1BCCE

Cytochrome bc1 complex from chicken
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 44
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1bccE02
3AZCA 1P84E 2HMLA 2YIUC 1PP9E 2QJKC 4QUQA 3EQQA 4HM0A 4QDFB 4H0LD 3L71E 3L70E 4HKVA 2NVEA 2E75D 3FOUA 1NDOA 1O7GA 3GB4A 4QUPA 4U3FE 4NBHD 3VMID 1BGYE 4P1CH 3TGUE 1NTME 1NU1E 1O7NA 5KLIC 2ZYLA 1NTKE 3L72E 2XR8A 1L0LE 1WQLA 3DQYA 4NB9D 1RFSA 1SQVE 4H13D 4QDFA 3C0DA 2DE6D 3EN1A 4NB8D 4P1BH 5KLVE 4QCKA 3BCCE 4H44D 4NBAD 1PPJE 3VMGD 2BCCE 1Q90C 4HM3A 3VCAA 2GBXA 1KYOE 2YFJA 1BE3E 1L0NE 3CWBE 4HJLA 5AEWA 2I7FA 3CX5E 3L74E 3GCEA 4PD4E 1NTZE 2BMOA 2HMNA 4HM5A 1O7HA 3GL2A 2NUMA 3GL0A 4AIVA 2BMRA 2B24A 4HM6A 1ULIA 4NBCD 4D6TE 2D2CD 4NBDD 1NYKA 1SJGA 1VCKA 2YFIA 3H1LE 4HM1A 2Q3WA 1SQBE 4PV1D 3GTSA 2HMJA 4HM4A 1SQXE 1JM1A 2GBWA 2XSOA 2JZAA 5HL4A 4NBED 4NBGD 1FQTA 2YFLA 1UUVA 3GKEA 2E74D 3H1JE 2ZT9D 3VCPA 4AAYB 4NBFD 2NWFA 4QURA 5BOKA 1O7PA 2HMMA 3GZXA 4HM2A 3L73E 4QDCA 3N0QA 3H1IE 2QJPC 2XRXA 2E4QA 3GOBA 3H1KE 1VF5D 2XSHA 1EZVE 2CKFA 1VM9A 2BMQA 4NBBD 4HM7A 1SQPE 3D89A 3L75E 1ZRTE 4EMJB 2A06E 1ULJA 4QDDA 2NVGA 1SQQE 2FYNC 5AEUA 3GZYA 1KB9E 2QPZA 1RIEA 5KKZC 2NUKA 4OGQD 4HM8A 3CXHE 5CXMA 1EG9A 2DE5D 1BCCE 2IBZE 1O7WA 2E76D 2QJYC 1G8JB 1UUWA 2NVFA 1G8KB 3VMHD 2B1XA 1O7MA 2JO6A 2YVJB 3H1HE 2E4PA 2DE7D 3GTEA 2HMOA 2FYUE 2HMKA
chains in the Genus database with same CATH superfamily
1QL2A 2C9NY 4TT3H 1G2CB 3GB4A 1AVYA 3VMID 3D71A 4JYCA 2ZYLA 1FC2C 3H6PA 1GU4A 2GA1A 1T6AA 1T3UA 4L74A 1VPCA 1IZNB 1ZRTD 1LT9B 2K9YA 3GL2A 2H89C 1NTKG 1AA0A 2ZVNB 3WUUA 5B5EE 3BCCJ 3KZIE 1VQPP 2R3SA 1KFMA 3V4QA 1OMIA 3A0HH 1M7LA 3K5BA 2QJYB 3CCVP 3AEEC 5L8RJ 4IFFA 2M5AB 2QIWA 3RK2D 2WZ7A 5KLVG 2OYHB 3EFFK 4YTPC 3H1IJ 1H0TB 3FWLA 2ZFCA 2Q5UA 2R3CA 2POHA 1L4AB 4D6TD 1LJ2A 2XSHA 3HUSC 4IFMA 4EOTA 3E1RA 1BE3G 1SQBD 3B4SA 3A7OA 3MUDA 1S9KD 5KJ7C 1BE3D 3VMYA 1H88A 1L0LJ 1MUUA 2WSFJ 1HF9A 3TK1A 5KKZC 4WY4B 1YJ9P 1QVFO 3O6QB 3CXHE 3AEFC 1EG9A 2DE5D 3TGUG 2IBZE 2NPSC 2D2CB 2W6BA 1VQNP 2E75B 1VQ7P 1E79H 3PH0A 1VQ5P 1VQMP 4AUWA 2YKQA 1J1DC 1SQQG 3AZCA 5CJ4A 1PP9E 2QJKC 2C0WA 2OTJP 1M90Q 1JTHA 1JNMA 2K9JA 2R32A 1GL2C 4C46A 3Q5PA 1RE3A 4Y99C 2IZ0A 1PPJG 3KHUA 4GOFA 5CCHC 4KJMA 1NU1E 2XZRA 4PV1C 2JEEA 1L0LK 1HH0A 3CCJP 2M5AA 4H0LB 4P1BH 1PGPA 1L0NE 2Y9YA 1GMJA 3G3ZA 3SWYA 1L4AC 2W8ZA 3HTKA 4UB6E 2FFDA 1CI6A 1R5SA 3TNUB 1OVUA 1XTCC 2OTLP 3HRNA 1N73A 2YFIA 5CCGA 1T2KC 1AFOA 2IFMA 3BRVB 1S5LX 3P32A 4L73A 1EDLA 4GKGA 1YTZT 2FYUJ 2CK3H 3A3YB 5KLIB 3C8VA 3CMAP 2HODA 1EXJA 1FZCC 3VCPA 3GOBA 3HE5A 2JO1A 1NAFA 4W7YA 3C9IA 4PD4D 1NTZD 1FDIA 3S9OA 1FZAA 1IFNA 2E74B 2NVGA 1EDIA 4IL6X 1RE3C 3ITKA 3L73J 5KAIH 2O01H 2O1JA 2Y0EA 4Z1MH 1KYOD 2HYNA 1LTJC 2FYUE 1KTMA 3VMAA 3OA7A 3RL0g 2WSCJ 4HKZH 2XNXA 2RN0A 1YHQP 4N78D 2Q9IA 1URQC 3P8CE 4H0LD 1ZN5A 2N9YB 3H1KJ 3L74G 2XR8A 1NU1J 1GDTA 4C7NB 5APSA 2Z4EA 3MZWB 3PLNA 1D7MA 1KILE 3CCEP 2IPPA 2JDIH 2M3EA 2YNYA 3GW6A 4A7PA 2ZYGA 4NBCD 2C9LY 1NYKA 1BDDA 1Q90D 2E76B 3GTSA 4HM4A 2R5BA 4OGQC 1JM1A 1M1JC 2N1TC 2ZT9D 2OYHC 3T97A 2M0BA 5BOKA 2HMMA 4HM2A 4QDCA 2YXRB 3HE4B 1EZVE 4JBZA 1PV3A 1PPJD 1JY3O 2WQYC 3CC4P 2WSFH 3L75E 2KUBA 4QDDA 1JCDA 1NTKD 1RF1C 1SFCC 1GK6A 4OVNF 4PJ0E 1SQPK 1G1IA 2J5UA 1NVOA 2Q7CA 3I56P 1UUWA 1G8KB 1USDA 1JY3N 2E42A 1H89A 2PGDA 3M9BA 1DD3A 1IFMA 3AE7C 3GHGB 2QG4A 5CMZA 4XE5B 3FWNA 5AW9B 1NTME 3H1JJ 1DD4A 4DCKA 2IX7C 1PGQA 3WU2E 2YO3A 1S2EA 1LTAC 2FXMA 4MN4C 3CWBE 2P10A 4IL6H 1S1CX 4N78E 2FYZA 3A0BE 2JWDA 4I1LA 1IFIA 4Y99B 2IBZI 4ZKPA 2BEQD 3AEAC 5B66H 2MJZA 3WMM0 1NTZJ 3CXHI 3GHGA 5TISE 4Y28J 3PJSK 2XDJA 1K04A 1HWTC 1SQXJ 5HL4A 1RY3A 3C1LA 5TJHA 2HPCA 4NPDA 3AE6C 2WT7B 1RF0C 3F89A 4ZMDA 1SQQJ 4HJGH 1T3JA 4HM7A 5AEUA 5AW2B 2H43A 2KLUA 4D6TJ 1RQVA 1O7WA 3VMZA 1RQUA 3RK3E 4PD4I 3H1ID 3P7KA 2YVJB 3KZIH 4RO0A 4DT0A 3USSA 1JMMA 4QMAA 2YIUC 3V2RA 1N7SA 4IOIH 2CPSA 2P2UA 1NDOA 2KSJA 1BDCA 2N1TD 1FS0E 3BVHA 5KLIC 4NB9D 1M56D 3L36A 1RFSA 4UB8E 1ZMEC 3CCSP 1NTKJ 3U1CA 3MHVA 1BSHA 3H1HJ 5CCGD 1OZHA 3CMEP 2J59M 1BCCD 4DZOA 3SSUA 4HM3A 2Z5IA 4JPZB 3D6ZA 2QRXA 4PD4E 4TLFA 2JP3A 3CCRP 1P84D 2D2CD 4RESB 1SJGA 1L0NG 3H1LE 4LGDE 3JSVC 1Y8AA 4PJ0H 5H2FE 1HJ0A 3Q5SA 1UUVA 3FX0A 3GKEA 3G9RA 2OYIB 3VP9A 3FGAD 3CX5H 3H1IE 2AXTE 3HD7D 3I55P 4GODA 3HTKB 1KB9D 3Q5RA 3BCCD 2IFNA 1VM9A 2BMQA 2QE7H 1SVFA 2XKMA 1SQQE 4H13B 4YXWH 2MKVA 1IFPA 1GL2D 3NTNA 2DW3A 2FYUG 2NUKA 1JY2P 1OW8A 4PD4H 1Y9BA 1JMBA 1R5LA 2K9JB 2KZIA 1OWAA 1KQFB 3T97B 1IK9A 4KT0J 2O01N 1LTJB 2HMOA 2SPZA 1KYOI 5APTA 4ZKUA 2BCCD 3S4RA 5AW3B 1L0ND 1FAVA 4JYBA 2ZXXA 3V2QA 1PP9J 1MZ9A 1AJYA 1BCCG 5M1BA 2OYOA 4YXDC 2P7JA 4EI2A 3KQGA 2UWJE 5TISH 1S5LE 4QDFA 2E74C 4QCKA 3RK3D 1JOCA 2RMZA 5AVVB 1LTBC 2A45H 3RBZA 2H8PD 3NFQA 1L4AA 1QX8A 5CBOA 1ULIA 3H1KD 3MP7B 1K8AQ 1LT9C 5AVUB 2V7QJ 4I6MC 1NU1G 1LP1B 2KB7P 3H1LJ 1S5LH 1ZR4A 3AE1C 1SQQK 3E7KA 1J1EC 3R4YA 1W2BO 3QWOC 1KYOH 1Q81Q 2I1JA 3N0QA 1YJWP 3KDPB 4PV1B 1MFTA 3I5CA 1G1JA 5AVTB 4N6JA 1A02J 3CWBD 3O6QA 4H0LC 2QJPB 2A06E 2IBZG 1K9MQ 2FYNC 1U7MA 2YKOA 5AW5B 3RGUA 3H1JG 1LTJA 2B87A 4JF7A 1DEEG 4GIFA 1URQA 3CX5D 1O7MA 5APUA 2IDBA 3W68A 3H1JD 1OVRA 5GTHE 3FXDA 1FZBA 3CLQA 5BU5A 3L75G 1MKMA 1URQD 3RK2C 2FYNB 1O7NA 1E5WA 5BVZA 5GTIE 2N9BA 2C0XA 3HD7C 2OARA 5B5EH 1N2DC 1SQVK 3L4FA 2PAJA 3E1IA 3VMGD 3G6EP 1OIPA 2YO2A 4M3LA 5APQA 1EZVG 3EWKA 1SLQA 3L70J 3L71J 1NHLA 1NTZE 2HMNA 3L73G 1U57A 3QH9A 4D6TE 3ABVC 1OX3A 1H8AA 3NMDA 3U59A 1SQVG 1J1EB 2V7QH 2O1KA 2FYUK 4CPGA 1RF1A 1VF5D 1SFCB 4NPFX 3TNUA 1RF1B 4EDFA 2N1TB 5DJUB 5CCHD 2B9BA 1LTSC 1SQPE 1ZRTE 2CPBA 2KSEA 2K3RA 3L75J 1MV8A 1RE4A 5CBNA 4IL6E 1EXIA 3N7NA 1DH3A 2GUVA 4BXLA 1BGYG 4ZNCA 2JR8A 1ZV8A 3L75D 1H0TA 2E4PA 2FBWC 3VOPA 2WITA 2OTKE 1N7SD 4U3FJ 2AEFA 3RL0C 1NTZG 4HM0A 4H13C 1N8RQ 1JCCA 2KI7B 1VF5B 1SQXG 1HGZA 1GU5A 1OXZA 1X9VA 1EDKA 3C0DA 1X79B 4WY4A 2GM4A 2IBZD 4WBAA 1HVVA 3UIAA 3GF3A 1WT6A 3M9HA 5APVA 1KILB 1QLED 1SQVD 2GUSA 3IFMA 2ZJSE 3PHLA 2B87B 4U3FG 1VCKA 1L0LG 5AW1B 5AW0B 2M8RA 1RE4C 1S72P 3S1KA 1K73Q 3SWFA 2NZ2A 1VL2A 2A45G 1HJBA 1N73B 3BATA 2Y0DA 3GZXA 2XRXA 1NH4A 1HTLC 4ASWA 4HH2A 2CKFA 2H7HA 3CCUP 2WSEH 2OYIA 4EMJB 1ZXGA 1PP9G 3B5ND 4XA4A 4KHXA 1BCCE 1M1JA 2QA4P 2YIUB 3TGUD 1NTKK 1UIIA 3L73D 2ZXEB 1FZCB 5KAFE 3CCQP 1EZVD 1NTMD 3CWBJ 2FXPA 2W83C 2E75D 5KAFH 1Q7YQ 1AQ5A 1BGYE 3AE4C 1SFCA 1X22A 1NTMJ 3R2PA 4NB8D 1PL5A 1FZEA 2P58A 5APXA 5AVZB 4D6TG 3TGUJ 3H25A 4B86A 1BE3E 2QJKB 3CPWO 2Q1KA 3CC7P 3CX5E 4LC1A 2NUMA 3RL0B 1FBMA 3KYQA 1KB9I 2XSOA 1SQQD 5GTHH 4NBED 2W90A 3A0HE 2QJPC 2NPSB 4JQ0D 3AE8C 4R4LA 3KPEA 2HPCB 4WY4C 3D89A 3PP5A 2QM7A 2E5YA 3RK3B 3H32A 3M06A 1R8EA 3GHGC 1FOSE 1NGMB 2V4HA 5CXMA 1SQPG 1P84H 2ZYDA 3HE5B 2PP6A 4WWIA 1AQTA 2QJYC 1G8JB 1S9KE 3H1HE 1LT1A 5DJTB 1ZR2A 1NWQA 1EDJA 4QUQA 1SQBJ 4HKVA 4ASVA 4IFDK 4P1CH 3CD6P 1YBKA 2WWWA 2NPSD 5E79E 3L74D 1W2EA 1JY2O 4L75A 4NBAD 2BCCE 1SQPJ 3RK3C 2J58A 5E79H 2KNCB 3L72G 3F5HA 3L35A 4HM5A 2Y0CA 3MIWA 3GMAA 3OW2O 2FFDB 3M0AA 4I2LC 1JY2N 4PV1D 3LW5H 4WB4A 1MFZA 1PIXA 1L2PA 3RBXA 1XTGB 2H88C 5CHXA 2E43A 3AEGC 3HE4A 3TYYA 2FXOA 5KJ7A 4R4MA 1KZUB 1YITP 1ULJA 1YQ3C 2ZVOB 3JCUH 1LP1A 3L71D 3L70D 1NKNA 1JM0A 4RJTA 5KJ7D 3H1IG 4LLHA 4BWNA 3SWKA 3EN1A 5AW6B 3AEDC 2KK7A 3LW5J 1NU1D 3B5NA 2W6JH 4YPCA 3L71E 3L70E 1BCCJ 2NVEA 3PTZA 2WSEJ 1LWUA 3TSIA 2M3BA 3PRJA 3AE3C 1JB0J 4AQRD 3DQYA 3SFDC 1QL1A 1WMKA 2P67A 4OWFA 3VCAA 3IAOA 2FY8A 5AEWA 2IYPA 3WU2H 2P1JA 2BMRA 1PZQA 3M0DA 2Q3WA 1SQBE 4UB8H 3BRTB 2BCCG 2K88A 3CCMP 2KS1A 2WPRA 2Q6QA 3Q1MA 3M9QA 1LTGC 4HYTB 3LIEA 1GK4A 2FYUD 1Q82Q 4NBBD 3P8CD 2PFXA 1IO4A 3IR9A 2ZAEB 4GDOA 2R5DA 5KLVK 3B71A 1IFDA 2XV5A 2ZT9C 2HLOA 1KQLA 1A02F 5AVXB 2YMKA 3A5TA 3GTEA 2ZT9B 3EQQA 4QDFB 3FOUA 1SP4A 4U3FE 2N1TA 5KKZB 2WSSH 1OW7A 3OAKA 2HG5D 1IK7A 2HFED 1WQLA 1KQSO 3V2NA 2WPVB 3HUSB 2WSCH 3L70G 3L71G 3HUSA 3H1LD 4NPEA 1VQ9P 3GL0A 2I1KA 2B24A 1FJKA 5H2FH 3AEBC 2BEZF 1KORA 3TDKA 3BCCG 4I7ZC 1FU1A 1FZCA 1FE6A 2G3AA 1ZP0C 1GZLA 1S4XA 1YTZI 2WVRA 2HR3A 2WT7A 3CWBG 1VQ6P 1DX7A 1L0NJ 1VDFA 1ZOYC 5APWA 1KFNA 1GL2A 5AVWB 1T8ZA 1KB9E 3ZDMA 1KV4A 1M8OB 1W5CE 4HM8A 3VYIA 1KN7A 2O3JA 2BASA 2W6AA 2AXCA 1HGVA 5CCGC 4U7JA 3CX5I 2W27A 4U3FD 5AVRB 1QEXA 3CXHD 1FJPA 3AE2C 1J1DB 2HMKA 1RF0A 3CL3D 3IF4A 3LIDA 1O7GA 5AW8B 2D2CC 3MTUE 4NBHD 5AW7B 3CC2P 3H1LG 1L4AD 4H44C 4H13D 5KLVE 4H44D 1PPJE 1X0TA 1Z56A 1G2CA 4EIJA 4N3YB 1CZQA 2GBXA 1IJDB 4L76A 3AE9C 2I7FA 1SQBG 3L74E 2JKVA 3Q2YA 2O01J 2VRSA 1O7HA 2Y9ZA 1M57D 1CI6B 2WMMA 4GT1A 3L72D 1HUCA 1N7SC 4C7NA 2QSIA 1EQ7A 2I8DA 3L73E 2XNDH 3EFGA 3CCLP 3L72J 2KLVA 4I7ZB 4GOEA 1KQGB 5CCHA 2KNCA 1GTWA 2RKLA 5KAIE 3BASA 1DIPA 1X8YA 4RKUJ 1NYHA 5KTBA 2PRRA 3MD0A 3VMXA 2NVFA 5B66E 2RH0A 3MGNA 1LGHB 1N73C 3M91A 2KS1B 3B5NC 1JO5A 1BE3J 5AW4B 4HB1A 1S3JA 3FXEA 2KZJA 3G71P 2WPSA 3EQ2A 2Q3IA 1U7JA 1YIJP 2E5TA 1NOHA 3HD7B 1SQVJ 4W80A 3TF5A 3H1HG 4BRYB 2HODB 2B88A 2K1AA 5AVSB 3H32B 2DE6D 2OYHA 1GL2B 1PP9D 3AE5C 5CJ0A 1Q90C 1SQXD 5KLVJ 2YKPA 5C39A 4H44B 1Q2NA 2OGUA 4AIVA 3M0DC 4NBDD 1GW3A 1VF5C 1L0NK 2WTYA 1K05A 1PGOA 1VQ4P 1EC5A 3GG2A 2GBWA 2AEJA 4DJGA 2FFDC 1VQ8P 4NBGD 2YFLA 1J2JB 3U1AA 1UIXA 2E74D 3H1JE 2KP8A 3O8ZA 4QURA 1L0LD 2QVAA 4BRYA 1EZVI 2ITAA 2E4QA 4DOJA 2E75C 2YMYA 3HD7A 1URQB 5EFWB 1VQLP 3L37A 1KILA 3VP8A 3H1KG 1NTMK 2Q3EA 3L74J 2LXCB 4WVZA 1T2KD 1RIEA 3A2AA 3RL0D 1FZFA 3CI9A 1JY3P 1SS1A 4EYYQ 1NO4A 2BCCJ 1LWUB 2B1XA 4C7RA 2DE7D 3WUTA 1P84E 2L91A 1OFCX 5GTIH 3Q3DA 1PFIA 2ZYAA 3P8MC 4QUPA 2QEXP 3D70A 2B89A 3TGUE 2LXBA 4AYCA 2QM8A 1LWUC 2A06D 1AV1A 4OH8B 2IYOA 2NRGA 1OVVA 1SQVE 3B8EB 3W67A 1JTHB 1KMIZ 3GF7A 3BCCE 4WY4D 4OGQB 1JEKA 1FZGA 1BGYJ 1KD1Q 3JCUE 4HJLA 2E76C 3GCEA 1QVGO 2BMOA 4HM6A 1SQXK 5K5GB 2G8YA 3JC22 1LNQA 2KOGA 5AVQB 4HM1A 1LTIC 5BU8B 1NTZK 3AECC 1KILD 1FDMA 2L5GB 1RH5B 2LR2A 3GLMA 1FQTA 1KILC 3CXHH 3WUVA 2OYIC 2KYVA 3VN0A 1VQKP 2NWFA 1O7PA 3IN6A 3V5BA 1CW5A 2XU6A 1DEBA 3OJAB 3H1HD 2AXTH 3KXDA 2K37A 2FKWB 2QPZA 4OGQD 1FDOA 1N7LA 1OW6A 1GW4A 2A45I 1PGJA 3V2PA 5KLVD 1YI2P 2JO6A 3B5NB 2Z5HA 2HMLA 1BSNA 3VTPC 2KXPB 1P84I 1SQBK 1SFCD 3A0BH 3SFEC 4XFJA 2YXQB 4K3AA 1NTKE 3L72E 1L0LE 3II6A 2LKMA 3MUDC 1USEA 4W7ZA 1AVOA 1YQ4C 1KYOE 4K35A 2YFJA 3V6IA 2JJLA 3G4SP 1IC2A 1TU3F 3NXSA 1N86A 1HBWA 2JWAA 2NPSA 1BGYD 1ZW0A 1NTMG 2HMJA 5APYA 3RK2B 1SQXE 1WRGA 1FOSF 2JZAA 1N7SB 1NAYA 5AVYB 1YYCA 4NBFD 4AAYB 1IFJA 1GD2E 1ZLLA 2OQQA 1QGKB 1LTTC 2A06G 3H1KE 1M1JB 4UB6H 2AEMA 1Y47A 2R44A 2KIKA 3V4WA 1KC8Q 1NU1K 3GZYA 1YJNP 1NJIQ 1RHZB 1SQPD 1NKZB 2IZ1A 3N4XA 1M1KQ 4O9BA 1CSBA 1KB9H 2E76D 1JUNA 1Q86Q 1LT9A 3D6YA 3VMHD 2WPQA 1VQOP
chains in the Genus database with same CATH topology
3AZCA 1P84E 2HMLA 2YIUC 1PP9E 2QJKC 4QUQA 3EQQA 4HM0A 4QDFB 4H0LD 3L71E 3L70E 4HKVA 2NVEA 2E75D 3FOUA 1NDOA 1O7GA 3GB4A 4QUPA 4U3FE 4NBHD 3VMID 1BGYE 4P1CH 3TGUE 1NTME 1NU1E 1O7NA 5KLIC 2ZYLA 1NTKE 3L72E 2XR8A 1L0LE 1WQLA 3DQYA 4NB9D 1RFSA 1SQVE 4H13D 4QDFA 3C0DA 2DE6D 3EN1A 4NB8D 4P1BH 5KLVE 4QCKA 3BCCE 4H44D 4NBAD 1PPJE 3VMGD 2BCCE 1Q90C 4HM3A 3VCAA 2GBXA 1KYOE 2YFJA 1BE3E 1L0NE 3CWBE 4HJLA 5AEWA 2I7FA 3CX5E 3L74E 3GCEA 4PD4E 1NTZE 2BMOA 2HMNA 4HM5A 1O7HA 3GL2A 2NUMA 3GL0A 4AIVA 2BMRA 2B24A 4HM6A 1ULIA 4NBCD 4D6TE 2D2CD 4NBDD 1NYKA 1SJGA 1VCKA 2YFIA 3H1LE 4HM1A 2Q3WA 1SQBE 4PV1D 3GTSA 2HMJA 4HM4A 1SQXE 1JM1A 2GBWA 2XSOA 2JZAA 5HL4A 4NBED 4NBGD 1FQTA 2YFLA 1UUVA 3GKEA 2E74D 3H1JE 2ZT9D 3VCPA 4AAYB 4NBFD 2NWFA 4QURA 5BOKA 1O7PA 2HMMA 3GZXA 4HM2A 3L73E 4QDCA 3N0QA 3H1IE 2QJPC 2XRXA 2E4QA 3GOBA 3H1KE 1VF5D 2XSHA 1EZVE 2CKFA 1VM9A 2BMQA 4NBBD 4HM7A 1SQPE 3D89A 3L75E 1ZRTE 4EMJB 2A06E 1ULJA 4QDDA 2NVGA 1SQQE 2FYNC 5AEUA 3GZYA 1KB9E 2QPZA 1RIEA 5KKZC 2NUKA 4OGQD 4HM8A 3CXHE 5CXMA 1EG9A 2DE5D 1BCCE 2IBZE 1O7WA 2E76D 2QJYC 1G8JB 1UUWA 2NVFA 1G8KB 3VMHD 2B1XA 1O7MA 2JO6A 2YVJB 3H1HE 2E4PA 2DE7D 3GTEA 2HMOA 2FYUE 2HMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZC A;  1P84 E;  2HML A;  2YIU C;  1PP9 E;  2QJK C;  4QUQ A;  3EQQ A;  4HM0 A;  4QDF B;  4H0L D;  3L71 E;  3L70 E;  4HKV A;  2NVE A;  2E75 D;  3FOU A;  1NDO A;  1O7G A;  3GB4 A;  4QUP A;  4U3F E;  4NBH D;  3VMI D;  1BGY E;  4P1C H;  3TGU E;  1NTM E;  1NU1 E;  1O7N A;  5KLI C;  2ZYL A;  1NTK E;  3L72 E;  2XR8 A;  1L0L E;  1WQL A;  3DQY A;  4NB9 D;  1RFS A;  1SQV E;  4H13 D;  4QDF A;  3C0D A;  2DE6 D;  3EN1 A;  4NB8 D;  4P1B H;  5KLV E;  4QCK A;  3BCC E;  4H44 D;  4NBA D;  1PPJ E;  3VMG D;  2BCC E;  1Q90 C;  4HM3 A;  3VCA A;  2GBX A;  1KYO E;  2YFJ A;  1BE3 E;  1L0N E;  3CWB E;  4HJL A;  5AEW A;  2I7F A;  3CX5 E;  3L74 E;  3GCE A;  4PD4 E;  1NTZ E;  2BMO A;  2HMN A;  4HM5 A;  1O7H A;  3GL2 A;  2NUM A;  3GL0 A;  4AIV A;  2BMR A;  2B24 A;  4HM6 A;  1ULI A;  4NBC D;  4D6T E;  2D2C D;  4NBD D;  1NYK A;  1SJG A;  1VCK A;  2YFI A;  3H1L E;  4HM1 A;  2Q3W A;  1SQB E;  4PV1 D;  3GTS A;  2HMJ A;  4HM4 A;  1SQX E;  1JM1 A;  2GBW A;  2XSO A;  2JZA A;  5HL4 A;  4NBE D;  4NBG D;  1FQT A;  2YFL A;  1UUV A;  3GKE A;  2E74 D;  3H1J E;  2ZT9 D;  3VCP A;  4AAY B;  4NBF D;  2NWF A;  4QUR A;  5BOK A;  1O7P A;  2HMM A;  3GZX A;  4HM2 A;  3L73 E;  4QDC A;  3N0Q A;  3H1I E;  2QJP C;  2XRX A;  2E4Q A;  3GOB A;  3H1K E;  1VF5 D;  2XSH A;  1EZV E;  2CKF A;  1VM9 A;  2BMQ A;  4NBB D;  4HM7 A;  1SQP E;  3D89 A;  3L75 E;  1ZRT E;  4EMJ B;  2A06 E;  1ULJ A;  4QDD A;  2NVG A;  1SQQ E;  2FYN C;  5AEU A;  3GZY A;  1KB9 E;  2QPZ A;  1RIE A;  5KKZ C;  2NUK A;  4OGQ D;  4HM8 A;  3CXH E;  5CXM A;  1EG9 A;  2DE5 D;  1BCC E;  2IBZ E;  1O7W A;  2E76 D;  2QJY C;  1G8J B;  1UUW A;  2NVF A;  1G8K B;  3VMH D;  2B1X A;  1O7M A;  2JO6 A;  2YVJ B;  3H1H E;  2E4P A;  2DE7 D;  3GTE A;  2HMO A;  2FYU E;  2HMK A; 
#chains in the Genus database with same CATH topology
 1QL2 A;  2C9N Y;  4TT3 H;  1G2C B;  3GB4 A;  1AVY A;  3VMI D;  3D71 A;  4JYC A;  2ZYL A;  1FC2 C;  3H6P A;  1GU4 A;  2GA1 A;  1T6A A;  1T3U A;  4L74 A;  1VPC A;  1IZN B;  1ZRT D;  1LT9 B;  2K9Y A;  3GL2 A;  2H89 C;  1NTK G;  1AA0 A;  2ZVN B;  3WUU A;  5B5E E;  3BCC J;  3KZI E;  1VQP P;  2R3S A;  1KFM A;  3V4Q A;  1OMI A;  3A0H H;  1M7L A;  3K5B A;  2QJY B;  3CCV P;  3AEE C;  5L8R J;  4IFF A;  2M5A B;  2QIW A;  3RK2 D;  2WZ7 A;  5KLV G;  2OYH B;  3EFF K;  4YTP C;  3H1I J;  1H0T B;  3FWL A;  2ZFC A;  2Q5U A;  2R3C A;  2POH A;  1L4A B;  4D6T D;  1LJ2 A;  2XSH A;  3HUS C;  4IFM A;  4EOT A;  3E1R A;  1BE3 G;  1SQB D;  3B4S A;  3A7O A;  3MUD A;  1S9K D;  5KJ7 C;  1BE3 D;  3VMY A;  1H88 A;  1L0L J;  1MUU A;  2WSF J;  1HF9 A;  3TK1 A;  5KKZ C;  4WY4 B;  1YJ9 P;  1QVF O;  3O6Q B;  3CXH E;  3AEF C;  1EG9 A;  2DE5 D;  3TGU G;  2IBZ E;  2NPS C;  2D2C B;  2W6B A;  1VQN P;  2E75 B;  1VQ7 P;  1E79 H;  3PH0 A;  1VQ5 P;  1VQM P;  4AUW A;  2YKQ A;  1J1D C;  1SQQ G;  3AZC A;  5CJ4 A;  1PP9 E;  2QJK C;  2C0W A;  2OTJ P;  1M90 Q;  1JTH A;  1JNM A;  2K9J A;  2R32 A;  1GL2 C;  4C46 A;  3Q5P A;  1RE3 A;  4Y99 C;  2IZ0 A;  1PPJ G;  3KHU A;  4GOF A;  5CCH C;  4KJM A;  1NU1 E;  2XZR A;  4PV1 C;  2JEE A;  1L0L K;  1HH0 A;  3CCJ P;  2M5A A;  4H0L B;  4P1B H;  1PGP A;  1L0N E;  2Y9Y A;  1GMJ A;  3G3Z A;  3SWY A;  1L4A C;  2W8Z A;  3HTK A;  4UB6 E;  2FFD A;  1CI6 A;  1R5S A;  3TNU B;  1OVU A;  1XTC C;  2OTL P;  3HRN A;  1N73 A;  2YFI A;  5CCG A;  1T2K C;  1AFO A;  2IFM A;  3BRV B;  1S5L X;  3P32 A;  4L73 A;  1EDL A;  4GKG A;  1YTZ T;  2FYU J;  2CK3 H;  3A3Y B;  5KLI B;  3C8V A;  3CMA P;  2HOD A;  1EXJ A;  1FZC C;  3VCP A;  3GOB A;  3HE5 A;  2JO1 A;  1NAF A;  4W7Y A;  3C9I A;  4PD4 D;  1NTZ D;  1FDI A;  3S9O A;  1FZA A;  1IFN A;  2E74 B;  2NVG A;  1EDI A;  4IL6 X;  1RE3 C;  3ITK A;  3L73 J;  5KAI H;  2O01 H;  2O1J A;  2Y0E A;  4Z1M H;  1KYO D;  2HYN A;  1LTJ C;  2FYU E;  1KTM A;  3VMA A;  3OA7 A;  3RL0 g;  2WSC J;  4HKZ H;  2XNX A;  2RN0 A;  1YHQ P;  4N78 D;  2Q9I A;  1URQ C;  3P8C E;  4H0L D;  1ZN5 A;  2N9Y B;  3H1K J;  3L74 G;  2XR8 A;  1NU1 J;  1GDT A;  4C7N B;  5APS A;  2Z4E A;  3MZW B;  3PLN A;  1D7M A;  1KIL E;  3CCE P;  2IPP A;  2JDI H;  2M3E A;  2YNY A;  3GW6 A;  4A7P A;  2ZYG A;  4NBC D;  2C9L Y;  1NYK A;  1BDD A;  1Q90 D;  2E76 B;  3GTS A;  4HM4 A;  2R5B A;  4OGQ C;  1JM1 A;  1M1J C;  2N1T C;  2ZT9 D;  2OYH C;  3T97 A;  2M0B A;  5BOK A;  2HMM A;  4HM2 A;  4QDC A;  2YXR B;  3HE4 B;  1EZV E;  4JBZ A;  1PV3 A;  1PPJ D;  1JY3 O;  2WQY C;  3CC4 P;  2WSF H;  3L75 E;  2KUB A;  4QDD A;  1JCD A;  1NTK D;  1RF1 C;  1SFC C;  1GK6 A;  4OVN F;  4PJ0 E;  1SQP K;  1G1I A;  2J5U A;  1NVO A;  2Q7C A;  3I56 P;  1UUW A;  1G8K B;  1USD A;  1JY3 N;  2E42 A;  1H89 A;  2PGD A;  3M9B A;  1DD3 A;  1IFM A;  3AE7 C;  3GHG B;  2QG4 A;  5CMZ A;  4XE5 B;  3FWN A;  5AW9 B;  1NTM E;  3H1J J;  1DD4 A;  4DCK A;  2IX7 C;  1PGQ A;  3WU2 E;  2YO3 A;  1S2E A;  1LTA C;  2FXM A;  4MN4 C;  3CWB E;  2P10 A;  4IL6 H;  1S1C X;  4N78 E;  2FYZ A;  3A0B E;  2JWD A;  4I1L A;  1IFI A;  4Y99 B;  2IBZ I;  4ZKP A;  2BEQ D;  3AEA C;  5B66 H;  2MJZ A;  3WMM 0;  1NTZ J;  3CXH I;  3GHG A;  5TIS E;  4Y28 J;  3PJS K;  2XDJ A;  1K04 A;  1HWT C;  1SQX J;  5HL4 A;  1RY3 A;  3C1L A;  5TJH A;  2HPC A;  4NPD A;  3AE6 C;  2WT7 B;  1RF0 C;  3F89 A;  4ZMD A;  1SQQ J;  4HJG H;  1T3J A;  4HM7 A;  5AEU A;  5AW2 B;  2H43 A;  2KLU A;  4D6T J;  1RQV A;  1O7W A;  3VMZ A;  1RQU A;  3RK3 E;  4PD4 I;  3H1I D;  3P7K A;  2YVJ B;  3KZI H;  4RO0 A;  4DT0 A;  3USS A;  1JMM A;  4QMA A;  2YIU C;  3V2R A;  1N7S A;  4IOI H;  2CPS A;  2P2U A;  1NDO A;  2KSJ A;  1BDC A;  2N1T D;  1FS0 E;  3BVH A;  5KLI C;  4NB9 D;  1M56 D;  3L36 A;  1RFS A;  4UB8 E;  1ZME C;  3CCS P;  1NTK J;  3U1C A;  3MHV A;  1BSH A;  3H1H J;  5CCG D;  1OZH A;  3CME P;  2J59 M;  1BCC D;  4DZO A;  3SSU A;  4HM3 A;  2Z5I A;  4JPZ B;  3D6Z A;  2QRX A;  4PD4 E;  4TLF A;  2JP3 A;  3CCR P;  1P84 D;  2D2C D;  4RES B;  1SJG A;  1L0N G;  3H1L E;  4LGD E;  3JSV C;  1Y8A A;  4PJ0 H;  5H2F E;  1HJ0 A;  3Q5S A;  1UUV A;  3FX0 A;  3GKE A;  3G9R A;  2OYI B;  3VP9 A;  3FGA D;  3CX5 H;  3H1I E;  2AXT E;  3HD7 D;  3I55 P;  4GOD A;  3HTK B;  1KB9 D;  3Q5R A;  3BCC D;  2IFN A;  1VM9 A;  2BMQ A;  2QE7 H;  1SVF A;  2XKM A;  1SQQ E;  4H13 B;  4YXW H;  2MKV A;  1IFP A;  1GL2 D;  3NTN A;  2DW3 A;  2FYU G;  2NUK A;  1JY2 P;  1OW8 A;  4PD4 H;  1Y9B A;  1JMB A;  1R5L A;  2K9J B;  2KZI A;  1OWA A;  1KQF B;  3T97 B;  1IK9 A;  4KT0 J;  2O01 N;  1LTJ B;  2HMO A;  2SPZ A;  1KYO I;  5APT A;  4ZKU A;  2BCC D;  3S4R A;  5AW3 B;  1L0N D;  1FAV A;  4JYB A;  2ZXX A;  3V2Q A;  1PP9 J;  1MZ9 A;  1AJY A;  1BCC G;  5M1B A;  2OYO A;  4YXD C;  2P7J A;  4EI2 A;  3KQG A;  2UWJ E;  5TIS H;  1S5L E;  4QDF A;  2E74 C;  4QCK A;  3RK3 D;  1JOC A;  2RMZ A;  5AVV B;  1LTB C;  2A45 H;  3RBZ A;  2H8P D;  3NFQ A;  1L4A A;  1QX8 A;  5CBO A;  1ULI A;  3H1K D;  3MP7 B;  1K8A Q;  1LT9 C;  5AVU B;  2V7Q J;  4I6M C;  1NU1 G;  1LP1 B;  2KB7 P;  3H1L J;  1S5L H;  1ZR4 A;  3AE1 C;  1SQQ K;  3E7K A;  1J1E C;  3R4Y A;  1W2B O;  3QWO C;  1KYO H;  1Q81 Q;  2I1J A;  3N0Q A;  1YJW P;  3KDP B;  4PV1 B;  1MFT A;  3I5C A;  1G1J A;  5AVT B;  4N6J A;  1A02 J;  3CWB D;  3O6Q A;  4H0L C;  2QJP B;  2A06 E;  2IBZ G;  1K9M Q;  2FYN C;  1U7M A;  2YKO A;  5AW5 B;  3RGU A;  3H1J G;  1LTJ A;  2B87 A;  4JF7 A;  1DEE G;  4GIF A;  1URQ A;  3CX5 D;  1O7M A;  5APU A;  2IDB A;  3W68 A;  3H1J D;  1OVR A;  5GTH E;  3FXD A;  1FZB A;  3CLQ A;  5BU5 A;  3L75 G;  1MKM A;  1URQ D;  3RK2 C;  2FYN B;  1O7N A;  1E5W A;  5BVZ A;  5GTI E;  2N9B A;  2C0X A;  3HD7 C;  2OAR A;  5B5E H;  1N2D C;  1SQV K;  3L4F A;  2PAJ A;  3E1I A;  3VMG D;  3G6E P;  1OIP A;  2YO2 A;  4M3L A;  5APQ A;  1EZV G;  3EWK A;  1SLQ A;  3L70 J;  3L71 J;  1NHL A;  1NTZ E;  2HMN A;  3L73 G;  1U57 A;  3QH9 A;  4D6T E;  3ABV C;  1OX3 A;  1H8A A;  3NMD A;  3U59 A;  1SQV G;  1J1E B;  2V7Q H;  2O1K A;  2FYU K;  4CPG A;  1RF1 A;  1VF5 D;  1SFC B;  4NPF X;  3TNU A;  1RF1 B;  4EDF A;  2N1T B;  5DJU B;  5CCH D;  2B9B A;  1LTS C;  1SQP E;  1ZRT E;  2CPB A;  2KSE A;  2K3R A;  3L75 J;  1MV8 A;  1RE4 A;  5CBN A;  4IL6 E;  1EXI A;  3N7N A;  1DH3 A;  2GUV A;  4BXL A;  1BGY G;  4ZNC A;  2JR8 A;  1ZV8 A;  3L75 D;  1H0T A;  2E4P A;  2FBW C;  3VOP A;  2WIT A;  2OTK E;  1N7S D;  4U3F J;  2AEF A;  3RL0 C;  1NTZ G;  4HM0 A;  4H13 C;  1N8R Q;  1JCC A;  2KI7 B;  1VF5 B;  1SQX G;  1HGZ A;  1GU5 A;  1OXZ A;  1X9V A;  1EDK A;  3C0D A;  1X79 B;  4WY4 A;  2GM4 A;  2IBZ D;  4WBA A;  1HVV A;  3UIA A;  3GF3 A;  1WT6 A;  3M9H A;  5APV A;  1KIL B;  1QLE D;  1SQV D;  2GUS A;  3IFM A;  2ZJS E;  3PHL A;  2B87 B;  4U3F G;  1VCK A;  1L0L G;  5AW1 B;  5AW0 B;  2M8R A;  1RE4 C;  1S72 P;  3S1K A;  1K73 Q;  3SWF A;  2NZ2 A;  1VL2 A;  2A45 G;  1HJB A;  1N73 B;  3BAT A;  2Y0D A;  3GZX A;  2XRX A;  1NH4 A;  1HTL C;  4ASW A;  4HH2 A;  2CKF A;  2H7H A;  3CCU P;  2WSE H;  2OYI A;  4EMJ B;  1ZXG A;  1PP9 G;  3B5N D;  4XA4 A;  4KHX A;  1BCC E;  1M1J A;  2QA4 P;  2YIU B;  3TGU D;  1NTK K;  1UII A;  3L73 D;  2ZXE B;  1FZC B;  5KAF E;  3CCQ P;  1EZV D;  1NTM D;  3CWB J;  2FXP A;  2W83 C;  2E75 D;  5KAF H;  1Q7Y Q;  1AQ5 A;  1BGY E;  3AE4 C;  1SFC A;  1X22 A;  1NTM J;  3R2P A;  4NB8 D;  1PL5 A;  1FZE A;  2P58 A;  5APX A;  5AVZ B;  4D6T G;  3TGU J;  3H25 A;  4B86 A;  1BE3 E;  2QJK B;  3CPW O;  2Q1K A;  3CC7 P;  3CX5 E;  4LC1 A;  2NUM A;  3RL0 B;  1FBM A;  3KYQ A;  1KB9 I;  2XSO A;  1SQQ D;  5GTH H;  4NBE D;  2W90 A;  3A0H E;  2QJP C;  2NPS B;  4JQ0 D;  3AE8 C;  4R4L A;  3KPE A;  2HPC B;  4WY4 C;  3D89 A;  3PP5 A;  2QM7 A;  2E5Y A;  3RK3 B;  3H32 A;  3M06 A;  1R8E A;  3GHG C;  1FOS E;  1NGM B;  2V4H A;  5CXM A;  1SQP G;  1P84 H;  2ZYD A;  3HE5 B;  2PP6 A;  4WWI A;  1AQT A;  2QJY C;  1G8J B;  1S9K E;  3H1H E;  1LT1 A;  5DJT B;  1ZR2 A;  1NWQ A;  1EDJ A;  4QUQ A;  1SQB J;  4HKV A;  4ASV A;  4IFD K;  4P1C H;  3CD6 P;  1YBK A;  2WWW A;  2NPS D;  5E79 E;  3L74 D;  1W2E A;  1JY2 O;  4L75 A;  4NBA D;  2BCC E;  1SQP J;  3RK3 C;  2J58 A;  5E79 H;  2KNC B;  3L72 G;  3F5H A;  3L35 A;  4HM5 A;  2Y0C A;  3MIW A;  3GMA A;  3OW2 O;  2FFD B;  3M0A A;  4I2L C;  1JY2 N;  4PV1 D;  3LW5 H;  4WB4 A;  1MFZ A;  1PIX A;  1L2P A;  3RBX A;  1XTG B;  2H88 C;  5CHX A;  2E43 A;  3AEG C;  3HE4 A;  3TYY A;  2FXO A;  5KJ7 A;  4R4M A;  1KZU B;  1YIT P;  1ULJ A;  1YQ3 C;  2ZVO B;  3JCU H;  1LP1 A;  3L71 D;  3L70 D;  1NKN A;  1JM0 A;  4RJT A;  5KJ7 D;  3H1I G;  4LLH A;  4BWN A;  3SWK A;  3EN1 A;  5AW6 B;  3AED C;  2KK7 A;  3LW5 J;  1NU1 D;  3B5N A;  2W6J H;  4YPC A;  3L71 E;  3L70 E;  1BCC J;  2NVE A;  3PTZ A;  2WSE J;  1LWU A;  3TSI A;  2M3B A;  3PRJ A;  3AE3 C;  1JB0 J;  4AQR D;  3DQY A;  3SFD C;  1QL1 A;  1WMK A;  2P67 A;  4OWF A;  3VCA A;  3IAO A;  2FY8 A;  5AEW A;  2IYP A;  3WU2 H;  2P1J A;  2BMR A;  1PZQ A;  3M0D A;  2Q3W A;  1SQB E;  4UB8 H;  3BRT B;  2BCC G;  2K88 A;  3CCM P;  2KS1 A;  2WPR A;  2Q6Q A;  3Q1M A;  3M9Q A;  1LTG C;  4HYT B;  3LIE A;  1GK4 A;  2FYU D;  1Q82 Q;  4NBB D;  3P8C D;  2PFX A;  1IO4 A;  3IR9 A;  2ZAE B;  4GDO A;  2R5D A;  5KLV K;  3B71 A;  1IFD A;  2XV5 A;  2ZT9 C;  2HLO A;  1KQL A;  1A02 F;  5AVX B;  2YMK A;  3A5T A;  3GTE A;  2ZT9 B;  3EQQ A;  4QDF B;  3FOU A;  1SP4 A;  4U3F E;  2N1T A;  5KKZ B;  2WSS H;  1OW7 A;  3OAK A;  2HG5 D;  1IK7 A;  2HFE D;  1WQL A;  1KQS O;  3V2N A;  2WPV B;  3HUS B;  2WSC H;  3L70 G;  3L71 G;  3HUS A;  3H1L D;  4NPE A;  1VQ9 P;  3GL0 A;  2I1K A;  2B24 A;  1FJK A;  5H2F H;  3AEB C;  2BEZ F;  1KOR A;  3TDK A;  3BCC G;  4I7Z C;  1FU1 A;  1FZC A;  1FE6 A;  2G3A A;  1ZP0 C;  1GZL A;  1S4X A;  1YTZ I;  2WVR A;  2HR3 A;  2WT7 A;  3CWB G;  1VQ6 P;  1DX7 A;  1L0N J;  1VDF A;  1ZOY C;  5APW A;  1KFN A;  1GL2 A;  5AVW B;  1T8Z A;  1KB9 E;  3ZDM A;  1KV4 A;  1M8O B;  1W5C E;  4HM8 A;  3VYI A;  1KN7 A;  2O3J A;  2BAS A;  2W6A A;  2AXC A;  1HGV A;  5CCG C;  4U7J A;  3CX5 I;  2W27 A;  4U3F D;  5AVR B;  1QEX A;  3CXH D;  1FJP A;  3AE2 C;  1J1D B;  2HMK A;  1RF0 A;  3CL3 D;  3IF4 A;  3LID A;  1O7G A;  5AW8 B;  2D2C C;  3MTU E;  4NBH D;  5AW7 B;  3CC2 P;  3H1L G;  1L4A D;  4H44 C;  4H13 D;  5KLV E;  4H44 D;  1PPJ E;  1X0T A;  1Z56 A;  1G2C A;  4EIJ A;  4N3Y B;  1CZQ A;  2GBX A;  1IJD B;  4L76 A;  3AE9 C;  2I7F A;  1SQB G;  3L74 E;  2JKV A;  3Q2Y A;  2O01 J;  2VRS A;  1O7H A;  2Y9Z A;  1M57 D;  1CI6 B;  2WMM A;  4GT1 A;  3L72 D;  1HUC A;  1N7S C;  4C7N A;  2QSI A;  1EQ7 A;  2I8D A;  3L73 E;  2XND H;  3EFG A;  3CCL P;  3L72 J;  2KLV A;  4I7Z B;  4GOE A;  1KQG B;  5CCH A;  2KNC A;  1GTW A;  2RKL A;  5KAI E;  3BAS A;  1DIP A;  1X8Y A;  4RKU J;  1NYH A;  5KTB A;  2PRR A;  3MD0 A;  3VMX A;  2NVF A;  5B66 E;  2RH0 A;  3MGN A;  1LGH B;  1N73 C;  3M91 A;  2KS1 B;  3B5N C;  1JO5 A;  1BE3 J;  5AW4 B;  4HB1 A;  1S3J A;  3FXE A;  2KZJ A;  3G71 P;  2WPS A;  3EQ2 A;  2Q3I A;  1U7J A;  1YIJ P;  2E5T A;  1NOH A;  3HD7 B;  1SQV J;  4W80 A;  3TF5 A;  3H1H G;  4BRY B;  2HOD B;  2B88 A;  2K1A A;  5AVS B;  3H32 B;  2DE6 D;  2OYH A;  1GL2 B;  1PP9 D;  3AE5 C;  5CJ0 A;  1Q90 C;  1SQX D;  5KLV J;  2YKP A;  5C39 A;  4H44 B;  1Q2N A;  2OGU A;  4AIV A;  3M0D C;  4NBD D;  1GW3 A;  1VF5 C;  1L0N K;  2WTY A;  1K05 A;  1PGO A;  1VQ4 P;  1EC5 A;  3GG2 A;  2GBW A;  2AEJ A;  4DJG A;  2FFD C;  1VQ8 P;  4NBG D;  2YFL A;  1J2J B;  3U1A A;  1UIX A;  2E74 D;  3H1J E;  2KP8 A;  3O8Z A;  4QUR A;  1L0L D;  2QVA A;  4BRY A;  1EZV I;  2ITA A;  2E4Q A;  4DOJ A;  2E75 C;  2YMY A;  3HD7 A;  1URQ B;  5EFW B;  1VQL P;  3L37 A;  1KIL A;  3VP8 A;  3H1K G;  1NTM K;  2Q3E A;  3L74 J;  2LXC B;  4WVZ A;  1T2K D;  1RIE A;  3A2A A;  3RL0 D;  1FZF A;  3CI9 A;  1JY3 P;  1SS1 A;  4EYY Q;  1NO4 A;  2BCC J;  1LWU B;  2B1X A;  4C7R A;  2DE7 D;  3WUT A;  1P84 E;  2L91 A;  1OFC X;  5GTI H;  3Q3D A;  1PFI A;  2ZYA A;  3P8M C;  4QUP A;  2QEX P;  3D70 A;  2B89 A;  3TGU E;  2LXB A;  4AYC A;  2QM8 A;  1LWU C;  2A06 D;  1AV1 A;  4OH8 B;  2IYO A;  2NRG A;  1OVV A;  1SQV E;  3B8E B;  3W67 A;  1JTH B;  1KMI Z;  3GF7 A;  3BCC E;  4WY4 D;  4OGQ B;  1JEK A;  1FZG A;  1BGY J;  1KD1 Q;  3JCU E;  4HJL A;  2E76 C;  3GCE A;  1QVG O;  2BMO A;  4HM6 A;  1SQX K;  5K5G B;  2G8Y A;  3JC2 2;  1LNQ A;  2KOG A;  5AVQ B;  4HM1 A;  1LTI C;  5BU8 B;  1NTZ K;  3AEC C;  1KIL D;  1FDM A;  2L5G B;  1RH5 B;  2LR2 A;  3GLM A;  1FQT A;  1KIL C;  3CXH H;  3WUV A;  2OYI C;  2KYV A;  3VN0 A;  1VQK P;  2NWF A;  1O7P A;  3IN6 A;  3V5B A;  1CW5 A;  2XU6 A;  1DEB A;  3OJA B;  3H1H D;  2AXT H;  3KXD A;  2K37 A;  2FKW B;  2QPZ A;  4OGQ D;  1FDO A;  1N7L A;  1OW6 A;  1GW4 A;  2A45 I;  1PGJ A;  3V2P A;  5KLV D;  1YI2 P;  2JO6 A;  3B5N B;  2Z5H A;  2HML A;  1BSN A;  3VTP C;  2KXP B;  1P84 I;  1SQB K;  1SFC D;  3A0B H;  3SFE C;  4XFJ A;  2YXQ B;  4K3A A;  1NTK E;  3L72 E;  1L0L E;  3II6 A;  2LKM A;  3MUD C;  1USE A;  4W7Z A;  1AVO A;  1YQ4 C;  1KYO E;  4K35 A;  2YFJ A;  3V6I A;  2JJL A;  3G4S P;  1IC2 A;  1TU3 F;  3NXS A;  1N86 A;  1HBW A;  2JWA A;  2NPS A;  1BGY D;  1ZW0 A;  1NTM G;  2HMJ A;  5APY A;  3RK2 B;  1SQX E;  1WRG A;  1FOS F;  2JZA A;  1N7S B;  1NAY A;  5AVY B;  1YYC A;  4NBF D;  4AAY B;  1IFJ A;  1GD2 E;  1ZLL A;  2OQQ A;  1QGK B;  1LTT C;  2A06 G;  3H1K E;  1M1J B;  4UB6 H;  2AEM A;  1Y47 A;  2R44 A;  2KIK A;  3V4W A;  1KC8 Q;  1NU1 K;  3GZY A;  1YJN P;  1NJI Q;  1RHZ B;  1SQP D;  1NKZ B;  2IZ1 A;  3N4X A;  1M1K Q;  4O9B A;  1CSB A;  1KB9 H;  2E76 D;  1JUN A;  1Q86 Q;  1LT9 A;  3D6Y A;  3VMH D;  2WPQ A;  1VQO P; 
#chains in the Genus database with same CATH homology
 3AZC A;  1P84 E;  2HML A;  2YIU C;  1PP9 E;  2QJK C;  4QUQ A;  3EQQ A;  4HM0 A;  4QDF B;  4H0L D;  3L71 E;  3L70 E;  4HKV A;  2NVE A;  2E75 D;  3FOU A;  1NDO A;  1O7G A;  3GB4 A;  4QUP A;  4U3F E;  4NBH D;  3VMI D;  1BGY E;  4P1C H;  3TGU E;  1NTM E;  1NU1 E;  1O7N A;  5KLI C;  2ZYL A;  1NTK E;  3L72 E;  2XR8 A;  1L0L E;  1WQL A;  3DQY A;  4NB9 D;  1RFS A;  1SQV E;  4H13 D;  4QDF A;  3C0D A;  2DE6 D;  3EN1 A;  4NB8 D;  4P1B H;  5KLV E;  4QCK A;  3BCC E;  4H44 D;  4NBA D;  1PPJ E;  3VMG D;  2BCC E;  1Q90 C;  4HM3 A;  3VCA A;  2GBX A;  1KYO E;  2YFJ A;  1BE3 E;  1L0N E;  3CWB E;  4HJL A;  5AEW A;  2I7F A;  3CX5 E;  3L74 E;  3GCE A;  4PD4 E;  1NTZ E;  2BMO A;  2HMN A;  4HM5 A;  1O7H A;  3GL2 A;  2NUM A;  3GL0 A;  4AIV A;  2BMR A;  2B24 A;  4HM6 A;  1ULI A;  4NBC D;  4D6T E;  2D2C D;  4NBD D;  1NYK A;  1SJG A;  1VCK A;  2YFI A;  3H1L E;  4HM1 A;  2Q3W A;  1SQB E;  4PV1 D;  3GTS A;  2HMJ A;  4HM4 A;  1SQX E;  1JM1 A;  2GBW A;  2XSO A;  2JZA A;  5HL4 A;  4NBE D;  4NBG D;  1FQT A;  2YFL A;  1UUV A;  3GKE A;  2E74 D;  3H1J E;  2ZT9 D;  3VCP A;  4AAY B;  4NBF D;  2NWF A;  4QUR A;  5BOK A;  1O7P A;  2HMM A;  3GZX A;  4HM2 A;  3L73 E;  4QDC A;  3N0Q A;  3H1I E;  2QJP C;  2XRX A;  2E4Q A;  3GOB A;  3H1K E;  1VF5 D;  2XSH A;  1EZV E;  2CKF A;  1VM9 A;  2BMQ A;  4NBB D;  4HM7 A;  1SQP E;  3D89 A;  3L75 E;  1ZRT E;  4EMJ B;  2A06 E;  1ULJ A;  4QDD A;  2NVG A;  1SQQ E;  2FYN C;  5AEU A;  3GZY A;  1KB9 E;  2QPZ A;  1RIE A;  5KKZ C;  2NUK A;  4OGQ D;  4HM8 A;  3CXH E;  5CXM A;  1EG9 A;  2DE5 D;  1BCC E;  2IBZ E;  1O7W A;  2E76 D;  2QJY C;  1G8J B;  1UUW A;  2NVF A;  1G8K B;  3VMH D;  2B1X A;  1O7M A;  2JO6 A;  2YVJ B;  3H1H E;  2E4P A;  2DE7 D;  3GTE A;  2HMO A;  2FYU E;  2HMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...