L0L D;  1JMM A;  1Q90 C;  5KLV K;  3II6 A;  4HM5 A;  1X9V A;  4KHX A;  1N86 A;  3BRT B;  5K5G B;  1GW4 A;  3AE5 C;  3CX5 I;  3JSV C;  2FYZ A;  1LT1 A;  3H1H G;  1BSN A;  3KZI E;  1KQG B;  1MFT A;  3A0H E;  5TIS E;  1PP9 D;  1P84 E;  3AE8 C;  2BEZ F;  2A45 H;  2IPP A;  1Q86 Q;  1G1I A;  1BCC E;  3LW5 J;  1AQ5 A;  1Y47 A;  3U1C A;  4U3F J;  3L70 D;  2FXO A;  3O6Q B;  3LW5 H;  3L75 E;  3GF7 A;  1URQ C;  2P67 A;  3MD0 A;  4OWF A;  3L73 D;  2W6J H;  1AA0 A;  1SQP G;  2KYV A;  3BCC E;  3N0Q A;  1J2J B;  4JYC A;  2KSE A;  3CX5 E;  4HM0 A;  1JY2 N;  3CCJ P;  2IZ1 A;  1XTC C;  1PV3 A;  3L70 G;  2I8D A;  4UB8 E;  4HKZ H;  4RKU J;  5CCG A;  3BRV B;  2H7H A;  5APY A;  1QLE D;  2HYN A;  3B8E B;  4BRY A;  2O01 N;  1VM9 A;  3HTK B;  3MTU E;  4H13 B;  2N1T D;  2Q3W A;  3H1K G;  2B24 A;  2OYI B;  3O8Z A;  5AVX B;  2IX7 C;  1VL2 A;  3D6Z A;  5AW9 B;  1OZH A;  1LTT C;  2YO2 A;  5B5E E;  3TGU E;  1OVU A;  1JO5 A;  3TF5 A;  1L4A B;  4GKG A;  3HD7 C;  3CCE P;  1KQL A;  1VF5 D;  2Q5U A;  1NTM J;  4IFD K;  2YMY A;  4TT3 H;  5KLV E;  1LTJ A;  5AVY B;  1RE3 A;  3CD6 P;  2KNC B;  2B87 A;  1NDO A;  1T2K C;  2BCC J;  2KB7 P;  2FXM A;  2WPS A;  2JKV A;  3EFF K;  2OGU A;  1SJG A;  3AE7 C;  2A45 G;  1EZV D;  2J58 A;  1M1K Q;  5C39 A;  1UUW A;  1Y9B A;  2E74 D;  1CZQ A;  2IBZ D;  5E79 E;  5CJ4 A;  2Z5H A;  2OTL P;  3O6Q A;  4U3F G;  5APT A;  3B5N B;  2H43 A;  1N7S C;  4H0L C;  1W5C E;  2NVF A;  1OXZ A;  3RK3 B;  1EZV G;  5KLI C;  1OFC X;  1O7W A;  3TSI A;  1FAV A;  2QA4 P;  2E42 A;  2KIK A;  2IBZ G;  4P1B H;  3H25 A;  4KJM A;  1A02 F;  3CL3 D;  2WT7 B;  2B1X A;  4ZKP A;  2HMN A;  4WWI A;  1PGJ A;  3CWB J;  3V2R A;  1K73 Q;  1NU1 J;  3KZI H;  2OYH B;  3A0H H;  5TIS H;  1P84 H;  3WUU A;  2ZYG A; 
#chains in the Genus database with same CATH homology
 4QDF B;  4NB9 D;  5BOK A;  1RFS A;  2BMO A;  3TGU E;  2YFJ A;  2D2C D;  2E4Q A;  4HM6 A;  3CWB E;  4AIV A;  2DE7 D;  3VMG D;  4EMJ B;  1NU1 E;  1L0L E;  4D6T E;  1NTK E;  3GZX A;  3H1K E;  1Q90 C;  4QDF A;  1VF5 D;  1EG9 A;  2YFL A;  3GTE A;  3VMI D;  4HM5 A;  2FYN C;  2YIU C;  5CXM A;  2XRX A;  3DQY A;  3H1H E;  3GOB A;  4HM4 A;  5KLV E;  3GKE A;  4OGQ D;  4AAY B;  3D89 A;  4QDD A;  2E76 D;  3FOU A;  2A06 E;  4HM7 A;  2BMR A;  5AEU A;  4P1C H;  1O7H A;  4QUP A;  1PP9 E;  1P84 E;  1NDO A;  1BE3 E;  1O7P A;  2DE6 D;  4H0L D;  1NTM E;  1BCC E;  3GL2 A;  2JO6 A;  3H1I E;  1NYK A;  1SJG A;  1SQQ E;  3GB4 A;  1L0N E;  4QCK A;  4HJL A;  1O7M A;  1G8K B;  1ULI A;  1O7N A;  4HM2 A;  2HMJ A;  1UUV A;  4H44 D;  2BMQ A;  3L74 E;  1ULJ A;  2BCC E;  4NBG D;  2JZA A;  3L75 E;  3VMH D;  1UUW A;  2ZT9 D;  2E4P A;  1SQV E;  2E74 D;  3H1L E;  3AZC A;  2HMM A;  3L73 E;  4PV1 D;  3VCA A;  2FYU E;  2GBW A;  2GBX A;  4NBC D;  1SQX E;  1SQB E;  3CXH E;  2QJY C;  1KYO E;  3BCC E;  2NVE A;  2XR8 A;  4QDC A;  3N0Q A;  2HML A;  2HMO A;  2YFI A;  4HM8 A;  4NBA D;  4QUQ A;  3CX5 E;  3VCP A;  2XSH A;  2DE5 D;  3GL0 A;  1G8J B;  1PPJ E;  1BGY E;  4HM0 A;  4NBD D;  2NWF A;  2QJP C;  1EZV E;  2QJK C;  5HL4 A;  3L70 E;  1O7G A;  4NBF D;  2HMK A;  4H13 D;  1ZRT E;  2NVF A;  1RIE A;  5KLI C;  3H1J E;  2E75 D;  4PD4 E;  3GCE A;  3C0D A;  1O7W A;  4HKV A;  4HM1 A;  2IBZ E;  3GZY A;  2NVG A;  2I7F A;  1SQP E;  1NTZ E;  1WQL A;  4NBH D;  2XSO A;  4U3F E;  2NUM A;  4NBE D;  5AEW A;  4P1B H;  2YVJ B;  2NUK A;  3EN1 A;  2B1X A;  4HM3 A;  1VM9 A;  4NB8 D;  2HMN A;  1FQT A;  3L71 E;  1VCK A;  4NBB D;  2Q3W A;  3L72 E;  3EQQ A;  2B24 A;  1KB9 E;  3GTS A;  2QPZ A;  5KKZ C;  4QUR A;  1JM1 A;  2ZYL A;  2CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...