1BCCE

Cytochrome bc1 complex from chicken
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 44
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1bccE02
2E75D 1O7NA 3GZXA 2BMQA 2QPZA 1L0NE 4HM4A 1NTZE 3H1HE 1O7HA 2B1XA 2HMKA 2B24A 4HM0A 1VF5D 2NVFA 4NBFD 2FYNC 1PP9E 3L74E 4U3FE 2HMLA 1KYOE 2YFLA 1L0LE 1UUVA 1NTKE 2NWFA 4QUPA 4HM1A 2YVJB 1P84E 3H1KE 4HJLA 2BMRA 2D2CD 2GBWA 3D89A 3N0QA 3VMGD 4HM3A 3AZCA 4HM2A 1ULIA 1SJGA 3H1IE 1G8JB 1Q90C 3FOUA 1SQXE 1G8KB 2E4QA 1O7PA 5KLIC 5AEUA 2E76D 1FQTA 5BOKA 1WQLA 2JO6A 2XSHA 2QJKC 4NB9D 1PPJE 4QDDA 5AEWA 3L72E 4QDFA 3EN1A 4H13D 5CXMA 3VCAA 4PV1D 1SQVE 3GKEA 4OGQD 3L71E 2E4PA 2NVEA 2QJPC 4AAYB 4EMJB 4HM5A 1JM1A 4HM7A 1NDOA 1VCKA 2XR8A 2XRXA 4P1BH 2IBZE 2DE7D 5KKZC 2CKFA 3GTSA 2NUMA 1NU1E 2FYUE 3L73E 2YFJA 3DQYA 2HMJA 3GCEA 2YIUC 4NBED 2I7FA 1NTME 2YFIA 3VMHD 4H44D 1NYKA 2GBXA 4NBDD 4QCKA 2JZAA 3C0DA 1KB9E 2BCCE 3CXHE 4QDFB 1BGYE 3CWBE 3GZYA 4NBBD 4P1CH 2ZYLA 1BCCE 2DE5D 2Q3WA 2QJYC 4HM6A 2HMMA 2NUKA 4NBCD 3GOBA 3VMID 5KLVE 2HMOA 4QURA 2BMOA 3H1JE 5HL4A 1EZVE 1O7WA 1VM9A 2A06E 1SQPE 1BE3E 2DE6D 2NVGA 3GTEA 4QDCA 2E74D 4AIVA 3BCCE 1RFSA 1ZRTE 4HM8A 3H1LE 1UUWA 3L70E 2HMNA 4PD4E 3TGUE 2XSOA 2ZT9D 4HKVA 1SQBE 3EQQA 3GB4A 4NBAD 4NB8D 1SQQE 3VCPA 1O7GA 1RIEA 3GL2A 4H0LD 4QUQA 4NBHD 3GL0A 1EG9A 1ULJA 4NBGD 3CX5E 4D6TE 1O7MA 3L75E
chains in the Genus database with same CATH superfamily
1JY3P 2YMKA 2KB7P 2BEZF 3H6PA 1VQPP 4NBFD 1BDCA 1N7SD 4GKGA 2H8PD 3E1RA 1JY3O 2C9NY 1Q81Q 1OVUA 1M57D 3BCCJ 2OYIB 3VOPA 1IK9A 1KZUB 1R8EA 1G8KB 2P1JA 5KAFE 1YJNP 1HGVA 1ZR4A 5KAFH 1FDIA 2JJLA 2QRXA 1DEEG 1Z56A 2KNCB 2NRGA 1KN7A 1N7LA 1SFCA 2OTKE 2ZVNB 2WSFH 2RN0A 1FZCA 2JEEA 2B89A 3N7NA 1YTZT 2L91A 1A02J 2DE7D 2BCCJ 2P2UA 1KFMA 2FYUE 3GCEA 3HTKA 3V2QA 1IK7A 5KAIH 1KB9E 3CXHE 3W67A 5AVXB 1ZW0A 2DE5D 2FFDA 2YO2A 3KPEA 3AE3C 3JC22 3E1IA 1IFMA 1O7WA 1YQ4C 2LXBA 1BE3E 2B87A 3FX0A 3RK3B 1OMIA 2HG5D 1H0TB 1E5WA 3CPWO 1OXZA 4PD4D 3HE5B 3IR9A 1VF5B 2FXMA 1PFIA 2HMNA 1HJBA 3B5NA 1M1JC 2E5TA 1CI6A 3MZWB 4K3AA 3SWFA 4NBHD 1LTAC 1PV3A 1ULJA 3NTNA 3TDKA 3JCUE 5KLVD 5TJHA 5APSA 1VQ9P 4IOIH 1PGOA 4JBZA 5E79E 1VQLP 2IFMA 5GTIH 3HUSA 3NFQA 2FXOA 2E5YA 1Q7YQ 1QGKB 2C9LY 2KZIA 1X79B 1NTKD 2PAJA 3D89A 1OIPA 1FZBA 1BSNA 1KYOI 1L4AA 1LP1A 5C39A 3H1ID 2Q1KA 5AW5B 2W8ZA 1VQ8P 4L76A 2KUBA 3P7KA 2W6AA 1PP9G 4PD4H 4BRYB 4OGQD 3V4WA 1VQOP 1JTHB 1NWQA 1NU1J 1OZHA 3GHGB 1ZOYC 1SQVJ 3LW5J 3WUUA 2CKFA 5BU8B 5CCGA 2H43A 2OQQA 3VMXA 4EOTA 5KTBA 5CJ0A 2D2CB 3M9QA 1BGYE 4NBBD 2GUSA 3CXHD 5CCHA 1YI2P 4H13C 1N73B 2WSCJ 1LTIC 2FYUJ 2VRSA 4QDCA 4GIFA 2WQYC 5B5EE 3OAKA 1RH5B 1JMMA 1BCCD 3EQQA 1L0LJ 4NB8D 3JSVC 1DX7A 2XV5A 2Q7CA 3RBZA 4NBGD 2G3AA 4D6TE 2W83C 4TT3H 2K1AA 4I2LC 1KQSO 2QEXP 2QPZA 3AE4C 1IFDA 2B1XA 1FAVA 4YXWH 1IZNB 2IZ0A 1NVOA 1QX8A 1EXIA 4BRYA 4LLHA 2D2CD 2Q3EA 4HM3A 5TISH 3A5TA 5M1BA 5AVVB 4D6TJ 3FXEA 3WUTA 1ZMEC 3H1KG 3AE5C 3M06A 5KLVK 2QJKC 3EFGA 5APWA 1H89A 2N9BA 2NPSA 1SQVD 2K37A 1S5LX 1NTKJ 3QH9A 1U7JA 2OYOA 2FY8A 1BGYJ 1OW8A 4IL6X 3H32A 2QIWA 4OH8B 3AEEC 3CC2P 3RGUA 1L2PA 4DCKA 2LXCB 3F89A 4HM6A 1JMBA 3L37A 4RESB 1RHZB 3MHVA 4CPGA 1J1DB 1LTTC 2W27A 4HKVA 4NBAD 1PZQA 1EZVG 1RIEA 5APTA 3PTZA 3L71J 2NZ2A 1JY2N 1NTZD 1L0NE 1LT9B 3TYYA 1NHLA 1VF5D 3A0BE 2NVFA 3H1HJ 2ZT9B 1KYOE 5H2FH 1L0LE 1CSBA 4ZKUA 3HD7A 4QUPA 1OVVA 1K9MQ 1MZ9A 2JDIH 4AUWA 5KAIE 1BE3J 4I7ZC 3BASA 3D6ZA 2IBZD 1SQQJ 2PFXA 3AECC 3GHGC 3SSUA 1SQXD 2JWDA 2OYIA 4QDDA 3H1KD 3F5HA 3L74G 3MUDC 3R2PA 1AVYA 3MD0A 4C46A 2K88A 3L4FA 4HM5A 1K04A 2O3JA 2V7QJ 4C7NA 1N86A 2QE7H 3A0BH 4JYCA 1GL2C 1QEXA 3H1KJ 3GG2A 2FFDB 3C1LA 3HRNA 1URQB 1IFJA 1SQVK 1RQUA 4WVZA 3V2RA 3VTPC 1KD1Q 3FGAD 2WSCH 3CI9A 3MUDA 3USSA 4JF7A 4AQRD 4B86A 1SP4A 3CX5I 3Q2YA 1HH0A 3RL0D 2KNCA 3L71G 3O6QB 2AXTE 3FXDA 1FOSE 4UB6H 2HYNA 3T97A 2M5AB 2N1TD 2N1TC 1EXJA 1O7MA 3OJAB 2R3CA 2IBZI 3ABVC 2KOGA 1MFZA 1DH3A 1ZLLA 1VL2A 2WT7A 2YNYA 2K3RA 3V5BA 1HTLC 2N1TA 2OYHB 1NU1K 2Y0DA 1Q90C 1KFNA 1SQXE 1URQC 2H7HA 5AEUA 1JY2O 1OVRA 2WSEJ 4U3FD 1NU1G 4PV1D 3KDPB 3GKEA 3HD7B 1SFCC 4OVNF 1BCCJ 1N7SA 4P1BH 1NKZB 2HLOA 2KSJA 4AYCA 3IF4A 1NU1E 4WWIA 3TK1A 2HMJA 4GT1A 2ZYGA 2H89C 2XDJA 1S9KE 4WY4C 2ZYLA 1GU5A 2R32A 3CMEP 2NUKA 2D2CC 5KLVG 2KLUA 1UUWA 2J58A 4QUQA 2DW3A 3GL0A 2QG4A 1L0LG 4HKZH 3SWKA 2W6BA 2YXQB 2R5BA 1NAFA 5AVSB 4H44C 1IFNA 3MTUE 4HB1A 1UUVA 3A3YB 2ZYDA 4HM1A 3H1KE 4RKUJ 5APQA 4DZOA 3HTKB 1LTJC 3FOUA 5GTHH 3I56P 2JP3A 3RK3D 1WQLA 1N7SB 4JPZB 4NB9D 2B9BA 5AW1B 1S9KD 1YHQP 1BCCG 4H13D 3WU2H 3TGUG 3TSIA 1SQPK 3ITKA 1SQBJ 1VQMP 4PJ0H 2HODA 1HBWA 2YKPA 2O1JA 1KV4A 1NU1D 4RO0A 1H88A 1JCDA 5KKZC 1VQ7P 3CCSP 2WVRA 3W68A 1JCCA 2E74B 2B88A 1PGQA 2HR3A 2NPSC 3L73D 4NBDD 1SFCD 4HYTB 4W7YA 4P1CH 1BCCE 5KJ7D 3ZDMA 4QURA 5HL4A 2OARA 3HE4B 2DE6D 2CPSA 5AVWB 4AIVA 3Q1MA 1RFSA 3BCCD 2K9YA 3CC4P 1VQ5P 3O6QA 3L36A 1XTCC 4H0LD 1W2EA 1KB9D 3G6EP 1K05A 1G1IA 4KHXA 4W7ZA 2KSEA 1NTZE 3E7KA 1J1EB 2HODB 2WTYA 3CX5H 2FYNC 1NTZJ 2K9JA 3IFMA 1KB9I 4MN4C 1JEKA 2K9JB 4Y99B 1JB0J 3S4RA 1ULIA 1AV1A 1T3UA 3M0DC 2QM7A 5KLIC 1S1CX 3BVHA 1FQTA 5B5EH 2KS1A 4KT0J 2QA4P 2Q5UA 3KQGA 3PP5A 4R4MA 1HF9A 1SQQK 1QVFO 1GW4A 4QMAA 2Q6QA 3M9HA 1GL2B 1KILD 3JCUH 1Y9BA 3HE4A 2A45G 2HPCA 3L73E 2P67A 4NBED 2I7FA 2ZXXA 3U1CA 3G4SP 1JO5A 1SQPD 2KS1B 1EZVD 1J1EC 1R5SA 3H1HG 1VM9A 1KB9H 3I55P 4IFMA 1PP9D 2MJZA 1DD3A 1FE6A 4JYBA 3TNUA 3A2AA 4ZKPA 1UIIA 2YIUB 1MFTA 3V4QA 3CX5E 1J1DC 3CCVP 1NYHA 3LIEA 1VQ4P 2Y9YA 3L70D 1YBKA 1RF1B 1FU1A 3L74E 2R5DA 2BASA 2Q3IA 4I6MC 1EZVI 2WZ7A 2I1JA 1KYOH 3MP7B 1KILE 3CL3D 1PGPA 3L73J 4N78D 5KLVJ 1LTGC 3H1IE 1P84I 4IL6E 1G2CA 4EIJA 3BRTB 3H1LG 2JO6A 1GL2A 2N1TB 2OYHA 2YKQA 3BRVB 3VCAA 2RH0A 4GOFA 1RE4C 1FC2C 3HE5A 5CBOA 2ITAA 1NDOA 1VCKA 1H0TA 2YO3A 3HD7C 3H1IJ 1M56D 1N8RQ 4YXDC 2I8DA 1SQBG 1IFPA 1HGZA 4H44D 1P84H 2CK3H 3GZYA 3L75G 2BCCD 4R4LA 3H1JE 1L0LK 3BCCE 5EFWB 4RJTA 3V2NA 4I1LA 3C9IA 1HVVA 4WY4A 2J59M 3AE1C 2WMMA 2M3BA 1LGHB 1S5LE 3LIDA 1WT6A 2HMKA 2B24A 2OTJP 2R44A 3HUSC 1FDOA 3CWBG 1ZRTD 2KK7A 1T2KC 2NPSD 4HJLA 1MKMA 2KZJA 5KJ7C 2W6JH 4A7PA 2E76D 3V6IA 4K35A 2V7QH 2OYIC 1JUNA 3L75J 1S4XA 1FZFA 1NTMJ 2WWWA 2Z4EA 3MIWA 3FWNA 2NVEA 4EMJB 4WBAA 5CMZA 1K73Q 2BCCG 1LT9A 1LTBC 3B5NC 2JWAA 2YMYA 2IFNA 2NUMA 2YFJA 2AEFA 1LTJA 5GTHE 2FYUD 3VMHD 1NYKA 2MKVA 4OGQB 3SFEC 3H1JJ 1M8OB 3IAOA 2QJYC 3Q5SA 5AVTB 1IO4A 2E43A 1GD2E 4OGQC 2FYZA 3G71P 3L74D 3Q3DA 2E42A 4PD4E 1LT9C 1L4AD 4GOEA 3Q5RA 1EG9A 5BVZA 2AEJA 2OGUA 1NTKG 3KYQA 4HM4A 1W2BO 1L0LD 1KYOD 2WSFJ 4EI2A 3G3ZA 1OW7A 1PP9E 1VQNP 1Y47A 2NWFA 3D6YA 2V4HA 1WRGA 2YVJB 2C0WA 2E76B 2GBWA 1LTJB 5AW4B 1YQ3C 3L72G 1RF1C 1USEA 1S3JA 2GA1A 1FJPA 5AW2B 3HD7D 1X22A 3L72E 3TNUB 5B66E 3GW6A 1PL5A 2LR2A 1SVFA 2IPPA 3RL0C 1H8AA 2E75C 1JY3N 2XU6A 3GLMA 1SQXJ 1KTMA 3AE8C 1SS1A 2I1KA 2M8RA 1VQ6P 1DEBA 3KXDA 3KZIE 1E79H 3L72J 1NAYA 2R3SA 3BCCG 2BEQD 1SQPG 5APVA 3NMDA 1NTKK 3PHLA 2ZT9C 2HFED 2Q3WA 5DJUB 3I5CA 3P8CD 1G2CB 4IL6H 1N73C 3GF3A 3CCJP 2JO1A 2M3EA 4D6TG 2M5AA 1BE3G 2QJPB 1USDA 3RL0B 2XSOA 2FYUK 4WB4A 3VCPA 2YXRB 2ZFCA 4UB6E 1HUCA 3GZXA 2BMQA 3H1HD 2N9YB 2GM4A 3OW2O 4HM0A 1JNMA 2E75B 4JQ0D 1NTKE 3L71D 1CZQA 4EDFA 3AEAC 4NPFX 4NPDA 1AQ5A 3SFDC 1Q82Q 1G8JB 3GF7A 1O7PA 3L35A 5CHXA 1GK4A 2POHA 3CMAP 2AEMA 3CCMP 2H88C 2PGDA 1ZXGA 1JM1A 1NTZK 5L8RJ 2SPZA 1U7MA 1OW6A 1GK6A 1Q2NA 1GZLA 2IBZE 4UB8E 3D70A 1N73A 1EDJA 2WITA 5CCGC 2FXPA 3H1LD 3L70G 3RK3E 1BGYD 3A0HE 1FZGA 1FJKA 3CLQA 4QCKA 2JZAA 2BCCE 3KZIH 1RE4A 3AE6C 2GUVA 1J2JB 1EZVE 2A06E 1SQPE 3GTEA 1SQXK 2IX7C 2KYVA 2W90A 3PRJA 1FZAA 1VDFA 2QJYB 1ZRTE 1T8ZA 3H1LE 3M91A 1LWUB 2IZ1A 2Y9ZA 1GL2D 3CCRP 1YJWP 2AXTH 3S9OA 1HWTC 1GW3A 2UWJE 1FOSF 1FZCB 2HMLA 1EC5A 1T3JA 2IYOA 3HUSB 3VMGD 1AVOA 3D71A 2HPCB 2E4QA 1M90Q 4H0LC 1PPJD 4QDFA 3CWBD 1CI6B 1SQVE 3B5NB 3R4YA 1AA0A 3V2PA 4XA4A 5KJ7A 4PV1B 4BWNA 1QL1A 1TU3F 4DOJA 4H0LB 1OX3A 3DQYA 4PJ0E 5H2FE 2O01N 3CC7P 1SQPJ 4UB8H 3P8MC 4N3YB 3NXSA 3B4SA 3RL0g 1DD4A 1YYCA 4NBCD 1GDTA 3AEDC 3H25A 1LP1B 1YITP 2E74D 2KXPB 1SFCB 2Y0EA 1RE3A 3TGUE 1VPCA 1L4AC 1URQA 1IJDB 3GL2A 2Q9IA 1QVGO 2FYNB 1BGYG 3VN0A 1S72P 2JR8A 5E79H 2E75D 1LWUC 1KQFB 3CX5D 4C7NB 1KILC 1LT1A 2WPSA 2XKMA 3EFFK 2Z5IA 2YFLA 4TLFA 2FKWB 3RK3C 1WMKA 2WPRA 3AE7C 3CCEP 1P84E 4L75A 5AVRB 3AE9C 1KQLA 1SQQG 1L0ND 3QWOC 3UIAA 2PRRA 4C7RA 1URQD 1LNQA 4IFDK 1JM0A 1L0NJ 3GHGA 2A06G 5BOKA 2OYHC 1QLED 1X9VA 5CCGD 3EN1A 1NKNA 1KILA 4GDOA 2AXCA 1RF1A 3CCQP 3CCLP 1PGJA 1L4AB 3CXHH 5AVZB 3BATA 2KP8A 4O9BA 2YIUC 3M0AA 2GBXA 3PJSK 5AW3B 1YTZI 2KI7B 5TISE 2FYUG 2HMMA 1L0NG 3LW5H 2BMOA 1GMJA 4D6TD 5AVYB 5K5GB 4GODA 3WUVA 2O01H 1XTGB 3K5BA 2A06D 4OWFA 3GMAA 3L70E 3RK2B 1OWAA 1Q90D 1W5CE 1A02F 3WU2E 1KC8Q 1SQVG 1AFOA 2IBZG 3TF5A 4Z1MH 1O7NA 4PD4I 2B87B 2RMZA 4PV1C 4U3FJ 3RBXA 2Y0CA 1ZN5A 1Y8AA 4U3FE 1PP9J 1ZV8A 1K8AQ 1KORA 4WY4B 1QL2A 2QSIA 3VMAA 1NO4A 1HJ0A 1VQKP 2BMRA 3N0QA 5APUA 1FZCC 1T6AA 1SJGA 1UIXA 3U59A 1NTMK 4IFFA 3A7OA 2P7JA 1ZR2A 5CCHC 2XSHA 4I7ZB 1FDMA 5CJ4A 1KILB 1LWUA 2ZYAA 1YJ9P 5AW7B 3CD6P 3L71E 4U7JA 4HJGH 1NTMG 2XR8A 1L0NK 2XRXA 1M1JA 3U1AA 4W80A 3GTSA 2A45H 1GU4A 4M3LA 1T2KD 1NTME 2YFIA 1EDLA 5AW0B 1IC2A 4QDFB 3CWBE 3H1JD 5APXA 3VP8A 1MUUA 3CWBJ 5KLVE 4Y99C 2E76C 4HH2A 4BXLA 2M0BA 3AE2C 3VMYA 3SWYA 2C0XA 2XZRA 3TGUD 4Y28J 4N6JA 1SQBD 1SQQD 3M0DA 3C8VA 1LJ2A 2XNXA 2NPSB 2OTLP 1S5LH 5CCHD 1BE3D 2WSEH 3CCUP 3B71A 4HM8A 3II6A 2PP6A 5APYA 2KIKA 2LKMA 1VF5C 2IYPA 1KMIZ 1NH4A 1KQGB 3H1JG 1EQ7A 4ZMDA 2L5GB 1RF0C 3AEFC 3H1IG 1PPJE 3P32A 5AEWA 1G1JA 3RK2D 3RK2C 1MV8A 2E4PA 2QJPC 5BU5A 4AAYB 4H44B 3MGNA 4HM7A 3H1LJ 4H13B 2ZAEB 1NTMD 4EYYQ 3WMM0 1DIPA 2QVAA 5AVUB 3PLNA 1PPJG 2RKLA 3C0DA 1NJIQ 1PIXA 2FBWC 1D7MA 2QM8A 2HMOA 5KLIB 3VP9A 4NPEA 3CXHI 3P8CE 4YPCA 2IDBA 1ZP0C 2JKVA 1JTHA 2KLVA 3AEGC 4L74A 5B66H 3A0HH 1BSHA 1EDIA 2ZVOB 1OFCX 2O01J 1LTSC 3H1HE 1O7HA 2Z5HA 1RF0A 1AQTA 1NGMB 1M1KQ 4ASVA 3L74J 1SLQA 1SQBK 3VYIA 5DJTB 1N2DC 1IFIA 4YTPC 3B8EB 3L72D 3G9RA 4LGDE 2P10A 3AZCA 4HM2A 3H32B 4U3FG 3IN6A 3L75D 3L70J 1FS0E 5CBNA 1U57A 3VMZA 1JOCA 2YKOA 1NOHA 4DT0A 5KKZB 3PH0A 1JY2P 5CXMA 4N78E 2WT7B 2XNDH 1RY3A 2E74C 1P84D 5AW6B 1X0TA 1N7SC 4DJGA 1GTWA 2P58A 1M1JB 3S1KA 1CW5A 1Q86Q 5AW9B 3M9BA 3AEBC 3Q5PA 4ASWA 3KHUA 1RE3C 3T97B 1RQVA 3L73G 4WY4D 1BDDA 2ZXEB 2WSSH 2WPVB 2QJKB 3OA7A 4XFJA 1R5LA 3EQ2A 3GOBA 3VMID 2WPQA 2ZJSE 2CPBA 1NTZG 1FZEA 5AVQB 1YIJP 2NVGA 1SQXG 4XE5B 1X8YA 2A45I 1FBMA 1EDKA 3FWLA 1AJYA 5AW8B 2ZT9D 3TGUJ 3B5ND 3EWKA 1SQBE 2O1KA 4LC1A 3GB4A 4ZNCA 2J5UA 1SQQE 1O7GA 1S2EA 2FFDC 1M7LA 5GTIE 3N4XA 3O8ZA 3L75E 4L73A 4KJMA 2G8YA
chains in the Genus database with same CATH topology
2E75D 1O7NA 3GZXA 2BMQA 2QPZA 1L0NE 4HM4A 1NTZE 3H1HE 1O7HA 2B1XA 2HMKA 2B24A 4HM0A 1VF5D 2NVFA 4NBFD 2FYNC 1PP9E 3L74E 4U3FE 2HMLA 1KYOE 2YFLA 1L0LE 1UUVA 1NTKE 2NWFA 4QUPA 4HM1A 2YVJB 1P84E 3H1KE 4HJLA 2BMRA 2D2CD 2GBWA 3D89A 3N0QA 3VMGD 4HM3A 3AZCA 4HM2A 1ULIA 1SJGA 3H1IE 1G8JB 1Q90C 3FOUA 1SQXE 1G8KB 2E4QA 1O7PA 5KLIC 5AEUA 2E76D 1FQTA 5BOKA 1WQLA 2JO6A 2XSHA 2QJKC 4NB9D 1PPJE 4QDDA 5AEWA 3L72E 4QDFA 3EN1A 4H13D 5CXMA 3VCAA 4PV1D 1SQVE 3GKEA 4OGQD 3L71E 2E4PA 2NVEA 2QJPC 4AAYB 4EMJB 4HM5A 1JM1A 4HM7A 1NDOA 1VCKA 2XR8A 2XRXA 4P1BH 2IBZE 2DE7D 5KKZC 2CKFA 3GTSA 2NUMA 1NU1E 2FYUE 3L73E 2YFJA 3DQYA 2HMJA 3GCEA 2YIUC 4NBED 2I7FA 1NTME 2YFIA 3VMHD 4H44D 1NYKA 2GBXA 4NBDD 4QCKA 2JZAA 3C0DA 1KB9E 2BCCE 3CXHE 4QDFB 1BGYE 3CWBE 3GZYA 4NBBD 4P1CH 2ZYLA 1BCCE 2DE5D 2Q3WA 2QJYC 4HM6A 2HMMA 2NUKA 4NBCD 3GOBA 3VMID 5KLVE 2HMOA 4QURA 2BMOA 3H1JE 5HL4A 1EZVE 1O7WA 1VM9A 2A06E 1SQPE 1BE3E 2DE6D 2NVGA 3GTEA 4QDCA 2E74D 4AIVA 3BCCE 1RFSA 1ZRTE 4HM8A 3H1LE 1UUWA 3L70E 2HMNA 4PD4E 3TGUE 2XSOA 2ZT9D 4HKVA 1SQBE 3EQQA 3GB4A 4NBAD 4NB8D 1SQQE 3VCPA 1O7GA 1RIEA 3GL2A 4H0LD 4QUQA 4NBHD 3GL0A 1EG9A 1ULJA 4NBGD 3CX5E 4D6TE 1O7MA 3L75E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E75 D;  1O7N A;  3GZX A;  2BMQ A;  2QPZ A;  1L0N E;  4HM4 A;  1NTZ E;  3H1H E;  1O7H A;  2B1X A;  2HMK A;  2B24 A;  4HM0 A;  1VF5 D;  2NVF A;  4NBF D;  2FYN C;  1PP9 E;  3L74 E;  4U3F E;  2HML A;  1KYO E;  2YFL A;  1L0L E;  1UUV A;  1NTK E;  2NWF A;  4QUP A;  4HM1 A;  2YVJ B;  1P84 E;  3H1K E;  4HJL A;  2BMR A;  2D2C D;  2GBW A;  3D89 A;  3N0Q A;  3VMG D;  4HM3 A;  3AZC A;  4HM2 A;  1ULI A;  1SJG A;  3H1I E;  1G8J B;  1Q90 C;  3FOU A;  1SQX E;  1G8K B;  2E4Q A;  1O7P A;  5KLI C;  5AEU A;  2E76 D;  1FQT A;  5BOK A;  1WQL A;  2JO6 A;  2XSH A;  2QJK C;  4NB9 D;  1PPJ E;  4QDD A;  5AEW A;  3L72 E;  4QDF A;  3EN1 A;  4H13 D;  5CXM A;  3VCA A;  4PV1 D;  1SQV E;  3GKE A;  4OGQ D;  3L71 E;  2E4P A;  2NVE A;  2QJP C;  4AAY B;  4EMJ B;  4HM5 A;  1JM1 A;  4HM7 A;  1NDO A;  1VCK A;  2XR8 A;  2XRX A;  4P1B H;  2IBZ E;  2DE7 D;  5KKZ C;  2CKF A;  3GTS A;  2NUM A;  1NU1 E;  2FYU E;  3L73 E;  2YFJ A;  3DQY A;  2HMJ A;  3GCE A;  2YIU C;  4NBE D;  2I7F A;  1NTM E;  2YFI A;  3VMH D;  4H44 D;  1NYK A;  2GBX A;  4NBD D;  4QCK A;  2JZA A;  3C0D A;  1KB9 E;  2BCC E;  3CXH E;  4QDF B;  1BGY E;  3CWB E;  3GZY A;  4NBB D;  4P1C H;  2ZYL A;  1BCC E;  2DE5 D;  2Q3W A;  2QJY C;  4HM6 A;  2HMM A;  2NUK A;  4NBC D;  3GOB A;  3VMI D;  5KLV E;  2HMO A;  4QUR A;  2BMO A;  3H1J E;  5HL4 A;  1EZV E;  1O7W A;  1VM9 A;  2A06 E;  1SQP E;  1BE3 E;  2DE6 D;  2NVG A;  3GTE A;  4QDC A;  2E74 D;  4AIV A;  3BCC E;  1RFS A;  1ZRT E;  4HM8 A;  3H1L E;  1UUW A;  3L70 E;  2HMN A;  4PD4 E;  3TGU E;  2XSO A;  2ZT9 D;  4HKV A;  1SQB E;  3EQQ A;  3GB4 A;  4NBA D;  4NB8 D;  1SQQ E;  3VCP A;  1O7G A;  1RIE A;  3GL2 A;  4H0L D;  4QUQ A;  4NBH D;  3GL0 A;  1EG9 A;  1ULJ A;  4NBG D;  3CX5 E;  4D6T E;  1O7M A;  3L75 E; 
#chains in the Genus database with same CATH topology
 1JY3 P;  2YMK A;  2KB7 P;  2BEZ F;  3H6P A;  1VQP P;  4NBF D;  1BDC A;  1N7S D;  4GKG A;  2H8P D;  3E1R A;  1JY3 O;  2C9N Y;  1Q81 Q;  1OVU A;  1M57 D;  3BCC J;  2OYI B;  3VOP A;  1IK9 A;  1KZU B;  1R8E A;  1G8K B;  2P1J A;  5KAF E;  1YJN P;  1HGV A;  1ZR4 A;  5KAF H;  1FDI A;  2JJL A;  2QRX A;  1DEE G;  1Z56 A;  2KNC B;  2NRG A;  1KN7 A;  1N7L A;  1SFC A;  2OTK E;  2ZVN B;  2WSF H;  2RN0 A;  1FZC A;  2JEE A;  2B89 A;  3N7N A;  1YTZ T;  2L91 A;  1A02 J;  2DE7 D;  2BCC J;  2P2U A;  1KFM A;  2FYU E;  3GCE A;  3HTK A;  3V2Q A;  1IK7 A;  5KAI H;  1KB9 E;  3CXH E;  3W67 A;  5AVX B;  1ZW0 A;  2DE5 D;  2FFD A;  2YO2 A;  3KPE A;  3AE3 C;  3JC2 2;  3E1I A;  1IFM A;  1O7W A;  1YQ4 C;  2LXB A;  1BE3 E;  2B87 A;  3FX0 A;  3RK3 B;  1OMI A;  2HG5 D;  1H0T B;  1E5W A;  3CPW O;  1OXZ A;  4PD4 D;  3HE5 B;  3IR9 A;  1VF5 B;  2FXM A;  1PFI A;  2HMN A;  1HJB A;  3B5N A;  1M1J C;  2E5T A;  1CI6 A;  3MZW B;  4K3A A;  3SWF A;  4NBH D;  1LTA C;  1PV3 A;  1ULJ A;  3NTN A;  3TDK A;  3JCU E;  5KLV D;  5TJH A;  5APS A;  1VQ9 P;  4IOI H;  1PGO A;  4JBZ A;  5E79 E;  1VQL P;  2IFM A;  5GTI H;  3HUS A;  3NFQ A;  2FXO A;  2E5Y A;  1Q7Y Q;  1QGK B;  2C9L Y;  2KZI A;  1X79 B;  1NTK D;  2PAJ A;  3D89 A;  1OIP A;  1FZB A;  1BSN A;  1KYO I;  1L4A A;  1LP1 A;  5C39 A;  3H1I D;  2Q1K A;  5AW5 B;  2W8Z A;  1VQ8 P;  4L76 A;  2KUB A;  3P7K A;  2W6A A;  1PP9 G;  4PD4 H;  4BRY B;  4OGQ D;  3V4W A;  1VQO P;  1JTH B;  1NWQ A;  1NU1 J;  1OZH A;  3GHG B;  1ZOY C;  1SQV J;  3LW5 J;  3WUU A;  2CKF A;  5BU8 B;  5CCG A;  2H43 A;  2OQQ A;  3VMX A;  4EOT A;  5KTB A;  5CJ0 A;  2D2C B;  3M9Q A;  1BGY E;  4NBB D;  2GUS A;  3CXH D;  5CCH A;  1YI2 P;  4H13 C;  1N73 B;  2WSC J;  1LTI C;  2FYU J;  2VRS A;  4QDC A;  4GIF A;  2WQY C;  5B5E E;  3OAK A;  1RH5 B;  1JMM A;  1BCC D;  3EQQ A;  1L0L J;  4NB8 D;  3JSV C;  1DX7 A;  2XV5 A;  2Q7C A;  3RBZ A;  4NBG D;  2G3A A;  4D6T E;  2W83 C;  4TT3 H;  2K1A A;  4I2L C;  1KQS O;  2QEX P;  2QPZ A;  3AE4 C;  1IFD A;  2B1X A;  1FAV A;  4YXW H;  1IZN B;  2IZ0 A;  1NVO A;  1QX8 A;  1EXI A;  4BRY A;  4LLH A;  2D2C D;  2Q3E A;  4HM3 A;  5TIS H;  3A5T A;  5M1B A;  5AVV B;  4D6T J;  3FXE A;  3WUT A;  1ZME C;  3H1K G;  3AE5 C;  3M06 A;  5KLV K;  2QJK C;  3EFG A;  5APW A;  1H89 A;  2N9B A;  2NPS A;  1SQV D;  2K37 A;  1S5L X;  1NTK J;  3QH9 A;  1U7J A;  2OYO A;  2FY8 A;  1BGY J;  1OW8 A;  4IL6 X;  3H32 A;  2QIW A;  4OH8 B;  3AEE C;  3CC2 P;  3RGU A;  1L2P A;  4DCK A;  2LXC B;  3F89 A;  4HM6 A;  1JMB A;  3L37 A;  4RES B;  1RHZ B;  3MHV A;  4CPG A;  1J1D B;  1LTT C;  2W27 A;  4HKV A;  4NBA D;  1PZQ A;  1EZV G;  1RIE A;  5APT A;  3PTZ A;  3L71 J;  2NZ2 A;  1JY2 N;  1NTZ D;  1L0N E;  1LT9 B;  3TYY A;  1NHL A;  1VF5 D;  3A0B E;  2NVF A;  3H1H J;  2ZT9 B;  1KYO E;  5H2F H;  1L0L E;  1CSB A;  4ZKU A;  3HD7 A;  4QUP A;  1OVV A;  1K9M Q;  1MZ9 A;  2JDI H;  4AUW A;  5KAI E;  1BE3 J;  4I7Z C;  3BAS A;  3D6Z A;  2IBZ D;  1SQQ J;  2PFX A;  3AEC C;  3GHG C;  3SSU A;  1SQX D;  2JWD A;  2OYI A;  4QDD A;  3H1K D;  3F5H A;  3L74 G;  3MUD C;  3R2P A;  1AVY A;  3MD0 A;  4C46 A;  2K88 A;  3L4F A;  4HM5 A;  1K04 A;  2O3J A;  2V7Q J;  4C7N A;  1N86 A;  2QE7 H;  3A0B H;  4JYC A;  1GL2 C;  1QEX A;  3H1K J;  3GG2 A;  2FFD B;  3C1L A;  3HRN A;  1URQ B;  1IFJ A;  1SQV K;  1RQU A;  4WVZ A;  3V2R A;  3VTP C;  1KD1 Q;  3FGA D;  2WSC H;  3CI9 A;  3MUD A;  3USS A;  4JF7 A;  4AQR D;  4B86 A;  1SP4 A;  3CX5 I;  3Q2Y A;  1HH0 A;  3RL0 D;  2KNC A;  3L71 G;  3O6Q B;  2AXT E;  3FXD A;  1FOS E;  4UB6 H;  2HYN A;  3T97 A;  2M5A B;  2N1T D;  2N1T C;  1EXJ A;  1O7M A;  3OJA B;  2R3C A;  2IBZ I;  3ABV C;  2KOG A;  1MFZ A;  1DH3 A;  1ZLL A;  1VL2 A;  2WT7 A;  2YNY A;  2K3R A;  3V5B A;  1HTL C;  2N1T A;  2OYH B;  1NU1 K;  2Y0D A;  1Q90 C;  1KFN A;  1SQX E;  1URQ C;  2H7H A;  5AEU A;  1JY2 O;  1OVR A;  2WSE J;  4U3F D;  1NU1 G;  4PV1 D;  3KDP B;  3GKE A;  3HD7 B;  1SFC C;  4OVN F;  1BCC J;  1N7S A;  4P1B H;  1NKZ B;  2HLO A;  2KSJ A;  4AYC A;  3IF4 A;  1NU1 E;  4WWI A;  3TK1 A;  2HMJ A;  4GT1 A;  2ZYG A;  2H89 C;  2XDJ A;  1S9K E;  4WY4 C;  2ZYL A;  1GU5 A;  2R32 A;  3CME P;  2NUK A;  2D2C C;  5KLV G;  2KLU A;  1UUW A;  2J58 A;  4QUQ A;  2DW3 A;  3GL0 A;  2QG4 A;  1L0L G;  4HKZ H;  3SWK A;  2W6B A;  2YXQ B;  2R5B A;  1NAF A;  5AVS B;  4H44 C;  1IFN A;  3MTU E;  4HB1 A;  1UUV A;  3A3Y B;  2ZYD A;  4HM1 A;  3H1K E;  4RKU J;  5APQ A;  4DZO A;  3HTK B;  1LTJ C;  3FOU A;  5GTH H;  3I56 P;  2JP3 A;  3RK3 D;  1WQL A;  1N7S B;  4JPZ B;  4NB9 D;  2B9B A;  5AW1 B;  1S9K D;  1YHQ P;  1BCC G;  4H13 D;  3WU2 H;  3TGU G;  3TSI A;  1SQP K;  3ITK A;  1SQB J;  1VQM P;  4PJ0 H;  2HOD A;  1HBW A;  2YKP A;  2O1J A;  1KV4 A;  1NU1 D;  4RO0 A;  1H88 A;  1JCD A;  5KKZ C;  1VQ7 P;  3CCS P;  2WVR A;  3W68 A;  1JCC A;  2E74 B;  2B88 A;  1PGQ A;  2HR3 A;  2NPS C;  3L73 D;  4NBD D;  1SFC D;  4HYT B;  4W7Y A;  4P1C H;  1BCC E;  5KJ7 D;  3ZDM A;  4QUR A;  5HL4 A;  2OAR A;  3HE4 B;  2DE6 D;  2CPS A;  5AVW B;  4AIV A;  3Q1M A;  1RFS A;  3BCC D;  2K9Y A;  3CC4 P;  1VQ5 P;  3O6Q A;  3L36 A;  1XTC C;  4H0L D;  1W2E A;  1KB9 D;  3G6E P;  1K05 A;  1G1I A;  4KHX A;  4W7Z A;  2KSE A;  1NTZ E;  3E7K A;  1J1E B;  2HOD B;  2WTY A;  3CX5 H;  2FYN C;  1NTZ J;  2K9J A;  3IFM A;  1KB9 I;  4MN4 C;  1JEK A;  2K9J B;  4Y99 B;  1JB0 J;  3S4R A;  1ULI A;  1AV1 A;  1T3U A;  3M0D C;  2QM7 A;  5KLI C;  1S1C X;  3BVH A;  1FQT A;  5B5E H;  2KS1 A;  4KT0 J;  2QA4 P;  2Q5U A;  3KQG A;  3PP5 A;  4R4M A;  1HF9 A;  1SQQ K;  1QVF O;  1GW4 A;  4QMA A;  2Q6Q A;  3M9H A;  1GL2 B;  1KIL D;  3JCU H;  1Y9B A;  3HE4 A;  2A45 G;  2HPC A;  3L73 E;  2P67 A;  4NBE D;  2I7F A;  2ZXX A;  3U1C A;  3G4S P;  1JO5 A;  1SQP D;  2KS1 B;  1EZV D;  1J1E C;  1R5S A;  3H1H G;  1VM9 A;  1KB9 H;  3I55 P;  4IFM A;  1PP9 D;  2MJZ A;  1DD3 A;  1FE6 A;  4JYB A;  3TNU A;  3A2A A;  4ZKP A;  1UII A;  2YIU B;  1MFT A;  3V4Q A;  3CX5 E;  1J1D C;  3CCV P;  1NYH A;  3LIE A;  1VQ4 P;  2Y9Y A;  3L70 D;  1YBK A;  1RF1 B;  1FU1 A;  3L74 E;  2R5D A;  2BAS A;  2Q3I A;  4I6M C;  1EZV I;  2WZ7 A;  2I1J A;  1KYO H;  3MP7 B;  1KIL E;  3CL3 D;  1PGP A;  3L73 J;  4N78 D;  5KLV J;  1LTG C;  3H1I E;  1P84 I;  4IL6 E;  1G2C A;  4EIJ A;  3BRT B;  3H1L G;  2JO6 A;  1GL2 A;  2N1T B;  2OYH A;  2YKQ A;  3BRV B;  3VCA A;  2RH0 A;  4GOF A;  1RE4 C;  1FC2 C;  3HE5 A;  5CBO A;  2ITA A;  1NDO A;  1VCK A;  1H0T A;  2YO3 A;  3HD7 C;  3H1I J;  1M56 D;  1N8R Q;  4YXD C;  2I8D A;  1SQB G;  1IFP A;  1HGZ A;  4H44 D;  1P84 H;  2CK3 H;  3GZY A;  3L75 G;  2BCC D;  4R4L A;  3H1J E;  1L0L K;  3BCC E;  5EFW B;  4RJT A;  3V2N A;  4I1L A;  3C9I A;  1HVV A;  4WY4 A;  2J59 M;  3AE1 C;  2WMM A;  2M3B A;  1LGH B;  1S5L E;  3LID A;  1WT6 A;  2HMK A;  2B24 A;  2OTJ P;  2R44 A;  3HUS C;  1FDO A;  3CWB G;  1ZRT D;  2KK7 A;  1T2K C;  2NPS D;  4HJL A;  1MKM A;  2KZJ A;  5KJ7 C;  2W6J H;  4A7P A;  2E76 D;  3V6I A;  4K35 A;  2V7Q H;  2OYI C;  1JUN A;  3L75 J;  1S4X A;  1FZF A;  1NTM J;  2WWW A;  2Z4E A;  3MIW A;  3FWN A;  2NVE A;  4EMJ B;  4WBA A;  5CMZ A;  1K73 Q;  2BCC G;  1LT9 A;  1LTB C;  3B5N C;  2JWA A;  2YMY A;  2IFN A;  2NUM A;  2YFJ A;  2AEF A;  1LTJ A;  5GTH E;  2FYU D;  3VMH D;  1NYK A;  2MKV A;  4OGQ B;  3SFE C;  3H1J J;  1M8O B;  3IAO A;  2QJY C;  3Q5S A;  5AVT B;  1IO4 A;  2E43 A;  1GD2 E;  4OGQ C;  2FYZ A;  3G71 P;  3L74 D;  3Q3D A;  2E42 A;  4PD4 E;  1LT9 C;  1L4A D;  4GOE A;  3Q5R A;  1EG9 A;  5BVZ A;  2AEJ A;  2OGU A;  1NTK G;  3KYQ A;  4HM4 A;  1W2B O;  1L0L D;  1KYO D;  2WSF J;  4EI2 A;  3G3Z A;  1OW7 A;  1PP9 E;  1VQN P;  1Y47 A;  2NWF A;  3D6Y A;  2V4H A;  1WRG A;  2YVJ B;  2C0W A;  2E76 B;  2GBW A;  1LTJ B;  5AW4 B;  1YQ3 C;  3L72 G;  1RF1 C;  1USE A;  1S3J A;  2GA1 A;  1FJP A;  5AW2 B;  3HD7 D;  1X22 A;  3L72 E;  3TNU B;  5B66 E;  3GW6 A;  1PL5 A;  2LR2 A;  1SVF A;  2IPP A;  3RL0 C;  1H8A A;  2E75 C;  1JY3 N;  2XU6 A;  3GLM A;  1SQX J;  1KTM A;  3AE8 C;  1SS1 A;  2I1K A;  2M8R A;  1VQ6 P;  1DEB A;  3KXD A;  3KZI E;  1E79 H;  3L72 J;  1NAY A;  2R3S A;  3BCC G;  2BEQ D;  1SQP G;  5APV A;  3NMD A;  1NTK K;  3PHL A;  2ZT9 C;  2HFE D;  2Q3W A;  5DJU B;  3I5C A;  3P8C D;  1G2C B;  4IL6 H;  1N73 C;  3GF3 A;  3CCJ P;  2JO1 A;  2M3E A;  4D6T G;  2M5A A;  1BE3 G;  2QJP B;  1USD A;  3RL0 B;  2XSO A;  2FYU K;  4WB4 A;  3VCP A;  2YXR B;  2ZFC A;  4UB6 E;  1HUC A;  3GZX A;  2BMQ A;  3H1H D;  2N9Y B;  2GM4 A;  3OW2 O;  4HM0 A;  1JNM A;  2E75 B;  4JQ0 D;  1NTK E;  3L71 D;  1CZQ A;  4EDF A;  3AEA C;  4NPF X;  4NPD A;  1AQ5 A;  3SFD C;  1Q82 Q;  1G8J B;  3GF7 A;  1O7P A;  3L35 A;  5CHX A;  1GK4 A;  2POH A;  3CMA P;  2AEM A;  3CCM P;  2H88 C;  2PGD A;  1ZXG A;  1JM1 A;  1NTZ K;  5L8R J;  2SPZ A;  1U7M A;  1OW6 A;  1GK6 A;  1Q2N A;  1GZL A;  2IBZ E;  4UB8 E;  3D70 A;  1N73 A;  1EDJ A;  2WIT A;  5CCG C;  2FXP A;  3H1L D;  3L70 G;  3RK3 E;  1BGY D;  3A0H E;  1FZG A;  1FJK A;  3CLQ A;  4QCK A;  2JZA A;  2BCC E;  3KZI H;  1RE4 A;  3AE6 C;  2GUV A;  1J2J B;  1EZV E;  2A06 E;  1SQP E;  3GTE A;  1SQX K;  2IX7 C;  2KYV A;  2W90 A;  3PRJ A;  1FZA A;  1VDF A;  2QJY B;  1ZRT E;  1T8Z A;  3H1L E;  3M91 A;  1LWU B;  2IZ1 A;  2Y9Z A;  1GL2 D;  3CCR P;  1YJW P;  2AXT H;  3S9O A;  1HWT C;  1GW3 A;  2UWJ E;  1FOS F;  1FZC B;  2HML A;  1EC5 A;  1T3J A;  2IYO A;  3HUS B;  3VMG D;  1AVO A;  3D71 A;  2HPC B;  2E4Q A;  1M90 Q;  4H0L C;  1PPJ D;  4QDF A;  3CWB D;  1CI6 B;  1SQV E;  3B5N B;  3R4Y A;  1AA0 A;  3V2P A;  4XA4 A;  5KJ7 A;  4PV1 B;  4BWN A;  1QL1 A;  1TU3 F;  4DOJ A;  4H0L B;  1OX3 A;  3DQY A;  4PJ0 E;  5H2F E;  2O01 N;  3CC7 P;  1SQP J;  4UB8 H;  3P8M C;  4N3Y B;  3NXS A;  3B4S A;  3RL0 g;  1DD4 A;  1YYC A;  4NBC D;  1GDT A;  3AED C;  3H25 A;  1LP1 B;  1YIT P;  2E74 D;  2KXP B;  1SFC B;  2Y0E A;  1RE3 A;  3TGU E;  1VPC A;  1L4A C;  1URQ A;  1IJD B;  3GL2 A;  2Q9I A;  1QVG O;  2FYN B;  1BGY G;  3VN0 A;  1S72 P;  2JR8 A;  5E79 H;  2E75 D;  1LWU C;  1KQF B;  3CX5 D;  4C7N B;  1KIL C;  1LT1 A;  2WPS A;  2XKM A;  3EFF K;  2Z5I A;  2YFL A;  4TLF A;  2FKW B;  3RK3 C;  1WMK A;  2WPR A;  3AE7 C;  3CCE P;  1P84 E;  4L75 A;  5AVR B;  3AE9 C;  1KQL A;  1SQQ G;  1L0N D;  3QWO C;  3UIA A;  2PRR A;  4C7R A;  1URQ D;  1LNQ A;  4IFD K;  1JM0 A;  1L0N J;  3GHG A;  2A06 G;  5BOK A;  2OYH C;  1QLE D;  1X9V A;  5CCG D;  3EN1 A;  1NKN A;  1KIL A;  4GDO A;  2AXC A;  1RF1 A;  3CCQ P;  3CCL P;  1PGJ A;  1L4A B;  3CXH H;  5AVZ B;  3BAT A;  2KP8 A;  4O9B A;  2YIU C;  3M0A A;  2GBX A;  3PJS K;  5AW3 B;  1YTZ I;  2KI7 B;  5TIS E;  2FYU G;  2HMM A;  1L0N G;  3LW5 H;  2BMO A;  1GMJ A;  4D6T D;  5AVY B;  5K5G B;  4GOD A;  3WUV A;  2O01 H;  1XTG B;  3K5B A;  2A06 D;  4OWF A;  3GMA A;  3L70 E;  3RK2 B;  1OWA A;  1Q90 D;  1W5C E;  1A02 F;  3WU2 E;  1KC8 Q;  1SQV G;  1AFO A;  2IBZ G;  3TF5 A;  4Z1M H;  1O7N A;  4PD4 I;  2B87 B;  2RMZ A;  4PV1 C;  4U3F J;  3RBX A;  2Y0C A;  1ZN5 A;  1Y8A A;  4U3F E;  1PP9 J;  1ZV8 A;  1K8A Q;  1KOR A;  4WY4 B;  1QL2 A;  2QSI A;  3VMA A;  1NO4 A;  1HJ0 A;  1VQK P;  2BMR A;  3N0Q A;  5APU A;  1FZC C;  1T6A A;  1SJG A;  1UIX A;  3U59 A;  1NTM K;  4IFF A;  3A7O A;  2P7J A;  1ZR2 A;  5CCH C;  2XSH A;  4I7Z B;  1FDM A;  5CJ4 A;  1KIL B;  1LWU A;  2ZYA A;  1YJ9 P;  5AW7 B;  3CD6 P;  3L71 E;  4U7J A;  4HJG H;  1NTM G;  2XR8 A;  1L0N K;  2XRX A;  1M1J A;  3U1A A;  4W80 A;  3GTS A;  2A45 H;  1GU4 A;  4M3L A;  1T2K D;  1NTM E;  2YFI A;  1EDL A;  5AW0 B;  1IC2 A;  4QDF B;  3CWB E;  3H1J D;  5APX A;  3VP8 A;  1MUU A;  3CWB J;  5KLV E;  4Y99 C;  2E76 C;  4HH2 A;  4BXL A;  2M0B A;  3AE2 C;  3VMY A;  3SWY A;  2C0X A;  2XZR A;  3TGU D;  4Y28 J;  4N6J A;  1SQB D;  1SQQ D;  3M0D A;  3C8V A;  1LJ2 A;  2XNX A;  2NPS B;  2OTL P;  1S5L H;  5CCH D;  1BE3 D;  2WSE H;  3CCU P;  3B71 A;  4HM8 A;  3II6 A;  2PP6 A;  5APY A;  2KIK A;  2LKM A;  1VF5 C;  2IYP A;  1KMI Z;  1NH4 A;  1KQG B;  3H1J G;  1EQ7 A;  4ZMD A;  2L5G B;  1RF0 C;  3AEF C;  3H1I G;  1PPJ E;  3P32 A;  5AEW A;  1G1J A;  3RK2 D;  3RK2 C;  1MV8 A;  2E4P A;  2QJP C;  5BU5 A;  4AAY B;  4H44 B;  3MGN A;  4HM7 A;  3H1L J;  4H13 B;  2ZAE B;  1NTM D;  4EYY Q;  3WMM 0;  1DIP A;  2QVA A;  5AVU B;  3PLN A;  1PPJ G;  2RKL A;  3C0D A;  1NJI Q;  1PIX A;  2FBW C;  1D7M A;  2QM8 A;  2HMO A;  5KLI B;  3VP9 A;  4NPE A;  3CXH I;  3P8C E;  4YPC A;  2IDB A;  1ZP0 C;  2JKV A;  1JTH A;  2KLV A;  3AEG C;  4L74 A;  5B66 H;  3A0H H;  1BSH A;  1EDI A;  2ZVO B;  1OFC X;  2O01 J;  1LTS C;  3H1H E;  1O7H A;  2Z5H A;  1RF0 A;  1AQT A;  1NGM B;  1M1K Q;  4ASV A;  3L74 J;  1SLQ A;  1SQB K;  3VYI A;  5DJT B;  1N2D C;  1IFI A;  4YTP C;  3B8E B;  3L72 D;  3G9R A;  4LGD E;  2P10 A;  3AZC A;  4HM2 A;  3H32 B;  4U3F G;  3IN6 A;  3L75 D;  3L70 J;  1FS0 E;  5CBN A;  1U57 A;  3VMZ A;  1JOC A;  2YKO A;  1NOH A;  4DT0 A;  5KKZ B;  3PH0 A;  1JY2 P;  5CXM A;  4N78 E;  2WT7 B;  2XND H;  1RY3 A;  2E74 C;  1P84 D;  5AW6 B;  1X0T A;  1N7S C;  4DJG A;  1GTW A;  2P58 A;  1M1J B;  3S1K A;  1CW5 A;  1Q86 Q;  5AW9 B;  3M9B A;  3AEB C;  3Q5P A;  4ASW A;  3KHU A;  1RE3 C;  3T97 B;  1RQV A;  3L73 G;  4WY4 D;  1BDD A;  2ZXE B;  2WSS H;  2WPV B;  2QJK B;  3OA7 A;  4XFJ A;  1R5L A;  3EQ2 A;  3GOB A;  3VMI D;  2WPQ A;  2ZJS E;  2CPB A;  1NTZ G;  1FZE A;  5AVQ B;  1YIJ P;  2NVG A;  1SQX G;  4XE5 B;  1X8Y A;  2A45 I;  1FBM A;  1EDK A;  3FWL A;  1AJY A;  5AW8 B;  2ZT9 D;  3TGU J;  3B5N D;  3EWK A;  1SQB E;  2O1K A;  4LC1 A;  3GB4 A;  4ZNC A;  2J5U A;  1SQQ E;  1O7G A;  1S2E A;  2FFD C;  1M7L A;  5GTI E;  3N4X A;  3O8Z A;  3L75 E;  4L73 A;  4KJM A;  2G8Y A; 
#chains in the Genus database with same CATH homology
 2E75 D;  1O7N A;  3GZX A;  2BMQ A;  2QPZ A;  1L0N E;  4HM4 A;  1NTZ E;  3H1H E;  1O7H A;  2B1X A;  2HMK A;  2B24 A;  4HM0 A;  1VF5 D;  2NVF A;  4NBF D;  2FYN C;  1PP9 E;  3L74 E;  4U3F E;  2HML A;  1KYO E;  2YFL A;  1L0L E;  1UUV A;  1NTK E;  2NWF A;  4QUP A;  4HM1 A;  2YVJ B;  1P84 E;  3H1K E;  4HJL A;  2BMR A;  2D2C D;  2GBW A;  3D89 A;  3N0Q A;  3VMG D;  4HM3 A;  3AZC A;  4HM2 A;  1ULI A;  1SJG A;  3H1I E;  1G8J B;  1Q90 C;  3FOU A;  1SQX E;  1G8K B;  2E4Q A;  1O7P A;  5KLI C;  5AEU A;  2E76 D;  1FQT A;  5BOK A;  1WQL A;  2JO6 A;  2XSH A;  2QJK C;  4NB9 D;  1PPJ E;  4QDD A;  5AEW A;  3L72 E;  4QDF A;  3EN1 A;  4H13 D;  5CXM A;  3VCA A;  4PV1 D;  1SQV E;  3GKE A;  4OGQ D;  3L71 E;  2E4P A;  2NVE A;  2QJP C;  4AAY B;  4EMJ B;  4HM5 A;  1JM1 A;  4HM7 A;  1NDO A;  1VCK A;  2XR8 A;  2XRX A;  4P1B H;  2IBZ E;  2DE7 D;  5KKZ C;  2CKF A;  3GTS A;  2NUM A;  1NU1 E;  2FYU E;  3L73 E;  2YFJ A;  3DQY A;  2HMJ A;  3GCE A;  2YIU C;  4NBE D;  2I7F A;  1NTM E;  2YFI A;  3VMH D;  4H44 D;  1NYK A;  2GBX A;  4NBD D;  4QCK A;  2JZA A;  3C0D A;  1KB9 E;  2BCC E;  3CXH E;  4QDF B;  1BGY E;  3CWB E;  3GZY A;  4NBB D;  4P1C H;  2ZYL A;  1BCC E;  2DE5 D;  2Q3W A;  2QJY C;  4HM6 A;  2HMM A;  2NUK A;  4NBC D;  3GOB A;  3VMI D;  5KLV E;  2HMO A;  4QUR A;  2BMO A;  3H1J E;  5HL4 A;  1EZV E;  1O7W A;  1VM9 A;  2A06 E;  1SQP E;  1BE3 E;  2DE6 D;  2NVG A;  3GTE A;  4QDC A;  2E74 D;  4AIV A;  3BCC E;  1RFS A;  1ZRT E;  4HM8 A;  3H1L E;  1UUW A;  3L70 E;  2HMN A;  4PD4 E;  3TGU E;  2XSO A;  2ZT9 D;  4HKV A;  1SQB E;  3EQQ A;  3GB4 A;  4NBA D;  4NB8 D;  1SQQ E;  3VCP A;  1O7G A;  1RIE A;  3GL2 A;  4H0L D;  4QUQ A;  4NBH D;  3GL0 A;  1EG9 A;  1ULJ A;  4NBG D;  3CX5 E;  4D6T E;  1O7M A;  3L75 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...