1BCCE

Cytochrome bc1 complex from chicken
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
total genus 44
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1bccE02
2JZAA 3DQYA 1Q90C 4EMJB 4H44D 4QDFA 1O7WA 4H0LD 4D6TE 1SQPE 1ULIA 2DE5D 2E4PA 4PV1D 2GBWA 1RIEA 1SQBE 1SQVE 2QJPC 1O7MA 2BCCE 3L75E 2HMKA 3GKEA 2NVFA 1VF5D 2CKFA 2E76D 3EN1A 3FOUA 1PPJE 4P1CH 2B1XA 3TGUE 2HMLA 2YFJA 2JO6A 3H1JE 4NBCD 4QDCA 3L72E 2DE6D 3GB4A 2BMOA 3L71E 1UUVA 3C0DA 1NYKA 4OGQD 3H1KE 2NVGA 4NBHD 2HMMA 1NU1E 2NWFA 3H1HE 1SJGA 2QJYC 2E75D 2BMQA 3GL2A 2NUMA 1ZRTE 1VCKA 5CXMA 5BOKA 1FQTA 4NBDD 1SQXE 2A06E 1WQLA 5HL4A 1G8JB 3D89A 2FYUE 1O7PA 1JM1A 1L0NE 2ZT9D 3CX5E 3GL0A 4NBFD 5KLVE 1NTZE 3EQQA 4NBBD 1O7GA 4NBED 4QUQA 3AZCA 4H13D 1NTKE 1KB9E 3GOBA 3VCPA 3GCEA 4HM1A 2QJKC 1EZVE 2HMNA 3H1IE 2E4QA 3L73E 4AAYB 1BE3E 1UUWA 3CXHE 3GTEA 2I7FA 4NB9D 5AEUA 3L70E 3H1LE 2B24A 4QCKA 2E74D 1KYOE 3L74E 4QUPA 4HJLA 5KKZC 4HM6A 3GTSA 3VMID 2IBZE 5KLIC 3CWBE 1O7HA 2ZYLA 4HM7A 1NTME 1BGYE 3N0QA 4NBGD 2FYNC 2HMJA 1ULJA 2XRXA 4QURA 4AIVA 1BCCE 4HM3A 1EG9A 2XSHA 1SQQE 2YIUC 2HMOA 4U3FE 2YVJB 2BMRA 4P1BH 4HM0A 4HM4A 4NB8D 1NDOA 2YFIA 2NVEA 1G8KB 4HKVA 4HM5A 1O7NA 2DE7D 2XR8A 4HM8A 2XSOA 4QDFB 1L0LE 5AEWA 1RFSA 3GZXA 2GBXA 3VCAA 1PP9E 1P84E 2YFLA 2D2CD 4QDDA 4NBAD 1VM9A 3VMGD 2Q3WA 3GZYA 4PD4E 2NUKA 2QPZA 3BCCE 4HM2A 3VMHD
chains in the Genus database with same CATH superfamily
1ZRTD 4N78E 2E4PA 3B8EB 4W7YA 3E1IA 1YHQP 4XFJA 2NVFA 1SFCC 1SQQG 4WY4D 2NPSD 3TGUE 2P1JA 1PGPA 4KT0J 1YITP 3NMDA 3L71E 1UUVA 1RF0C 4OGQD 2NVGA 2AEMA 2IBZG 2M5AB 1KQLA 1RE3A 5APSA 1LT9C 1SQXE 3JSVC 1O7PA 5E79E 1GZLA 3PH0A 1FZCB 5DJTB 2FFDA 3GCEA 1M90Q 1KTMA 1MUUA 1VQNP 3MZWB 3Q5RA 2H7HA 5TJHA 3AE7C 2OYHB 2YKQA 3RL0D 2HMJA 2XRXA 3Q3DA 2FBWC 4HM3A 1N7LA 2WPRA 2HPCA 2XZRA 2E76C 1YTZT 1FJKA 3JCUE 2KIKA 2K88A 1CI6B 2GBXA 5E79H 1LTSC 2W90A 1YJWP 1JCCA 4WWIA 3B71A 2K9YA 2N1TA 2V7QH 4EMJB 5C39A 1SQQK 3CCUP 2AEJA 4RESB 2XKMA 4L73A 1L4AB 3CCRP 3HD7B 1NTZG 4ASVA 5AVXB 1FBMA 1ZXGA 2UWJE 3W67A 2HODB 2E74C 3O8ZA 1FJPA 4ZNCA 1BCCJ 2C9NY 1USEA 1Q2NA 3JCUH 1VCKA 1Q7YQ 3P8MC 2N1TD 4TLFA 3KDPB 4IFMA 1KFMA 1NO4A 3GL0A 1CW5A 4NBFD 1USDA 1RQUA 3LIEA 4H0LB 1L0LD 2KP8A 5B5EE 2D2CC 3HTKA 2I7FA 1Y8AA 3T97B 4KJMA 1UIXA 3SWFA 2IYOA 1RF1A 4JBZA 2R5DA 1IJDB 1KQFB 2OTKE 1SQPG 3WUTA 5AVTB 4HM4A 2E75B 5KAFE 2RN0A 2WPSA 3TYYA 3V6IA 3CLQA 3MUDA 2DE7D 2XR8A 3H1IJ 3L71J 1LP1A 1KZUB 1KB9D 3RK3D 4NBAD 3RBZA 1SQXJ 5KJ7C 4UB8E 4GODA 1D7MA 3QWOC 1NTZK 2A45H 3KPEA 2JZAA 1GU5A 4L75A 1W2BO 4IL6X 1FDMA 1L0NG 2QJPC 1YI2P 2ZYDA 2V7QJ 1T2KC 3GKEA 2W83C 1HJBA 2E5YA 5APVA 2JKVA 1H0TA 2O01H 3HE5A 4L74A 1T3JA 3AE1C 5KAFH 3CC2P 1GK6A 1FQTA 1AVYA 3R2PA 4UB8H 4H44B 1JUNA 5KLIB 1IK7A 1KB9E 3RK3E 3B5NC 2Q6QA 5AW3B 1RH5B 2LXCB 1YIJP 1GL2B 2WSSH 1NU1J 1SQPK 2Y9YA 3TNUA 1K9MQ 3H1JG 5AVQB 2QVAA 3NTNA 3BRVB 3CD6P 5KKZB 1HVVA 1SQVD 3M9BA 4N6JA 1NDOA 2A06G 4HKVA 2FYUG 1Z56A 1ZMEC 3L4FA 3CMEP 3A3YB 2OYHA 1VPCA 4HH2A 4H13B 4OWFA 1FU1A 4YPCA 1KORA 2JWDA 5AVSB 3TDKA 1KB9H 1EDLA 1L0NK 1E5WA 2KS1B 1MFTA 2WITA 3CWBD 1CI6A 4U7JA 2KZJA 3LW5H 4U3FG 1EZVG 3CCSP 2KOGA 4IFFA 2ZVNB 2O01J 5CBNA 1L4AA 3H32A 2KB7P 2NUMA 2HYNA 1QL2A 1R5SA 1BDCA 5AW7B 1SLQA 1VQKP 2KYVA 2CK3H 4PV1B 1M8OB 1FDIA 1OXZA 2RMZA 2Z4EA 2Q3EA 5CJ0A 4DT0A 3R4YA 3D70A 3H1KJ 1IFDA 3AE9C 3L72D 4I1LA 3CWBE 1KB9I 1L4AD 4YTPC 4M3LA 3HD7D 4NBGD 1S9KD 3A7OA 1LTBC 1EG9A 4I7ZB 5AVUB 3PRJA 1VF5C 1N7SA 4NB8D 1J1EB 3HUSC 4R4MA 3V2RA 1G8KB 3T97A 5AVRB 3L73J 2FKWB 1HTLC 1WRGA 2C0WA 3VCAA 1GTWA 3CXHD 1SFCB 2OYOA 1NTKK 4H0LD 4D6TE 2ZYGA 5CCGD 3AE8C 2HMKA 1KQSO 2QA4P 5CCHA 1IK9A 4ZKUA 2IYPA 4RJTA 2HMLA 5CBOA 3JC22 3U1AA 3AEGC 3L72E 2BMOA 3H1LG 3LW5J 3S9OA 3IAOA 2I1KA 2E75D 2B89A 2K37A 3FWNA 3GF7A 1YYCA 4GOEA 3D89A 1SQBJ 3AE3C 4I2LC 2BCCJ 1VQOP 2QJKC 3M9HA 2HMNA 5CCHD 3S1KA 3CXHE 3HUSA 4NB9D 1OX3A 2KXPB 1EXIA 4IFDK 1K05A 4YXWH 1FE6A 2E76B 4OGQC 3GLMA 4OVNF 3MP7B 2YMYA 4YXDC 3GG2A 2WSCJ 4QURA 1X22A 1RF1B 2YIUC 1ZR2A 3O6QA 2WPVB 1GL2A 1NTKJ 3KYQA 2BASA 3BVHA 1O7NA 1A02J 3P8CE 3MHVA 1EXJA 1GK4A 4DJGA 3TSIA 5M1BA 3Q5SA 1LP1B 1S5LE 3H1ID 3AEAC 1FZBA 3KZIE 2NUKA 1SVFA 3VMHD 1NH4A 2E74B 3BASA 4H44D 3CXHH 3RL0C 5APTA 2IBZD 2GBWA 2KNCA 1PZQA 1BGYG 5KLVG 2ZVOB 1K04A 1GL2D 1LTTC 4EI2A 3OW2O 1IFMA 4AUWA 1PP9J 1E79H 1NTMK 2E42A 4BWNA 3HE5B 4C7NB 3CCJP 3GHGC 1VQ5P 3G4SP 3AEFC 2JP3A 1SJGA 1ZW0A 2D2CB 4PD4D 2QRXA 1FZEA 1S5LH 4K35A 2B9BA 3KZIH 4NBBD 3G9RA 2HG5D 4H13D 1HGZA 3WUVA 3C1LA 1JNMA 3SFDC 1KYOI 3H1IE 1N73C 4AAYB 5CMZA 1KD1Q 4QUPA 1A02F 1OVVA 4HJLA 1FZFA 3A5TA 2JO1A 3TGUG 1GU4A 4D6TJ 4NPEA 2IBZE 2XV5A 1NWQA 1O7HA 4HM7A 1K73Q 3VMXA 1NU1D 3TNUB 3CXHI 2RKLA 3Q5PA 2YFIA 2QIWA 1KMIZ 3VMYA 3L72J 3GF3A 1PPJG 3RBXA 3L70J 1LWUC 2QJPB 3L74J 1S1CX 4PD4E 3G6EP 3M91A 5KLVK 1NTMJ 2N9BA 2QE7H 1YQ4C 1LT1A 1HWTC 3RL0g 4PV1D 2ZFCA 3FWLA 3W68A 2B87A 1FZAA 3N4XA 1PGOA 3RK2B 1SFCA 2NRGA 1CSBA 5L8RJ 3FXDA 4DOJA 2JO6A 5BU5A 1NU1E 1RF0A 2XNDH 5APQA 1AQTA 3B5NB 3H32B 2AEFA 1LT9A 3D6YA 1NTZE 3A2AA 5AW0B 2WT7A 4PD4H 3L75J 1SQPD 3AZCA 1QVGO 4XA4A 2ITAA 2MKVA 3VMID 2ZXEB 1RY3A 1QL1A 2ZYLA 3H1KD 3H6PA 3OAKA 3PHLA 1XTCC 5CJ4A 2JWAA 1L0ND 2O01N 2YO3A 1N7SB 4HB1A 2IBZI 1BE3J 1RHZB 5GTHH 3VTPC 4B86A 1DEBA 3L73D 2A45G 2PAJA 1U7MA 3KXDA 2YXRB 3H1HG 4KHXA 5EFWB 1O7WA 1SQPE 1SQQJ 3C9IA 1M56D 2M8RA 4PD4I 1KILC 1ZR4A 2E76D 1NOHA 2QG4A 1IFNA 1CZQA 3L36A 3M06A 1NYKA 1LTGC 3H1KE 2POHA 5AW1B 4O9BA 3CX5I 5AW5B 5CXMA 1VDFA 5BOKA 1QX8A 1FZCC 1FAVA 1M1JC 1X79B 1TU3F 1L0NE 2ZT9D 1FC2C 3A0BE 2ZYAA 1Q86Q 4C7NA 1SQBD 1U7JA 2I8DA 4HM1A 1L0LG 2BCCD 1JMMA 2O3JA 3L73E 1BDDA 3AE4C 1VF5B 1S5LX 1SS1A 2E74D 3HUSB 4HM6A 3VP8A 3BCCG 1YQ3C 2H43A 4Y99C 4JF7A 4EOTA 1ZOYC 3O6QB 4HM8A 2K1AA 1EDJA 1NTKD 2WSEH 4JYCA 1R8EA 1EZVD 2C0XA 2D2CD 3A0BH 4QDDA 2JJLA 3VN0A 2N9YB 4GIFA 3TK1A 3F89A 3E7KA 4L76A 2AXTH 5KJ7A 2OTLP 1GDTA 1NTZJ 3HD7C 3CCMP 1SQBE 1O7MA 2P67A 2BCCE 1FDOA 2KNCB 1OFCX 3P32A 2J58A 1YBKA 1M1JA 4CPGA 3QH9A 1DX7A 1HH0A 3VP9A 2O1JA 3C0DA 2WPQA 1AV1A 1PP9D 5K5GB 2QM8A 1YTZI 2Y0DA 2B88A 1NHLA 3V5BA 1G8JB 1J1DB 1JM1A 1L0LK 2OYIC 5CCGC 3M0DC 3EQQA 1JY2O 3CMAP 1IFJA 2R3SA 1NTKE 1RE4C 1EZVE 2OQQA 3B5NA 4N3YB 3B4SA 2FY8A 1MKMA 3EQ2A 1HF9A 2B24A 3MTUE 5DJUB 1GD2E 1SQPJ 1UIIA 1FS0E 1AJYA 3N0QA 1VQ7P 3RK2D 1PV3A 1G1IA 4D6TD 1DD3A 2M3EA 3WMM0 1SQVG 2NVEA 1OWAA 4TT3H 5H2FE 3WUUA 5AW6B 1PL5A 2WSCH 5AEWA 3UIAA 4LGDE 3B5ND 3CCVP 1PP9E 3CCEP 1URQC 1H89A 4MN4C 5KTBA 2FYUK 2GUVA 2XU6A 3L70D 2WSEJ 2L5GB 1AFOA 1SP4A 1L0NJ 3AE2C 3I56P 1KYOD 3L74D 5APXA 1T8ZA 1S4XA 1W5CE 2IPPA 1NTMD 3CWBG 3IN6A 1LTJC 4GOFA 3VMAA 1HBWA 3VOPA 4LC1A 2XNXA 2B87B 2Y0EA 1OVUA 2OYIA 4XE5B 3I55P 3GB4A 2YNYA 2R5BA 2Y9ZA 5H2FH 3M9QA 3GL2A 1N73B 1H88A 4C46A 1N7SD 1JEKA 1LGHB 3D6ZA 2QM7A 1IZNB 1DH3A 1LT9B 3CI9A 2WSFJ 2W27A 3D71A 3P8CD 2WT7B 3L75D 3H1JJ 1JY3O 3H1LE 3L70E 1KYOE 3L74E 3AE6C 5KKZC 4W80A 3MIWA 1NKNA 4NPFX 2FXPA 1SQVK 1Q90D 1NTME 1EZVI 1N8RQ 2FYNC 1IFPA 2FYUJ 2ZJSE 3N7NA 4WY4C 4HJGH 2NPSC 1LTAC 2WMMA 5KLVD 4QDFB 1M1KQ 1LTJA 2NZ2A 1QLED 3PTZA 1BE3D 1FZGA 2O1KA 3GZYA 2FYZA 2IZ0A 1IC2A 3V4QA 4A7PA 2PRRA 4I6MC 4RKUJ 3EFGA 4U3FJ 1KYOH 5TISE 3WU2H 3L75E 1SQQD 3KHUA 1X8YA 1VF5D 1M7LA 2W8ZA 3EN1A 4BRYA 3PJSK 1HUCA 2YFJA 2R44A 3RGUA 1EDIA 2ZXXA 3SWYA 2NWFA 2JDIH 3U59A 2WQYC 3IR9A 2KUBA 3V2PA 1RE3C 2BMQA 1S3JA 1VQPP 1BCCG 5KLVE 3FX0A 3PP5A 1PGQA 2FFDC 4NBED 2YMKA 3AEDC 3VCPA 3M0AA 4WVZA 4WB4A 3I5CA 1BE3E 4WY4A 1FOSE 5AEUA 5TISH 1PPJD 4I7ZC 4PJ0E 5BVZA 1SQQE 1OZHA 1AQ5A 2GA1A 3CC7P 3CX5D 2KLUA 5AVVB 1S2EA 1RFSA 1QEXA 1P84E 1VL2A 1PIXA 3L37A 1Y47A 3H1IG 3L71G 3AE5C 2N1TC 2HR3A 1KILB 2PGDA 3V2NA 1S72P 3AEBC 1ULIA 2DE5D 1NAYA 1SQXG 1ZLLA 1NTZD 2Y0CA 3BRTB 1NAFA 5AW8B 4PJ0H 3CCLP 4W7ZA 2R3CA 3H1LJ 1LTIC 1PPJE 2PFXA 1M1JB 4DCKA 3CCQP 1X0TA 4NBHD 2HMMA 2VRSA 3E1RA 1GW4A 5AVWB 3GHGA 2QJYC 1ZRTE 2W6JH 1VQMP 4NBDD 1P84H 3EFFK 3CX5E 3ITKA 3VMZA 1O7GA 3C8VA 4QUQA 3ZDMA 1NYHA 2G3AA 3RK3C 2AXCA 2P2UA 4Y99B 1NJIQ 1N73A 1VQ9P 5AVYB 1H8AA 5KAIE 1Y9BA 4QCKA 2L91A 4ZKPA 2Z5HA 4GKGA 3HRNA 2CPSA 1EC5A 3GTSA 1RF1C 5GTHE 2LXBA 1NU1G 3H1HD 2ZT9C 3K5BA 1JB0J 3CPWO 3MUDC 4DZOA 4IOIH 1SFCD 1NVOA 2H88C 4HM5A 3NFQA 2LR2A 5BU8B 3CX5H 2K9JA 1LWUA 5AVZB 1SQXK 2KLVA 2M3BA 4Z1MH 1VQ8P 1BGYJ 5KLVJ 2GM4A 1OVRA 4QDFA 1JY2P 5KAIH 2P7JA 1RIEA 1P84I 1T3UA 2JEEA 1KFNA 1K8AQ 1LJ2A 1GMJA 4AQRD 3AEEC 2WWWA 1T6AA 3FOUA 2KK7A 2P10A 2OYIB 3Q1MA 2MJZA 2WZ7A 1R5LA 1BSHA 4JYBA 2H8PD 2YXQB 3H1HE 1IO4A 5HL4A 3BCCD 1JTHA 5GTIE 1KN7A 3GOBA 1ZP0C 3TGUJ 1PFIA 2IZ1A 4ASWA 1YJ9P 4NPDA 3GW6A 4HKZH 3SWKA 1NKZB 1NU1K 3H1JD 2SPZA 2E43A 1L2PA 4GT1A 3HE4B 5AW4B 3H1KG 4JPZB 2KSEA 1G1JA 1URQB 2KSJA 5B5EH 2AXTE 2A06D 1DD4A 2FYUD 2XSOA 1L0LE 2OYHC 1JM0A 4GDOA 3USSA 5GTIH 3NXSA 1FOSF 1LTJB 3BATA 3MD0A 2BEZF 2KI7B 3L73G 2IFMA 4OH8B 5AW2B 3BCCE 2JR8A 1X9VA 3RK2C 4AYCA 4U3FD 1JY3P 4P1CH 3G3ZA 1KILA 3SSUA 3H1JE 4QDCA 4BRYB 2G8YA 3A0HE 1L4AC 2M5AA 1M57D 3TF5A 3OA7A 3Q2YA 2HLOA 3F5HA 4ZMDA 2A06E 1EQ7A 2FYUE 4LLHA 1FZCA 2Q3IA 3H25A 1J2JB 2A45I 2QSIA 3P7KA 1OW7A 2OGUA 2Z5IA 3V4WA 1JOCA 1AVOA 1SQBG 2FYNB 2WTYA 1G2CB 3VYIA 2YKPA 2K3RA 1VQLP 2BCCG 1KILD 3GTEA 2QJKB 4WY4B 5B66E 1VQ4P 5KJ7D 2NPSB 2WSFH 1IFIA 1GW3A 4H0LC 2FXMA 1W2EA 1NGMB 2BEQD 4OGQB 4AIVA 1N7SC 4U3FE 2YVJB 2BMRA 4HM0A 1OW6A 3A0HH 1T2KD 4Y28J 2W6AA 2YIUB 2V4HA 1JY2N 5APUA 1JMBA 1NTKG 1DIPA 2YFLA 3H1HJ 1VM9A 3VMGD 2E75C 3PLNA 1HJ0A 4HM2A 3OJAB 3DQYA 2IFNA 1Q90C 4R4LA 2OTJP 2IDBA 1VQ6P 3FXEA 3HD7A 3FGAD 1HGVA 1SQVE 5B66H 2I1JA 1BSNA 4EIJA 3RL0B 3V2QA 2HODA 5CCHC 1KILE 2CKFA 2Q9IA 4EDFA 2W6BA 1OMIA 3H1LD 2DE6D 3U1CA 2FFDB 2OARA 1ZV8A 2ZAEB 2Q1KA 2P58A 1PP9G 1ZN5A 3KQGA 1WQLA 1SQBK 3GHGB 4C7RA 4QMAA 3CL3D 4K3AA 1L0LJ 2M0BA 5CCGA 1PGJA 3M0DA 2XDJA 2FXOA 3AECC 1JO5A 1Q81Q 2E4QA 1RE4A 2HPCB 1UUWA 3BCCJ 1LNQA 4RO0A 4H44C 5KLIC 4WBAA 1OW8A 1AA0A 2E5TA 3GMAA 1ULJA 1KQGB 4BXLA 3L35A 2HFED 4D6TG 4P1BH 1GL2C 1U57A 3IFMA 2N1TB 1N2DC 2LKMA 3MGNA 5AW9B 1WMKA 3GZXA 3WU2E 2R32A 3HE4A 2H89C 3L72G 1URQA 2C9LY 1N86A 2K9JB 1JY3N 4UB6E 2J59M 2QPZA 1LWUB 2DW3A 3ABVC 3L70G 3SFEC 1OIPA 3L74G 2GUSA 1S9KE 2IX7C 1BGYD 4H13C 1QGKB 2YKOA 1NTMG 1WT6A 1BCCD 5APYA 5CHXA 2QJYB 1RQVA 2B1XA 3EWKA 1KC8Q 3CC4P 4NBCD 3LIDA 1JCDA 1YJNP 1EDKA 1URQD 3RK3B 2CPBA 1J1DC 3HTKB 1MV8A 4IL6E 4N78D 1XTGB 1JTHB 4UB6H 4JQ0D 3S4RA 3G71P 5APWA 3L75G 1P84D 2ZT9B 3TGUD 3L71D 4EYYQ 1MZ9A 3IF4A 1SQVJ 2RH0A 4PV1C 1BGYE 2YO2A 1BCCE 1KV4A 2XSHA 4HYTB 2HMOA 1G2CA 2WVRA 1SQXD 2J5UA 2KZIA 3II6A 2PP6A 1Q82Q 2NPSA 1MFZA 4IL6H 2Q5UA 2KS1A 1QVFO 1DEEG 2QEXP 2Q3WA 1BE3G 1J1EC 1H0TB 3CWBJ 2Q7CA
chains in the Genus database with same CATH topology
2JZAA 3DQYA 1Q90C 4EMJB 4H44D 4QDFA 1O7WA 4H0LD 4D6TE 1SQPE 1ULIA 2DE5D 2E4PA 4PV1D 2GBWA 1RIEA 1SQBE 1SQVE 2QJPC 1O7MA 2BCCE 3L75E 2HMKA 3GKEA 2NVFA 1VF5D 2CKFA 2E76D 3EN1A 3FOUA 1PPJE 4P1CH 2B1XA 3TGUE 2HMLA 2YFJA 2JO6A 3H1JE 4NBCD 4QDCA 3L72E 2DE6D 3GB4A 2BMOA 3L71E 1UUVA 3C0DA 1NYKA 4OGQD 3H1KE 2NVGA 4NBHD 2HMMA 1NU1E 2NWFA 3H1HE 1SJGA 2QJYC 2E75D 2BMQA 3GL2A 2NUMA 1ZRTE 1VCKA 5CXMA 5BOKA 1FQTA 4NBDD 1SQXE 2A06E 1WQLA 5HL4A 1G8JB 3D89A 2FYUE 1O7PA 1JM1A 1L0NE 2ZT9D 3CX5E 3GL0A 4NBFD 5KLVE 1NTZE 3EQQA 4NBBD 1O7GA 4NBED 4QUQA 3AZCA 4H13D 1NTKE 1KB9E 3GOBA 3VCPA 3GCEA 4HM1A 2QJKC 1EZVE 2HMNA 3H1IE 2E4QA 3L73E 4AAYB 1BE3E 1UUWA 3CXHE 3GTEA 2I7FA 4NB9D 5AEUA 3L70E 3H1LE 2B24A 4QCKA 2E74D 1KYOE 3L74E 4QUPA 4HJLA 5KKZC 4HM6A 3GTSA 3VMID 2IBZE 5KLIC 3CWBE 1O7HA 2ZYLA 4HM7A 1NTME 1BGYE 3N0QA 4NBGD 2FYNC 2HMJA 1ULJA 2XRXA 4QURA 4AIVA 1BCCE 4HM3A 1EG9A 2XSHA 1SQQE 2YIUC 2HMOA 4U3FE 2YVJB 2BMRA 4P1BH 4HM0A 4HM4A 4NB8D 1NDOA 2YFIA 2NVEA 1G8KB 4HKVA 4HM5A 1O7NA 2DE7D 2XR8A 4HM8A 2XSOA 4QDFB 1L0LE 5AEWA 1RFSA 3GZXA 2GBXA 3VCAA 1PP9E 1P84E 2YFLA 2D2CD 4QDDA 4NBAD 1VM9A 3VMGD 2Q3WA 3GZYA 4PD4E 2NUKA 2QPZA 3BCCE 4HM2A 3VMHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZA A;  3DQY A;  1Q90 C;  4EMJ B;  4H44 D;  4QDF A;  1O7W A;  4H0L D;  4D6T E;  1SQP E;  1ULI A;  2DE5 D;  2E4P A;  4PV1 D;  2GBW A;  1RIE A;  1SQB E;  1SQV E;  2QJP C;  1O7M A;  2BCC E;  3L75 E;  2HMK A;  3GKE A;  2NVF A;  1VF5 D;  2CKF A;  2E76 D;  3EN1 A;  3FOU A;  1PPJ E;  4P1C H;  2B1X A;  3TGU E;  2HML A;  2YFJ A;  2JO6 A;  3H1J E;  4NBC D;  4QDC A;  3L72 E;  2DE6 D;  3GB4 A;  2BMO A;  3L71 E;  1UUV A;  3C0D A;  1NYK A;  4OGQ D;  3H1K E;  2NVG A;  4NBH D;  2HMM A;  1NU1 E;  2NWF A;  3H1H E;  1SJG A;  2QJY C;  2E75 D;  2BMQ A;  3GL2 A;  2NUM A;  1ZRT E;  1VCK A;  5CXM A;  5BOK A;  1FQT A;  4NBD D;  1SQX E;  2A06 E;  1WQL A;  5HL4 A;  1G8J B;  3D89 A;  2FYU E;  1O7P A;  1JM1 A;  1L0N E;  2ZT9 D;  3CX5 E;  3GL0 A;  4NBF D;  5KLV E;  1NTZ E;  3EQQ A;  4NBB D;  1O7G A;  4NBE D;  4QUQ A;  3AZC A;  4H13 D;  1NTK E;  1KB9 E;  3GOB A;  3VCP A;  3GCE A;  4HM1 A;  2QJK C;  1EZV E;  2HMN A;  3H1I E;  2E4Q A;  3L73 E;  4AAY B;  1BE3 E;  1UUW A;  3CXH E;  3GTE A;  2I7F A;  4NB9 D;  5AEU A;  3L70 E;  3H1L E;  2B24 A;  4QCK A;  2E74 D;  1KYO E;  3L74 E;  4QUP A;  4HJL A;  5KKZ C;  4HM6 A;  3GTS A;  3VMI D;  2IBZ E;  5KLI C;  3CWB E;  1O7H A;  2ZYL A;  4HM7 A;  1NTM E;  1BGY E;  3N0Q A;  4NBG D;  2FYN C;  2HMJ A;  1ULJ A;  2XRX A;  4QUR A;  4AIV A;  1BCC E;  4HM3 A;  1EG9 A;  2XSH A;  1SQQ E;  2YIU C;  2HMO A;  4U3F E;  2YVJ B;  2BMR A;  4P1B H;  4HM0 A;  4HM4 A;  4NB8 D;  1NDO A;  2YFI A;  2NVE A;  1G8K B;  4HKV A;  4HM5 A;  1O7N A;  2DE7 D;  2XR8 A;  4HM8 A;  2XSO A;  4QDF B;  1L0L E;  5AEW A;  1RFS A;  3GZX A;  2GBX A;  3VCA A;  1PP9 E;  1P84 E;  2YFL A;  2D2C D;  4QDD A;  4NBA D;  1VM9 A;  3VMG D;  2Q3W A;  3GZY A;  4PD4 E;  2NUK A;  2QPZ A;  3BCC E;  4HM2 A;  3VMH D; 
#chains in the Genus database with same CATH topology
 1ZRT D;  4N78 E;  2E4P A;  3B8E B;  4W7Y A;  3E1I A;  1YHQ P;  4XFJ A;  2NVF A;  1SFC C;  1SQQ G;  4WY4 D;  2NPS D;  3TGU E;  2P1J A;  1PGP A;  4KT0 J;  1YIT P;  3NMD A;  3L71 E;  1UUV A;  1RF0 C;  4OGQ D;  2NVG A;  2AEM A;  2IBZ G;  2M5A B;  1KQL A;  1RE3 A;  5APS A;  1LT9 C;  1SQX E;  3JSV C;  1O7P A;  5E79 E;  1GZL A;  3PH0 A;  1FZC B;  5DJT B;  2FFD A;  3GCE A;  1M90 Q;  1KTM A;  1MUU A;  1VQN P;  3MZW B;  3Q5R A;  2H7H A;  5TJH A;  3AE7 C;  2OYH B;  2YKQ A;  3RL0 D;  2HMJ A;  2XRX A;  3Q3D A;  2FBW C;  4HM3 A;  1N7L A;  2WPR A;  2HPC A;  2XZR A;  2E76 C;  1YTZ T;  1FJK A;  3JCU E;  2KIK A;  2K88 A;  1CI6 B;  2GBX A;  5E79 H;  1LTS C;  2W90 A;  1YJW P;  1JCC A;  4WWI A;  3B71 A;  2K9Y A;  2N1T A;  2V7Q H;  4EMJ B;  5C39 A;  1SQQ K;  3CCU P;  2AEJ A;  4RES B;  2XKM A;  4L73 A;  1L4A B;  3CCR P;  3HD7 B;  1NTZ G;  4ASV A;  5AVX B;  1FBM A;  1ZXG A;  2UWJ E;  3W67 A;  2HOD B;  2E74 C;  3O8Z A;  1FJP A;  4ZNC A;  1BCC J;  2C9N Y;  1USE A;  1Q2N A;  3JCU H;  1VCK A;  1Q7Y Q;  3P8M C;  2N1T D;  4TLF A;  3KDP B;  4IFM A;  1KFM A;  1NO4 A;  3GL0 A;  1CW5 A;  4NBF D;  1USD A;  1RQU A;  3LIE A;  4H0L B;  1L0L D;  2KP8 A;  5B5E E;  2D2C C;  3HTK A;  2I7F A;  1Y8A A;  3T97 B;  4KJM A;  1UIX A;  3SWF A;  2IYO A;  1RF1 A;  4JBZ A;  2R5D A;  1IJD B;  1KQF B;  2OTK E;  1SQP G;  3WUT A;  5AVT B;  4HM4 A;  2E75 B;  5KAF E;  2RN0 A;  2WPS A;  3TYY A;  3V6I A;  3CLQ A;  3MUD A;  2DE7 D;  2XR8 A;  3H1I J;  3L71 J;  1LP1 A;  1KZU B;  1KB9 D;  3RK3 D;  4NBA D;  3RBZ A;  1SQX J;  5KJ7 C;  4UB8 E;  4GOD A;  1D7M A;  3QWO C;  1NTZ K;  2A45 H;  3KPE A;  2JZA A;  1GU5 A;  4L75 A;  1W2B O;  4IL6 X;  1FDM A;  1L0N G;  2QJP C;  1YI2 P;  2ZYD A;  2V7Q J;  1T2K C;  3GKE A;  2W83 C;  1HJB A;  2E5Y A;  5APV A;  2JKV A;  1H0T A;  2O01 H;  3HE5 A;  4L74 A;  1T3J A;  3AE1 C;  5KAF H;  3CC2 P;  1GK6 A;  1FQT A;  1AVY A;  3R2P A;  4UB8 H;  4H44 B;  1JUN A;  5KLI B;  1IK7 A;  1KB9 E;  3RK3 E;  3B5N C;  2Q6Q A;  5AW3 B;  1RH5 B;  2LXC B;  1YIJ P;  1GL2 B;  2WSS H;  1NU1 J;  1SQP K;  2Y9Y A;  3TNU A;  1K9M Q;  3H1J G;  5AVQ B;  2QVA A;  3NTN A;  3BRV B;  3CD6 P;  5KKZ B;  1HVV A;  1SQV D;  3M9B A;  4N6J A;  1NDO A;  2A06 G;  4HKV A;  2FYU G;  1Z56 A;  1ZME C;  3L4F A;  3CME P;  3A3Y B;  2OYH A;  1VPC A;  4HH2 A;  4H13 B;  4OWF A;  1FU1 A;  4YPC A;  1KOR A;  2JWD A;  5AVS B;  3TDK A;  1KB9 H;  1EDL A;  1L0N K;  1E5W A;  2KS1 B;  1MFT A;  2WIT A;  3CWB D;  1CI6 A;  4U7J A;  2KZJ A;  3LW5 H;  4U3F G;  1EZV G;  3CCS P;  2KOG A;  4IFF A;  2ZVN B;  2O01 J;  5CBN A;  1L4A A;  3H32 A;  2KB7 P;  2NUM A;  2HYN A;  1QL2 A;  1R5S A;  1BDC A;  5AW7 B;  1SLQ A;  1VQK P;  2KYV A;  2CK3 H;  4PV1 B;  1M8O B;  1FDI A;  1OXZ A;  2RMZ A;  2Z4E A;  2Q3E A;  5CJ0 A;  4DT0 A;  3R4Y A;  3D70 A;  3H1K J;  1IFD A;  3AE9 C;  3L72 D;  4I1L A;  3CWB E;  1KB9 I;  1L4A D;  4YTP C;  4M3L A;  3HD7 D;  4NBG D;  1S9K D;  3A7O A;  1LTB C;  1EG9 A;  4I7Z B;  5AVU B;  3PRJ A;  1VF5 C;  1N7S A;  4NB8 D;  1J1E B;  3HUS C;  4R4M A;  3V2R A;  1G8K B;  3T97 A;  5AVR B;  3L73 J;  2FKW B;  1HTL C;  1WRG A;  2C0W A;  3VCA A;  1GTW A;  3CXH D;  1SFC B;  2OYO A;  1NTK K;  4H0L D;  4D6T E;  2ZYG A;  5CCG D;  3AE8 C;  2HMK A;  1KQS O;  2QA4 P;  5CCH A;  1IK9 A;  4ZKU A;  2IYP A;  4RJT A;  2HML A;  5CBO A;  3JC2 2;  3U1A A;  3AEG C;  3L72 E;  2BMO A;  3H1L G;  3LW5 J;  3S9O A;  3IAO A;  2I1K A;  2E75 D;  2B89 A;  2K37 A;  3FWN A;  3GF7 A;  1YYC A;  4GOE A;  3D89 A;  1SQB J;  3AE3 C;  4I2L C;  2BCC J;  1VQO P;  2QJK C;  3M9H A;  2HMN A;  5CCH D;  3S1K A;  3CXH E;  3HUS A;  4NB9 D;  1OX3 A;  2KXP B;  1EXI A;  4IFD K;  1K05 A;  4YXW H;  1FE6 A;  2E76 B;  4OGQ C;  3GLM A;  4OVN F;  3MP7 B;  2YMY A;  4YXD C;  3GG2 A;  2WSC J;  4QUR A;  1X22 A;  1RF1 B;  2YIU C;  1ZR2 A;  3O6Q A;  2WPV B;  1GL2 A;  1NTK J;  3KYQ A;  2BAS A;  3BVH A;  1O7N A;  1A02 J;  3P8C E;  3MHV A;  1EXJ A;  1GK4 A;  4DJG A;  3TSI A;  5M1B A;  3Q5S A;  1LP1 B;  1S5L E;  3H1I D;  3AEA C;  1FZB A;  3KZI E;  2NUK A;  1SVF A;  3VMH D;  1NH4 A;  2E74 B;  3BAS A;  4H44 D;  3CXH H;  3RL0 C;  5APT A;  2IBZ D;  2GBW A;  2KNC A;  1PZQ A;  1BGY G;  5KLV G;  2ZVO B;  1K04 A;  1GL2 D;  1LTT C;  4EI2 A;  3OW2 O;  1IFM A;  4AUW A;  1PP9 J;  1E79 H;  1NTM K;  2E42 A;  4BWN A;  3HE5 B;  4C7N B;  3CCJ P;  3GHG C;  1VQ5 P;  3G4S P;  3AEF C;  2JP3 A;  1SJG A;  1ZW0 A;  2D2C B;  4PD4 D;  2QRX A;  1FZE A;  1S5L H;  4K35 A;  2B9B A;  3KZI H;  4NBB D;  3G9R A;  2HG5 D;  4H13 D;  1HGZ A;  3WUV A;  3C1L A;  1JNM A;  3SFD C;  1KYO I;  3H1I E;  1N73 C;  4AAY B;  5CMZ A;  1KD1 Q;  4QUP A;  1A02 F;  1OVV A;  4HJL A;  1FZF A;  3A5T A;  2JO1 A;  3TGU G;  1GU4 A;  4D6T J;  4NPE A;  2IBZ E;  2XV5 A;  1NWQ A;  1O7H A;  4HM7 A;  1K73 Q;  3VMX A;  1NU1 D;  3TNU B;  3CXH I;  2RKL A;  3Q5P A;  2YFI A;  2QIW A;  1KMI Z;  3VMY A;  3L72 J;  3GF3 A;  1PPJ G;  3RBX A;  3L70 J;  1LWU C;  2QJP B;  3L74 J;  1S1C X;  4PD4 E;  3G6E P;  3M91 A;  5KLV K;  1NTM J;  2N9B A;  2QE7 H;  1YQ4 C;  1LT1 A;  1HWT C;  3RL0 g;  4PV1 D;  2ZFC A;  3FWL A;  3W68 A;  2B87 A;  1FZA A;  3N4X A;  1PGO A;  3RK2 B;  1SFC A;  2NRG A;  1CSB A;  5L8R J;  3FXD A;  4DOJ A;  2JO6 A;  5BU5 A;  1NU1 E;  1RF0 A;  2XND H;  5APQ A;  1AQT A;  3B5N B;  3H32 B;  2AEF A;  1LT9 A;  3D6Y A;  1NTZ E;  3A2A A;  5AW0 B;  2WT7 A;  4PD4 H;  3L75 J;  1SQP D;  3AZC A;  1QVG O;  4XA4 A;  2ITA A;  2MKV A;  3VMI D;  2ZXE B;  1RY3 A;  1QL1 A;  2ZYL A;  3H1K D;  3H6P A;  3OAK A;  3PHL A;  1XTC C;  5CJ4 A;  2JWA A;  1L0N D;  2O01 N;  2YO3 A;  1N7S B;  4HB1 A;  2IBZ I;  1BE3 J;  1RHZ B;  5GTH H;  3VTP C;  4B86 A;  1DEB A;  3L73 D;  2A45 G;  2PAJ A;  1U7M A;  3KXD A;  2YXR B;  3H1H G;  4KHX A;  5EFW B;  1O7W A;  1SQP E;  1SQQ J;  3C9I A;  1M56 D;  2M8R A;  4PD4 I;  1KIL C;  1ZR4 A;  2E76 D;  1NOH A;  2QG4 A;  1IFN A;  1CZQ A;  3L36 A;  3M06 A;  1NYK A;  1LTG C;  3H1K E;  2POH A;  5AW1 B;  4O9B A;  3CX5 I;  5AW5 B;  5CXM A;  1VDF A;  5BOK A;  1QX8 A;  1FZC C;  1FAV A;  1M1J C;  1X79 B;  1TU3 F;  1L0N E;  2ZT9 D;  1FC2 C;  3A0B E;  2ZYA A;  1Q86 Q;  4C7N A;  1SQB D;  1U7J A;  2I8D A;  4HM1 A;  1L0L G;  2BCC D;  1JMM A;  2O3J A;  3L73 E;  1BDD A;  3AE4 C;  1VF5 B;  1S5L X;  1SS1 A;  2E74 D;  3HUS B;  4HM6 A;  3VP8 A;  3BCC G;  1YQ3 C;  2H43 A;  4Y99 C;  4JF7 A;  4EOT A;  1ZOY C;  3O6Q B;  4HM8 A;  2K1A A;  1EDJ A;  1NTK D;  2WSE H;  4JYC A;  1R8E A;  1EZV D;  2C0X A;  2D2C D;  3A0B H;  4QDD A;  2JJL A;  3VN0 A;  2N9Y B;  4GIF A;  3TK1 A;  3F89 A;  3E7K A;  4L76 A;  2AXT H;  5KJ7 A;  2OTL P;  1GDT A;  1NTZ J;  3HD7 C;  3CCM P;  1SQB E;  1O7M A;  2P67 A;  2BCC E;  1FDO A;  2KNC B;  1OFC X;  3P32 A;  2J58 A;  1YBK A;  1M1J A;  4CPG A;  3QH9 A;  1DX7 A;  1HH0 A;  3VP9 A;  2O1J A;  3C0D A;  2WPQ A;  1AV1 A;  1PP9 D;  5K5G B;  2QM8 A;  1YTZ I;  2Y0D A;  2B88 A;  1NHL A;  3V5B A;  1G8J B;  1J1D B;  1JM1 A;  1L0L K;  2OYI C;  5CCG C;  3M0D C;  3EQQ A;  1JY2 O;  3CMA P;  1IFJ A;  2R3S A;  1NTK E;  1RE4 C;  1EZV E;  2OQQ A;  3B5N A;  4N3Y B;  3B4S A;  2FY8 A;  1MKM A;  3EQ2 A;  1HF9 A;  2B24 A;  3MTU E;  5DJU B;  1GD2 E;  1SQP J;  1UII A;  1FS0 E;  1AJY A;  3N0Q A;  1VQ7 P;  3RK2 D;  1PV3 A;  1G1I A;  4D6T D;  1DD3 A;  2M3E A;  3WMM 0;  1SQV G;  2NVE A;  1OWA A;  4TT3 H;  5H2F E;  3WUU A;  5AW6 B;  1PL5 A;  2WSC H;  5AEW A;  3UIA A;  4LGD E;  3B5N D;  3CCV P;  1PP9 E;  3CCE P;  1URQ C;  1H89 A;  4MN4 C;  5KTB A;  2FYU K;  2GUV A;  2XU6 A;  3L70 D;  2WSE J;  2L5G B;  1AFO A;  1SP4 A;  1L0N J;  3AE2 C;  3I56 P;  1KYO D;  3L74 D;  5APX A;  1T8Z A;  1S4X A;  1W5C E;  2IPP A;  1NTM D;  3CWB G;  3IN6 A;  1LTJ C;  4GOF A;  3VMA A;  1HBW A;  3VOP A;  4LC1 A;  2XNX A;  2B87 B;  2Y0E A;  1OVU A;  2OYI A;  4XE5 B;  3I55 P;  3GB4 A;  2YNY A;  2R5B A;  2Y9Z A;  5H2F H;  3M9Q A;  3GL2 A;  1N73 B;  1H88 A;  4C46 A;  1N7S D;  1JEK A;  1LGH B;  3D6Z A;  2QM7 A;  1IZN B;  1DH3 A;  1LT9 B;  3CI9 A;  2WSF J;  2W27 A;  3D71 A;  3P8C D;  2WT7 B;  3L75 D;  3H1J J;  1JY3 O;  3H1L E;  3L70 E;  1KYO E;  3L74 E;  3AE6 C;  5KKZ C;  4W80 A;  3MIW A;  1NKN A;  4NPF X;  2FXP A;  1SQV K;  1Q90 D;  1NTM E;  1EZV I;  1N8R Q;  2FYN C;  1IFP A;  2FYU J;  2ZJS E;  3N7N A;  4WY4 C;  4HJG H;  2NPS C;  1LTA C;  2WMM A;  5KLV D;  4QDF B;  1M1K Q;  1LTJ A;  2NZ2 A;  1QLE D;  3PTZ A;  1BE3 D;  1FZG A;  2O1K A;  3GZY A;  2FYZ A;  2IZ0 A;  1IC2 A;  3V4Q A;  4A7P A;  2PRR A;  4I6M C;  4RKU J;  3EFG A;  4U3F J;  1KYO H;  5TIS E;  3WU2 H;  3L75 E;  1SQQ D;  3KHU A;  1X8Y A;  1VF5 D;  1M7L A;  2W8Z A;  3EN1 A;  4BRY A;  3PJS K;  1HUC A;  2YFJ A;  2R44 A;  3RGU A;  1EDI A;  2ZXX A;  3SWY A;  2NWF A;  2JDI H;  3U59 A;  2WQY C;  3IR9 A;  2KUB A;  3V2P A;  1RE3 C;  2BMQ A;  1S3J A;  1VQP P;  1BCC G;  5KLV E;  3FX0 A;  3PP5 A;  1PGQ A;  2FFD C;  4NBE D;  2YMK A;  3AED C;  3VCP A;  3M0A A;  4WVZ A;  4WB4 A;  3I5C A;  1BE3 E;  4WY4 A;  1FOS E;  5AEU A;  5TIS H;  1PPJ D;  4I7Z C;  4PJ0 E;  5BVZ A;  1SQQ E;  1OZH A;  1AQ5 A;  2GA1 A;  3CC7 P;  3CX5 D;  2KLU A;  5AVV B;  1S2E A;  1RFS A;  1QEX A;  1P84 E;  1VL2 A;  1PIX A;  3L37 A;  1Y47 A;  3H1I G;  3L71 G;  3AE5 C;  2N1T C;  2HR3 A;  1KIL B;  2PGD A;  3V2N A;  1S72 P;  3AEB C;  1ULI A;  2DE5 D;  1NAY A;  1SQX G;  1ZLL A;  1NTZ D;  2Y0C A;  3BRT B;  1NAF A;  5AW8 B;  4PJ0 H;  3CCL P;  4W7Z A;  2R3C A;  3H1L J;  1LTI C;  1PPJ E;  2PFX A;  1M1J B;  4DCK A;  3CCQ P;  1X0T A;  4NBH D;  2HMM A;  2VRS A;  3E1R A;  1GW4 A;  5AVW B;  3GHG A;  2QJY C;  1ZRT E;  2W6J H;  1VQM P;  4NBD D;  1P84 H;  3EFF K;  3CX5 E;  3ITK A;  3VMZ A;  1O7G A;  3C8V A;  4QUQ A;  3ZDM A;  1NYH A;  2G3A A;  3RK3 C;  2AXC A;  2P2U A;  4Y99 B;  1NJI Q;  1N73 A;  1VQ9 P;  5AVY B;  1H8A A;  5KAI E;  1Y9B A;  4QCK A;  2L91 A;  4ZKP A;  2Z5H A;  4GKG A;  3HRN A;  2CPS A;  1EC5 A;  3GTS A;  1RF1 C;  5GTH E;  2LXB A;  1NU1 G;  3H1H D;  2ZT9 C;  3K5B A;  1JB0 J;  3CPW O;  3MUD C;  4DZO A;  4IOI H;  1SFC D;  1NVO A;  2H88 C;  4HM5 A;  3NFQ A;  2LR2 A;  5BU8 B;  3CX5 H;  2K9J A;  1LWU A;  5AVZ B;  1SQX K;  2KLV A;  2M3B A;  4Z1M H;  1VQ8 P;  1BGY J;  5KLV J;  2GM4 A;  1OVR A;  4QDF A;  1JY2 P;  5KAI H;  2P7J A;  1RIE A;  1P84 I;  1T3U A;  2JEE A;  1KFN A;  1K8A Q;  1LJ2 A;  1GMJ A;  4AQR D;  3AEE C;  2WWW A;  1T6A A;  3FOU A;  2KK7 A;  2P10 A;  2OYI B;  3Q1M A;  2MJZ A;  2WZ7 A;  1R5L A;  1BSH A;  4JYB A;  2H8P D;  2YXQ B;  3H1H E;  1IO4 A;  5HL4 A;  3BCC D;  1JTH A;  5GTI E;  1KN7 A;  3GOB A;  1ZP0 C;  3TGU J;  1PFI A;  2IZ1 A;  4ASW A;  1YJ9 P;  4NPD A;  3GW6 A;  4HKZ H;  3SWK A;  1NKZ B;  1NU1 K;  3H1J D;  2SPZ A;  2E43 A;  1L2P A;  4GT1 A;  3HE4 B;  5AW4 B;  3H1K G;  4JPZ B;  2KSE A;  1G1J A;  1URQ B;  2KSJ A;  5B5E H;  2AXT E;  2A06 D;  1DD4 A;  2FYU D;  2XSO A;  1L0L E;  2OYH C;  1JM0 A;  4GDO A;  3USS A;  5GTI H;  3NXS A;  1FOS F;  1LTJ B;  3BAT A;  3MD0 A;  2BEZ F;  2KI7 B;  3L73 G;  2IFM A;  4OH8 B;  5AW2 B;  3BCC E;  2JR8 A;  1X9V A;  3RK2 C;  4AYC A;  4U3F D;  1JY3 P;  4P1C H;  3G3Z A;  1KIL A;  3SSU A;  3H1J E;  4QDC A;  4BRY B;  2G8Y A;  3A0H E;  1L4A C;  2M5A A;  1M57 D;  3TF5 A;  3OA7 A;  3Q2Y A;  2HLO A;  3F5H A;  4ZMD A;  2A06 E;  1EQ7 A;  2FYU E;  4LLH A;  1FZC A;  2Q3I A;  3H25 A;  1J2J B;  2A45 I;  2QSI A;  3P7K A;  1OW7 A;  2OGU A;  2Z5I A;  3V4W A;  1JOC A;  1AVO A;  1SQB G;  2FYN B;  2WTY A;  1G2C B;  3VYI A;  2YKP A;  2K3R A;  1VQL P;  2BCC G;  1KIL D;  3GTE A;  2QJK B;  4WY4 B;  5B66 E;  1VQ4 P;  5KJ7 D;  2NPS B;  2WSF H;  1IFI A;  1GW3 A;  4H0L C;  2FXM A;  1W2E A;  1NGM B;  2BEQ D;  4OGQ B;  4AIV A;  1N7S C;  4U3F E;  2YVJ B;  2BMR A;  4HM0 A;  1OW6 A;  3A0H H;  1T2K D;  4Y28 J;  2W6A A;  2YIU B;  2V4H A;  1JY2 N;  5APU A;  1JMB A;  1NTK G;  1DIP A;  2YFL A;  3H1H J;  1VM9 A;  3VMG D;  2E75 C;  3PLN A;  1HJ0 A;  4HM2 A;  3OJA B;  3DQY A;  2IFN A;  1Q90 C;  4R4L A;  2OTJ P;  2IDB A;  1VQ6 P;  3FXE A;  3HD7 A;  3FGA D;  1HGV A;  1SQV E;  5B66 H;  2I1J A;  1BSN A;  4EIJ A;  3RL0 B;  3V2Q A;  2HOD A;  5CCH C;  1KIL E;  2CKF A;  2Q9I A;  4EDF A;  2W6B A;  1OMI A;  3H1L D;  2DE6 D;  3U1C A;  2FFD B;  2OAR A;  1ZV8 A;  2ZAE B;  2Q1K A;  2P58 A;  1PP9 G;  1ZN5 A;  3KQG A;  1WQL A;  1SQB K;  3GHG B;  4C7R A;  4QMA A;  3CL3 D;  4K3A A;  1L0L J;  2M0B A;  5CCG A;  1PGJ A;  3M0D A;  2XDJ A;  2FXO A;  3AEC C;  1JO5 A;  1Q81 Q;  2E4Q A;  1RE4 A;  2HPC B;  1UUW A;  3BCC J;  1LNQ A;  4RO0 A;  4H44 C;  5KLI C;  4WBA A;  1OW8 A;  1AA0 A;  2E5T A;  3GMA A;  1ULJ A;  1KQG B;  4BXL A;  3L35 A;  2HFE D;  4D6T G;  4P1B H;  1GL2 C;  1U57 A;  3IFM A;  2N1T B;  1N2D C;  2LKM A;  3MGN A;  5AW9 B;  1WMK A;  3GZX A;  3WU2 E;  2R32 A;  3HE4 A;  2H89 C;  3L72 G;  1URQ A;  2C9L Y;  1N86 A;  2K9J B;  1JY3 N;  4UB6 E;  2J59 M;  2QPZ A;  1LWU B;  2DW3 A;  3ABV C;  3L70 G;  3SFE C;  1OIP A;  3L74 G;  2GUS A;  1S9K E;  2IX7 C;  1BGY D;  4H13 C;  1QGK B;  2YKO A;  1NTM G;  1WT6 A;  1BCC D;  5APY A;  5CHX A;  2QJY B;  1RQV A;  2B1X A;  3EWK A;  1KC8 Q;  3CC4 P;  4NBC D;  3LID A;  1JCD A;  1YJN P;  1EDK A;  1URQ D;  3RK3 B;  2CPB A;  1J1D C;  3HTK B;  1MV8 A;  4IL6 E;  4N78 D;  1XTG B;  1JTH B;  4UB6 H;  4JQ0 D;  3S4R A;  3G71 P;  5APW A;  3L75 G;  1P84 D;  2ZT9 B;  3TGU D;  3L71 D;  4EYY Q;  1MZ9 A;  3IF4 A;  1SQV J;  2RH0 A;  4PV1 C;  1BGY E;  2YO2 A;  1BCC E;  1KV4 A;  2XSH A;  4HYT B;  2HMO A;  1G2C A;  2WVR A;  1SQX D;  2J5U A;  2KZI A;  3II6 A;  2PP6 A;  1Q82 Q;  2NPS A;  1MFZ A;  4IL6 H;  2Q5U A;  2KS1 A;  1QVF O;  1DEE G;  2QEX P;  2Q3W A;  1BE3 G;  1J1E C;  1H0T B;  3CWB J;  2Q7C A; 
#chains in the Genus database with same CATH homology
 2JZA A;  3DQY A;  1Q90 C;  4EMJ B;  4H44 D;  4QDF A;  1O7W A;  4H0L D;  4D6T E;  1SQP E;  1ULI A;  2DE5 D;  2E4P A;  4PV1 D;  2GBW A;  1RIE A;  1SQB E;  1SQV E;  2QJP C;  1O7M A;  2BCC E;  3L75 E;  2HMK A;  3GKE A;  2NVF A;  1VF5 D;  2CKF A;  2E76 D;  3EN1 A;  3FOU A;  1PPJ E;  4P1C H;  2B1X A;  3TGU E;  2HML A;  2YFJ A;  2JO6 A;  3H1J E;  4NBC D;  4QDC A;  3L72 E;  2DE6 D;  3GB4 A;  2BMO A;  3L71 E;  1UUV A;  3C0D A;  1NYK A;  4OGQ D;  3H1K E;  2NVG A;  4NBH D;  2HMM A;  1NU1 E;  2NWF A;  3H1H E;  1SJG A;  2QJY C;  2E75 D;  2BMQ A;  3GL2 A;  2NUM A;  1ZRT E;  1VCK A;  5CXM A;  5BOK A;  1FQT A;  4NBD D;  1SQX E;  2A06 E;  1WQL A;  5HL4 A;  1G8J B;  3D89 A;  2FYU E;  1O7P A;  1JM1 A;  1L0N E;  2ZT9 D;  3CX5 E;  3GL0 A;  4NBF D;  5KLV E;  1NTZ E;  3EQQ A;  4NBB D;  1O7G A;  4NBE D;  4QUQ A;  3AZC A;  4H13 D;  1NTK E;  1KB9 E;  3GOB A;  3VCP A;  3GCE A;  4HM1 A;  2QJK C;  1EZV E;  2HMN A;  3H1I E;  2E4Q A;  3L73 E;  4AAY B;  1BE3 E;  1UUW A;  3CXH E;  3GTE A;  2I7F A;  4NB9 D;  5AEU A;  3L70 E;  3H1L E;  2B24 A;  4QCK A;  2E74 D;  1KYO E;  3L74 E;  4QUP A;  4HJL A;  5KKZ C;  4HM6 A;  3GTS A;  3VMI D;  2IBZ E;  5KLI C;  3CWB E;  1O7H A;  2ZYL A;  4HM7 A;  1NTM E;  1BGY E;  3N0Q A;  4NBG D;  2FYN C;  2HMJ A;  1ULJ A;  2XRX A;  4QUR A;  4AIV A;  1BCC E;  4HM3 A;  1EG9 A;  2XSH A;  1SQQ E;  2YIU C;  2HMO A;  4U3F E;  2YVJ B;  2BMR A;  4P1B H;  4HM0 A;  4HM4 A;  4NB8 D;  1NDO A;  2YFI A;  2NVE A;  1G8K B;  4HKV A;  4HM5 A;  1O7N A;  2DE7 D;  2XR8 A;  4HM8 A;  2XSO A;  4QDF B;  1L0L E;  5AEW A;  1RFS A;  3GZX A;  2GBX A;  3VCA A;  1PP9 E;  1P84 E;  2YFL A;  2D2C D;  4QDD A;  4NBA D;  1VM9 A;  3VMG D;  2Q3W A;  3GZY A;  4PD4 E;  2NUK A;  2QPZ A;  3BCC E;  4HM2 A;  3VMH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...