1BCCE

Cytochrome bc1 complex from chicken
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 44
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1bccE02
4HJLA 2FYUE 4NBBD 2XR8A 2BMRA 1SQPE 2NUKA 3L72E 4QUPA 2QJYC 3GZYA 3DQYA 2DE6D 1NTKE 1VF5D 2NVFA 3EQQA 2NVEA 2HMMA 4HM1A 2E75D 5KLIC 1G8KB 1PP9E 4HM5A 2E4QA 3GL2A 3H1HE 4QURA 2BCCE 2D2CD 3GL0A 2E74D 5AEUA 1NTZE 1KB9E 5AEWA 3GZXA 3H1LE 2QJPC 4NB8D 3BCCE 4NBED 4AAYB 1SQBE 1UUVA 2ZYLA 4HKVA 2YIUC 3GTEA 1G8JB 1VM9A 1ULIA 4NBFD 2NUMA 2A06E 2HMLA 1BCCE 4QDCA 4U3FE 2YVJB 4HM6A 4QDFB 4OGQD 4HM0A 2XSOA 4PD4E 1WQLA 4NBDD 4P1BH 4NBCD 2IBZE 2NVGA 3L73E 4HM2A 1ULJA 4D6TE 4QUQA 4AIVA 4H0LD 1VCKA 2QJKC 1ZRTE 1EZVE 1UUWA 3D89A 4EMJB 4QCKA 1SQQE 3N0QA 2I7FA 2HMKA 1O7MA 2DE5D 1Q90C 3L75E 5KLVE 1O7GA 3GB4A 4H13D 4P1CH 1NDOA 2E76D 3GCEA 1BE3E 3VMID 2HMOA 3GOBA 2Q3WA 1NU1E 1RIEA 2FYNC 5CXMA 2NWFA 3CWBE 2YFJA 5KKZC 1PPJE 3VCAA 1SJGA 2GBWA 4HM7A 4PV1D 3VMHD 1NTME 2B24A 1NYKA 4HM4A 3L70E 1O7PA 3L71E 3CXHE 5BOKA 1L0LE 3EN1A 1FQTA 2XRXA 2YFLA 2ZT9D 3H1KE 3GTSA 2JO6A 1SQVE 3C0DA 2HMNA 1L0NE 3GKEA 2B1XA 3L74E 4NBHD 4NBAD 4QDDA 1O7HA 4NBGD 1RFSA 3FOUA 5HL4A 4HM3A 1JM1A 2XSHA 3H1IE 2HMJA 2YFIA 3AZCA 2GBXA 1BGYE 1O7WA 2BMQA 2DE7D 1KYOE 2JZAA 1SQXE 4H44D 4QDFA 3CX5E 4NB9D 2CKFA 1P84E 3H1JE 1EG9A 2BMOA 2E4PA 2QPZA 1O7NA 4HM8A 3TGUE 3VCPA 3VMGD
chains in the Genus database with same CATH superfamily
2FYUE 5AW2B 1SQQD 5K5GB 1RY3A 4NBBD 2BMRA 4HH2A 2ZYGA 2OYHA 1RF0C 3HE4B 1KILE 1JTHA 1VQPP 4KHXA 3TSIA 4Y99C 2RKLA 1FZGA 2NZ2A 1JM0A 1BE3J 4WY4B 5AEWA 3H1LE 3H1KD 1KZUB 3BCCE 3CI9A 1SQBE 1GW3A 1S5LH 2B89A 3D6YA 3OW2O 1YYCA 5AW0B 2KUBA 1GU4A 4HB1A 2OGUA 1FDIA 2E5YA 3B5NA 5APQA 2K88A 5TJHA 1QL1A 4Y99B 3P8CD 2OARA 1N7LA 1ZV8A 3G9RA 3ZDMA 1W2BO 3Q2YA 1LT9B 1D7MA 2OYOA 2E76D 2Q5UA 5KTBA 2ZAEB 1J2JB 1UIXA 1RE3C 1USDA 3CWBE 4U3FG 4I6MC 1EDIA 3AE1C 1KB9D 1DEEG 3IAOA 1FE6A 4BRYA 1NYKA 2A06D 2RN0A 3SWFA 3V5BA 2IBZI 1K9MQ 2KIKA 4QDDA 5AVTB 5APSA 2YO3A 5AVUB 1RFSA 1XTGB 2KZJA 3WUTA 5KLVG 1NWQA 4LGDE 4D6TD 1VQNP 2E76B 2QIWA 3QH9A 1Y9BA 4H44D 4HJLA 1ZR2A 4ZKUA 2KYVA 2NVEA 1SQVG 3T97A 2KS1A 1L0NG 3PHLA 5KLIC 1LTJC 3FXDA 3GL2A 1TU3F 2DW3A 1KYOH 3FXEA 1SQQJ 1EZVI 2D2CD 3L70D 4H44B 2Q9IA 1S2EA 3M9HA 2FYUK 1Q2NA 1S1CX 3H1KJ 4GOFA 2BCCG 2POHA 4EOTA 2D2CB 2JR8A 4DOJA 2K9YA 5DJUB 1FDOA 1GDTA 3GCEA 1OVRA 1R5SA 1L4AD 3A5TA 4PV1D 3UIAA 2WT7A 4EIJA 3CC7P 2IBZG 4PV1C 1O7PA 4Z1MH 3NMDA 5TISE 1NKZB 4CPGA 4DJGA 3K5BA 3HUSB 2WQYC 4EYYQ 2FYZA 5AW3B 2YKOA 3QWOC 5M1BA 3R2PA 4OWFA 1O7WA 1OIPA 2B88A 2JZAA 1Q82Q 1GL2A 5AW5B 1L4AB 4PV1B 2KLVA 3L71G 2JP3A 2K9JB 4D6TJ 1EZVG 2P10A 4HM1A 1LTSC 4WBAA 3H1HE 1RF0A 1N7SD 1PL5A 3WU2E 1IFIA 4OH8B 1FBMA 4IL6E 1KTMA 1LTIC 3CMEP 2KZIA 4NPDA 3BATA 3LW5H 3L70J 2M3BA 2XSOA 3V2PA 2FYUD 2WITA 3MZWB 1JY3P 1N7SB 1EZVE 1J1DC 3O6QA 5B66H 1KILD 2P2UA 2DE5D 5AVQB 2NWFA 3Q5RA 4IFMA 2AEFA 1NJIQ 2YFJA 3H1LD 1PGQA 3BCCD 1SQBD 3AE5C 1RE3A 3WUVA 2JO6A 2G3AA 2I8DA 2HMNA 2YIUB 1KQGB 3MD0A 4HM3A 2O3JA 1MUUA 3GHGA 1K73Q 1RF1C 3CC2P 3AE8C 1DIPA 4HM8A 2AEJA 3TGUE 4RJTA 2YMKA 4QMAA 5KJ7D 2QVAA 5KJ7C 3TDKA 3CWBD 2E4QA 1NGMB 3CLQA 2E42A 3EFFK 2ZXXA 1IFJA 3G3ZA 4R4LA 5AEUA 3VP8A 1RF1B 3GZXA 3N4XA 1LTJA 5CCHC 1UUVA 3HTKB 1VPCA 3I5CA 1LT1A 3P8MC 1KC8Q 4UB8E 2A45I 1BDCA 2IZ0A 1GK6A 1QGKB 3L74J 3W67A 2OYHB 3L73E 4WWIA 5APXA 3B5ND 1ZRTE 4I1LA 1JTHB 3N7NA 2C0XA 3TYYA 5KAIE 1NVOA 3L72G 1O7GA 2FYUJ 4TT3H 5E79H 4AQRD 2GUSA 3LIEA 2IYPA 3M0DC 5AW1B 2W6JH 1Z56A 2XNDH 3II6A 2W27A 2WSFH 1IFDA 1T3UA 2JO1A 3IN6A 3H1IJ 2C9NY 3B5NB 3GKEA 3H1LJ 1M8OB 3M9QA 5AW9B 3C9IA 3BCCJ 1SQBJ 1OFCX 5DJTB 3M0AA 4I2LC 2Y0DA 1YJWP 2Q3IA 4N78E 2PFXA 3CX5E 2LXBA 2JEEA 1SQPE 2NUKA 3L72E 1K8AQ 2WZ7A 3GF3A 2OYIC 1FZCA 2L5GB 1VF5D 2V4HA 1LWUA 1G8KB 1VF5C 2L91A 3IR9A 1KORA 1CZQA 3PP5A 3PLNA 3SSUA 3CWBJ 3G71P 1IJDB 2A45G 3GTEA 2IX7C 5B5EE 4HM6A 1VF5B 1YHQP 1T2KD 1PP9G 3ABVC 1IC2A 1IZNB 3D6ZA 2R44A 3BRTB 3VP9A 2KS1B 1J1EC 3ITKA 4EMJB 4RESB 1DH3A 4GODA 3N0QA 3A3YB 1G2CA 1O7MA 3L75E 4H13D 3H1HD 3OA7A 4H13C 1SFCC 1EXIA 1VQOP 2V7QJ 3D70A 3NFQA 2LR2A 4PD4I 2ZT9D 2QJPB 1KN7A 3GTSA 1U7MA 1SQXJ 4LC1A 3CD6P 1MFTA 3RK3E 1X8YA 2WSEH 2P67A 4H13B 4IL6X 1KQSO 4QDFA 3CXHH 1OVUA 1EZVD 3H1JE 4W7ZA 1YITP 1O7NA 3VMID 3VMXA 4L73A 1L0LG 3GZYA 2HFED 1H88A 1GL2D 1S5LE 2R5DA 2KLUA 1GL2C 1ZW0A 4QURA 3HRNA 1GK4A 2A45H 3S1KA 1BSHA 4L74A 4ZMDA 3VMAA 2Y9ZA 2ZYLA 2BEZF 2LKMA 1NH4A 1SQPK 3VOPA 1P84I 2C9LY 1NTKG 1HJ0A 1GL2B 2GM4A 1WQLA 5CCHA 3USSA 1HTLC 4P1BH 3TGUD 3G6EP 3P32A 2FXOA 1LTTC 2AXCA 3AE6C 1W2EA 5C39A 4NPFX 5CXMA 2HR3A 1PPJE 3B71A 1SJGA 4Y28J 1YJNP 3I56P 3V2RA 2YMYA 1PGJA 3H1HJ 1LNQA 2FY8A 2OTJP 5CBNA 3M0DA 1KD1Q 1FC2C 3L73D 2Q6QA 1KYOE 2AXTH 3O6QB 1ZRTD 2O1JA 2E74C 1LTGC 5GTIH 3P7KA 3GHGC 3A0BH 3PH0A 2QJYC 4HJGH 2YKPA 4OGQC 2OYIA 1NU1G 2UWJE 1ZLLA 3CCRP 1BGYG 3TNUA 3RL0C 2CPBA 1YQ4C 4NBED 1NTMG 4AAYB 3JCUH 3U59A 1NAFA 3GHGB 2WSCJ 3NTNA 4U3FE 2YVJB 1GD2E 2J58A 4N78D 4YXDC 2N9YB 3CX5D 4NBCD 1N73A 1NAYA 3MUDA 1SQPD 4R4MA 3L72D 4AIVA 3MGNA 2W90A 3CPWO 4JQ0D 1FZBA 2KB7P 5KLVE 2QM8A 3TGUJ 4PD4H 1FZFA 4A7PA 1NU1E 2FYNC 2KI7B 1BCCG 2K1AA 5KLIB 4TLFA 1PGOA 2XDJA 1LTJB 1PGPA 1NTME 2N1TA 2GA1A 1CI6A 1SFCA 2G8YA 2XRXA 2B87A 1SQVE 1L0NE 3Q5SA 4NBAD 2O01H 4NPEA 1BE3G 1JOCA 2FXPA 2H88C 3AZCA 1M1JC 5CJ4A 2WPSA 5KKZC 3VMGD 3L75D 3L73J 2Q1KA 2QRXA 1U7JA 3V4QA 1MFZA 2BCCE 3KQGA 1P84H 4MN4C 1FZCC 5APUA 2JKVA 4KT0J 5BU5A 1LWUC 4B86A 3VTPC 3JC22 2W6BA 4HKVA 1DEBA 3RK3D 5B66E 1KV4A 2HMLA 2NUMA 3RK3C 1S4XA 3KPEA 4GKGA 2R3SA 3H1JD 1S9KE 1LP1A 3E7KA 3MTUE 2IBZE 1AVOA 4I7ZC 1FZCB 3B8EB 4GDOA 3VYIA 4EDFA 1USEA 1LWUB 2XV5A 1Q90D 1Q90C 1HGVA 3AEEC 1SQPJ 3L72J 3RK3B 4C7NA 2QSIA 3VCAA 1RQUA 2NPSA 1SP4A 3C8VA 4HM4A 4I7ZB 1UIIA 3GW6A 3L71E 2ZJSE 1S5LX 1H0TA 1R5LA 2PP6A 1NTZG 4W80A 3KYQA 3A2AA 3R4YA 1SQQG 4L76A 4NBGD 2FXMA 1OMIA 5HL4A 5KLVK 2KK7A 4EI2A 4AYCA 1NU1K 2OQQA 2HODA 1G2CB 1NTMK 1YJ9P 1QX8A 1J1DB 1WT6A 1DD4A 2P1JA 3EQQA 3H1KG 2R5BA 1OVVA 1RE4C 2E75D 1EC5A 1SQVK 2KSEA 1L0NK 1QVFO 1PPJD 2QA4P 2E75C 3V4WA 1JY2O 5CCGC 3MIWA 1HWTC 3L75J 1NTZE 4PJ0H 4JPZB 1RQVA 4GT1A 1OW8A 2W6AA 1BSNA 1JMMA 1G8JB 1GW4A 1M1KQ 1FOSE 2W83C 4QDFB 1KYOD 2M8RA 3CXHI 5E79E 1Y8AA 2E75B 2IDBA 2HLOA 1JO5A 4C7RA 4LLHA 3AE9C 5CCHD 2AEMA 3E1RA 2IFMA 4M3LA 3H1JJ 1VQKP 3HD7A 2MKVA 2HMOA 2A06G 3GOBA 1QL2A 2E5TA 2R32A 3M9BA 4O9BA 3VMYA 2JDIH 4DT0A 2B24A 3KZIH 4D6TG 1KFNA 3E1IA 1Q81Q 3SFDC 5CMZA 4U3FD 2H7HA 2GUVA 2Y0EA 2P7JA 5BVZA 2JJLA 1VQ7P 4NB9D 3V6IA 2J5UA 3FGAD 1K04A 3L70G 1JCDA 1URQC 5KLVD 1M1JA 3EFGA 1NOHA 1NU1D 2WWWA 5AVRB 2H8PD 3L35A 4WB4A 1NTMD 3Q1MA 3TK1A 1G1JA 5AW8B 1X9VA 1EXJA 1GMJA 1SQVD 2WTYA 1L0ND 4HKZH 1Q7YQ 1ULIA 2WPRA 4NBFD 3Q3DA 3G4SP 1H8AA 4JYCA 1ZP0C 1YQ3C 1FJKA 1N8RQ 1KB9H 1PV3A 1AQTA 4HM2A 3PRJA 2IYOA 2M0BA 1RH5B 1NTZK 2WPVB 5KAFH 4K35A 1N73C 2OYIB 3MUDC 3I55P 2BCCD 1HJBA 1VQMP 3CCSP 1VQ5P 3LIDA 3TNUB 3W68A 1S72P 4HM7A 1VQLP 3A7OA 3VMHD 1X0TA 3RBZA 3CXHE 1KFMA 1AJYA 1OZHA 3GMAA 2Z4EA 1W5CE 3L36A 3M06A 2KSJA 5GTHH 2N1TD 1N73B 1SFCD 1NYHA 2N9BA 3EQ2A 1S9KD 2N1TC 1JM1A 2IBZD 1ZMEC 1DX7A 1YIJP 4RKUJ 4U3FJ 2BMOA 5L8RJ 2FFDA 5H2FH 1ZN5A 4JBZA 1J1EB 2HMMA 2ZVOB 5CJ0A 3L74G 1PP9E 4HM5A 1EDJA 1GZLA 2N1TB 1CI6B 1SFCB 3AEDC 2B87B 5KLVJ 3L71D 4RO0A 4OVNF 1RE4A 4NB8D 1AVYA 1N2DC 5CCGA 2FYUG 1NTMJ 5AVVB 2JWAA 3FWNA 1OX3A 1SQVJ 1L0NJ 3RK2C 5AVWB 3H1IG 1E5WA 3A0HH 4QUQA 3F89A 3CC4P 4UB6H 2QJKC 1WRGA 3H1LG 3BCCG 1SQBG 4P1CH 2CK3H 2K37A 2HYNA 1NTZD 3B4SA 2IFNA 1M57D 1NO4A 3LW5J 2AXTE 1L0LE 4YXWH 3RL0g 2BCCJ 5GTIE 2QJKB 2NPSD 2NRGA 5AW7B 2OTKE 2KNCA 4IOIH 2NPSC 3A0BE 4NBHD 2HPCA 1LP1B 1T6AA 2YNYA 4JF7A 1JUNA 3H1IE 2HMJA 3AEFC 2YO2A 1JCCA 3CWBG 1JY3O 2P58A 3IF4A 1S3JA 2ZYDA 2QPZA 2OTLP 3VCPA 1IK9A 1LT9C 4C7NB 3JCUE 1NTKE 1A02F 2NPSB 1URQA 3F5HA 1H0TB 2E74D 3CL3D 3VMZA 2Z5IA 1QEXA 3L71J 1FOSF 2HODB 2YXRB 4OGQD 5CBOA 1M90Q 2E76C 4PD4E 1T8ZA 3AECC 1VQ4P 4N3YB 3KDPB 3RL0D 3CCLP 3C1LA 1SQXG 2E74B 1HVVA 1H89A 2I7FA 1G1IA 2QJYB 1SLQA 4YTPC 1RIEA 1CSBA 2FKWB 1A02J 5APWA 3HD7D 4OGQB 4U7JA 4W7YA 1ZOYC 4H44C 3HD7C 3GLMA 3H32A 3RL0B 4BWNA 1NTZJ 2IZ1A 1VDFA 3CCMP 3U1CA 1JNMA 2I1KA 1GU5A 3AE4C 1EDLA 4XE5B 2VRSA 3BRVB 1BGYE 1SQXE 2D2CC 1P84E 2M5AA 1E79H 5AVSB 4ZKPA 2B1XA 3HD7B 2XR8A 1MV8A 2YKQA 1IK7A 1L0LK 4DZOA 2PRRA 3S4RA 3DQYA 4HYTB 3H25A 2KP8A 3L4FA 2WSFJ 4N6JA 3WMM0 2FYNB 3CXHD 4C46A 1L2PA 2E43A 2WVRA 3HUSC 3BASA 3EWKA 1SQBK 2V7QH 4ZNCA 1BCCE 3CCQP 5AVYB 5AW6B 2YXQB 2J59M 1NTKK 1VQ8P 1N86A 3H1HG 1L4AC 1M1JB 3FX0A 1GTWA 2R3CA 2XU6A 1KQLA 5KKZB 1IFNA 1PZQA 1PP9D 5AW4B 1BE3E 3NXSA 2Q7CA 3HE4A 5APTA 1WMKA 5BOKA 2MJZA 2KXPB 3EN1A 2YFLA 2QG4A 4WY4A 3HE5B 2Y0CA 1KB9I 3JSVC 1VL2A 1X79B 2DE7D 1N7SC 1M56D 1EG9A 5TISH 4PJ0E 3L74D 1JY2N 1IFMA 3Q5PA 3IFMA 2FFDC 1HGZA 1LT9A 2RMZA 1FU1A 3M91A 1L0LD 4DCKA 1U57A 1SQXK 1AQ5A 2WSEJ 1Q86Q 3TGUG 1QVGO 2YIUC 2QEXP 4K3AA 2HG5D 1KILC 4IFFA 3AEGC 3VN0A 3CX5I 3H1ID 3CCVP 5CCGD 1Y47A 3S9OA 1FAVA 3MP7B 2FFDB 1MKMA 1PIXA 3WU2H 1OXZA 4KJMA 4IL6H 3MHVA 1FJPA 1VCKA 1SS1A 2K3RA 1NTKD 3KZIE 1SVFA 1SQQE 1R8EA 2HMKA 3GB4A 4WVZA 4GOEA 1KILB 3AE3C 3KXDA 2O1KA 2PGDA 1AFOA 1PP9J 2SPZA 1NKNA 3L73G 1EQ7A 1FS0E 2RH0A 4L75A 4YPCA 3H1KE 1OW7A 3C0DA 2WMMA 5AVZB 4PD4D 5APVA 1O7HA 4XFJA 4XA4A 1OW6A 5EFWB 4ASVA 2OYHC 1LJ2A 2BASA 3RGUA 2BMQA 3RBXA 2WSCH 3U1AA 2E4PA 2WSSH 2XKMA 3PTZA 4ASWA 3P8CE 3CCJP 4QUPA 5APYA 2DE6D 3KHUA 2QM7A 1K05A 5AVXB 1CW5A 2BEQD 2ZVNB 3AE7C 1YI2P 2ITAA 2CPSA 3GG2A 3O8ZA 1LTAC 2KNCB 1KB9E 1JEKA 2HPCB 1URQD 3B5NC 1AA0A 1VM9A 1SQPG 5KAFE 2A06E 1FDMA 4QDCA 3PJSK 1L0LJ 2WPQA 2ZXEB 1BGYD 4HM0A 3HUSA 1SQXD 4NBDD 3GF7A 1P84D 4D6TE 1RHZB 3V2NA 3SWYA 1PFIA 1AV1A 3D71A 5CHXA 3SWKA 1M7LA 2I1JA 1OWAA 1LGHB 4QCKA 1L4AA 1URQB 4UB8H 2FBWC 3OJAB 1HBWA 1MZ9A 5GTHE 2H89C 2M3EA 2K9JA 3HE5A 1NTKJ 3L70E 3AEAC 1FQTA 5H2FE 5KAIH 3BVHA 1BCCD 2B9BA 2QE7H 2XNXA 1SQQK 4BRYB 3H6PA 3L75G 2XSHA 1KQFB 2LXCB 3CCEP 4JYBA 2IPPA 4AUWA 1ZXGA 2Y9YA 4BXLA 2XZRA 1FZEA 1BE3D 1N7SA 2NVFA 3SFEC 3CMAP 1T3JA 3H32B 3CX5H 3GL0A 1HUCA 1T2KC 1VQ6P 3FWLA 3OAKA 3CCUP 2QJPC 2O01J 3A0HE 3T97B 3H1JG 1YTZI 4UB6E 2O01N 3AE2C 2C0WA 1KMIZ 1HF9A 1KYOI 2JWDA 2M5AB 4IFDK 2NVGA 1KILA 1ULJA 3TF5A 4H0LD 1NU1J 1FZAA 2ZFCA 1UUWA 3D89A 1JMBA 4H0LC 4GIFA 1BGYJ 1HH0A 2ZT9C 5B5EH 2KOGA 1XTCC 2Z5HA 1DD3A 1NDOA 1IO4A 3WUUA 2Q3WA 1IFPA 1LTBC 2ZYAA 3RK2D 1JY2P 3V2QA 2GBWA 2W8ZA 3L37A 1JB0J 1VQ9P 1YTZT 1YBKA 5BU8B 1EDKA 2H43A 1RF1A 4H0LB 1X22A 1JY3N 3L74E 2ZT9B 1BDDA 1NHLA 2WT7B 2PAJA 1QLED 3FOUA 3HTKA 4WY4D 2YFIA 1ZR4A 2GBXA 2Q3EA 5KJ7A 4WY4C 1BCCJ 3AEBC 2CKFA 1PPJG 3RK2B
chains in the Genus database with same CATH topology
4HJLA 2FYUE 4NBBD 2XR8A 2BMRA 1SQPE 2NUKA 3L72E 4QUPA 2QJYC 3GZYA 3DQYA 2DE6D 1NTKE 1VF5D 2NVFA 3EQQA 2NVEA 2HMMA 4HM1A 2E75D 5KLIC 1G8KB 1PP9E 4HM5A 2E4QA 3GL2A 3H1HE 4QURA 2BCCE 2D2CD 3GL0A 2E74D 5AEUA 1NTZE 1KB9E 5AEWA 3GZXA 3H1LE 2QJPC 4NB8D 3BCCE 4NBED 4AAYB 1SQBE 1UUVA 2ZYLA 4HKVA 2YIUC 3GTEA 1G8JB 1VM9A 1ULIA 4NBFD 2NUMA 2A06E 2HMLA 1BCCE 4QDCA 4U3FE 2YVJB 4HM6A 4QDFB 4OGQD 4HM0A 2XSOA 4PD4E 1WQLA 4NBDD 4P1BH 4NBCD 2IBZE 2NVGA 3L73E 4HM2A 1ULJA 4D6TE 4QUQA 4AIVA 4H0LD 1VCKA 2QJKC 1ZRTE 1EZVE 1UUWA 3D89A 4EMJB 4QCKA 1SQQE 3N0QA 2I7FA 2HMKA 1O7MA 2DE5D 1Q90C 3L75E 5KLVE 1O7GA 3GB4A 4H13D 4P1CH 1NDOA 2E76D 3GCEA 1BE3E 3VMID 2HMOA 3GOBA 2Q3WA 1NU1E 1RIEA 2FYNC 5CXMA 2NWFA 3CWBE 2YFJA 5KKZC 1PPJE 3VCAA 1SJGA 2GBWA 4HM7A 4PV1D 3VMHD 1NTME 2B24A 1NYKA 4HM4A 3L70E 1O7PA 3L71E 3CXHE 5BOKA 1L0LE 3EN1A 1FQTA 2XRXA 2YFLA 2ZT9D 3H1KE 3GTSA 2JO6A 1SQVE 3C0DA 2HMNA 1L0NE 3GKEA 2B1XA 3L74E 4NBHD 4NBAD 4QDDA 1O7HA 4NBGD 1RFSA 3FOUA 5HL4A 4HM3A 1JM1A 2XSHA 3H1IE 2HMJA 2YFIA 3AZCA 2GBXA 1BGYE 1O7WA 2BMQA 2DE7D 1KYOE 2JZAA 1SQXE 4H44D 4QDFA 3CX5E 4NB9D 2CKFA 1P84E 3H1JE 1EG9A 2BMOA 2E4PA 2QPZA 1O7NA 4HM8A 3TGUE 3VCPA 3VMGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJL A;  2FYU E;  4NBB D;  2XR8 A;  2BMR A;  1SQP E;  2NUK A;  3L72 E;  4QUP A;  2QJY C;  3GZY A;  3DQY A;  2DE6 D;  1NTK E;  1VF5 D;  2NVF A;  3EQQ A;  2NVE A;  2HMM A;  4HM1 A;  2E75 D;  5KLI C;  1G8K B;  1PP9 E;  4HM5 A;  2E4Q A;  3GL2 A;  3H1H E;  4QUR A;  2BCC E;  2D2C D;  3GL0 A;  2E74 D;  5AEU A;  1NTZ E;  1KB9 E;  5AEW A;  3GZX A;  3H1L E;  2QJP C;  4NB8 D;  3BCC E;  4NBE D;  4AAY B;  1SQB E;  1UUV A;  2ZYL A;  4HKV A;  2YIU C;  3GTE A;  1G8J B;  1VM9 A;  1ULI A;  4NBF D;  2NUM A;  2A06 E;  2HML A;  1BCC E;  4QDC A;  4U3F E;  2YVJ B;  4HM6 A;  4QDF B;  4OGQ D;  4HM0 A;  2XSO A;  4PD4 E;  1WQL A;  4NBD D;  4P1B H;  4NBC D;  2IBZ E;  2NVG A;  3L73 E;  4HM2 A;  1ULJ A;  4D6T E;  4QUQ A;  4AIV A;  4H0L D;  1VCK A;  2QJK C;  1ZRT E;  1EZV E;  1UUW A;  3D89 A;  4EMJ B;  4QCK A;  1SQQ E;  3N0Q A;  2I7F A;  2HMK A;  1O7M A;  2DE5 D;  1Q90 C;  3L75 E;  5KLV E;  1O7G A;  3GB4 A;  4H13 D;  4P1C H;  1NDO A;  2E76 D;  3GCE A;  1BE3 E;  3VMI D;  2HMO A;  3GOB A;  2Q3W A;  1NU1 E;  1RIE A;  2FYN C;  5CXM A;  2NWF A;  3CWB E;  2YFJ A;  5KKZ C;  1PPJ E;  3VCA A;  1SJG A;  2GBW A;  4HM7 A;  4PV1 D;  3VMH D;  1NTM E;  2B24 A;  1NYK A;  4HM4 A;  3L70 E;  1O7P A;  3L71 E;  3CXH E;  5BOK A;  1L0L E;  3EN1 A;  1FQT A;  2XRX A;  2YFL A;  2ZT9 D;  3H1K E;  3GTS A;  2JO6 A;  1SQV E;  3C0D A;  2HMN A;  1L0N E;  3GKE A;  2B1X A;  3L74 E;  4NBH D;  4NBA D;  4QDD A;  1O7H A;  4NBG D;  1RFS A;  3FOU A;  5HL4 A;  4HM3 A;  1JM1 A;  2XSH A;  3H1I E;  2HMJ A;  2YFI A;  3AZC A;  2GBX A;  1BGY E;  1O7W A;  2BMQ A;  2DE7 D;  1KYO E;  2JZA A;  1SQX E;  4H44 D;  4QDF A;  3CX5 E;  4NB9 D;  2CKF A;  1P84 E;  3H1J E;  1EG9 A;  2BMO A;  2E4P A;  2QPZ A;  1O7N A;  4HM8 A;  3TGU E;  3VCP A;  3VMG D; 
#chains in the Genus database with same CATH topology
 2FYU E;  5AW2 B;  1SQQ D;  5K5G B;  1RY3 A;  4NBB D;  2BMR A;  4HH2 A;  2ZYG A;  2OYH A;  1RF0 C;  3HE4 B;  1KIL E;  1JTH A;  1VQP P;  4KHX A;  3TSI A;  4Y99 C;  2RKL A;  1FZG A;  2NZ2 A;  1JM0 A;  1BE3 J;  4WY4 B;  5AEW A;  3H1L E;  3H1K D;  1KZU B;  3BCC E;  3CI9 A;  1SQB E;  1GW3 A;  1S5L H;  2B89 A;  3D6Y A;  3OW2 O;  1YYC A;  5AW0 B;  2KUB A;  1GU4 A;  4HB1 A;  2OGU A;  1FDI A;  2E5Y A;  3B5N A;  5APQ A;  2K88 A;  5TJH A;  1QL1 A;  4Y99 B;  3P8C D;  2OAR A;  1N7L A;  1ZV8 A;  3G9R A;  3ZDM A;  1W2B O;  3Q2Y A;  1LT9 B;  1D7M A;  2OYO A;  2E76 D;  2Q5U A;  5KTB A;  2ZAE B;  1J2J B;  1UIX A;  1RE3 C;  1USD A;  3CWB E;  4U3F G;  4I6M C;  1EDI A;  3AE1 C;  1KB9 D;  1DEE G;  3IAO A;  1FE6 A;  4BRY A;  1NYK A;  2A06 D;  2RN0 A;  3SWF A;  3V5B A;  2IBZ I;  1K9M Q;  2KIK A;  4QDD A;  5AVT B;  5APS A;  2YO3 A;  5AVU B;  1RFS A;  1XTG B;  2KZJ A;  3WUT A;  5KLV G;  1NWQ A;  4LGD E;  4D6T D;  1VQN P;  2E76 B;  2QIW A;  3QH9 A;  1Y9B A;  4H44 D;  4HJL A;  1ZR2 A;  4ZKU A;  2KYV A;  2NVE A;  1SQV G;  3T97 A;  2KS1 A;  1L0N G;  3PHL A;  5KLI C;  1LTJ C;  3FXD A;  3GL2 A;  1TU3 F;  2DW3 A;  1KYO H;  3FXE A;  1SQQ J;  1EZV I;  2D2C D;  3L70 D;  4H44 B;  2Q9I A;  1S2E A;  3M9H A;  2FYU K;  1Q2N A;  1S1C X;  3H1K J;  4GOF A;  2BCC G;  2POH A;  4EOT A;  2D2C B;  2JR8 A;  4DOJ A;  2K9Y A;  5DJU B;  1FDO A;  1GDT A;  3GCE A;  1OVR A;  1R5S A;  1L4A D;  3A5T A;  4PV1 D;  3UIA A;  2WT7 A;  4EIJ A;  3CC7 P;  2IBZ G;  4PV1 C;  1O7P A;  4Z1M H;  3NMD A;  5TIS E;  1NKZ B;  4CPG A;  4DJG A;  3K5B A;  3HUS B;  2WQY C;  4EYY Q;  2FYZ A;  5AW3 B;  2YKO A;  3QWO C;  5M1B A;  3R2P A;  4OWF A;  1O7W A;  1OIP A;  2B88 A;  2JZA A;  1Q82 Q;  1GL2 A;  5AW5 B;  1L4A B;  4PV1 B;  2KLV A;  3L71 G;  2JP3 A;  2K9J B;  4D6T J;  1EZV G;  2P10 A;  4HM1 A;  1LTS C;  4WBA A;  3H1H E;  1RF0 A;  1N7S D;  1PL5 A;  3WU2 E;  1IFI A;  4OH8 B;  1FBM A;  4IL6 E;  1KTM A;  1LTI C;  3CME P;  2KZI A;  4NPD A;  3BAT A;  3LW5 H;  3L70 J;  2M3B A;  2XSO A;  3V2P A;  2FYU D;  2WIT A;  3MZW B;  1JY3 P;  1N7S B;  1EZV E;  1J1D C;  3O6Q A;  5B66 H;  1KIL D;  2P2U A;  2DE5 D;  5AVQ B;  2NWF A;  3Q5R A;  4IFM A;  2AEF A;  1NJI Q;  2YFJ A;  3H1L D;  1PGQ A;  3BCC D;  1SQB D;  3AE5 C;  1RE3 A;  3WUV A;  2JO6 A;  2G3A A;  2I8D A;  2HMN A;  2YIU B;  1KQG B;  3MD0 A;  4HM3 A;  2O3J A;  1MUU A;  3GHG A;  1K73 Q;  1RF1 C;  3CC2 P;  3AE8 C;  1DIP A;  4HM8 A;  2AEJ A;  3TGU E;  4RJT A;  2YMK A;  4QMA A;  5KJ7 D;  2QVA A;  5KJ7 C;  3TDK A;  3CWB D;  2E4Q A;  1NGM B;  3CLQ A;  2E42 A;  3EFF K;  2ZXX A;  1IFJ A;  3G3Z A;  4R4L A;  5AEU A;  3VP8 A;  1RF1 B;  3GZX A;  3N4X A;  1LTJ A;  5CCH C;  1UUV A;  3HTK B;  1VPC A;  3I5C A;  1LT1 A;  3P8M C;  1KC8 Q;  4UB8 E;  2A45 I;  1BDC A;  2IZ0 A;  1GK6 A;  1QGK B;  3L74 J;  3W67 A;  2OYH B;  3L73 E;  4WWI A;  5APX A;  3B5N D;  1ZRT E;  4I1L A;  1JTH B;  3N7N A;  2C0X A;  3TYY A;  5KAI E;  1NVO A;  3L72 G;  1O7G A;  2FYU J;  4TT3 H;  5E79 H;  4AQR D;  2GUS A;  3LIE A;  2IYP A;  3M0D C;  5AW1 B;  2W6J H;  1Z56 A;  2XND H;  3II6 A;  2W27 A;  2WSF H;  1IFD A;  1T3U A;  2JO1 A;  3IN6 A;  3H1I J;  2C9N Y;  3B5N B;  3GKE A;  3H1L J;  1M8O B;  3M9Q A;  5AW9 B;  3C9I A;  3BCC J;  1SQB J;  1OFC X;  5DJT B;  3M0A A;  4I2L C;  2Y0D A;  1YJW P;  2Q3I A;  4N78 E;  2PFX A;  3CX5 E;  2LXB A;  2JEE A;  1SQP E;  2NUK A;  3L72 E;  1K8A Q;  2WZ7 A;  3GF3 A;  2OYI C;  1FZC A;  2L5G B;  1VF5 D;  2V4H A;  1LWU A;  1G8K B;  1VF5 C;  2L91 A;  3IR9 A;  1KOR A;  1CZQ A;  3PP5 A;  3PLN A;  3SSU A;  3CWB J;  3G71 P;  1IJD B;  2A45 G;  3GTE A;  2IX7 C;  5B5E E;  4HM6 A;  1VF5 B;  1YHQ P;  1T2K D;  1PP9 G;  3ABV C;  1IC2 A;  1IZN B;  3D6Z A;  2R44 A;  3BRT B;  3VP9 A;  2KS1 B;  1J1E C;  3ITK A;  4EMJ B;  4RES B;  1DH3 A;  4GOD A;  3N0Q A;  3A3Y B;  1G2C A;  1O7M A;  3L75 E;  4H13 D;  3H1H D;  3OA7 A;  4H13 C;  1SFC C;  1EXI A;  1VQO P;  2V7Q J;  3D70 A;  3NFQ A;  2LR2 A;  4PD4 I;  2ZT9 D;  2QJP B;  1KN7 A;  3GTS A;  1U7M A;  1SQX J;  4LC1 A;  3CD6 P;  1MFT A;  3RK3 E;  1X8Y A;  2WSE H;  2P67 A;  4H13 B;  4IL6 X;  1KQS O;  4QDF A;  3CXH H;  1OVU A;  1EZV D;  3H1J E;  4W7Z A;  1YIT P;  1O7N A;  3VMI D;  3VMX A;  4L73 A;  1L0L G;  3GZY A;  2HFE D;  1H88 A;  1GL2 D;  1S5L E;  2R5D A;  2KLU A;  1GL2 C;  1ZW0 A;  4QUR A;  3HRN A;  1GK4 A;  2A45 H;  3S1K A;  1BSH A;  4L74 A;  4ZMD A;  3VMA A;  2Y9Z A;  2ZYL A;  2BEZ F;  2LKM A;  1NH4 A;  1SQP K;  3VOP A;  1P84 I;  2C9L Y;  1NTK G;  1HJ0 A;  1GL2 B;  2GM4 A;  1WQL A;  5CCH A;  3USS A;  1HTL C;  4P1B H;  3TGU D;  3G6E P;  3P32 A;  2FXO A;  1LTT C;  2AXC A;  3AE6 C;  1W2E A;  5C39 A;  4NPF X;  5CXM A;  2HR3 A;  1PPJ E;  3B71 A;  1SJG A;  4Y28 J;  1YJN P;  3I56 P;  3V2R A;  2YMY A;  1PGJ A;  3H1H J;  1LNQ A;  2FY8 A;  2OTJ P;  5CBN A;  3M0D A;  1KD1 Q;  1FC2 C;  3L73 D;  2Q6Q A;  1KYO E;  2AXT H;  3O6Q B;  1ZRT D;  2O1J A;  2E74 C;  1LTG C;  5GTI H;  3P7K A;  3GHG C;  3A0B H;  3PH0 A;  2QJY C;  4HJG H;  2YKP A;  4OGQ C;  2OYI A;  1NU1 G;  2UWJ E;  1ZLL A;  3CCR P;  1BGY G;  3TNU A;  3RL0 C;  2CPB A;  1YQ4 C;  4NBE D;  1NTM G;  4AAY B;  3JCU H;  3U59 A;  1NAF A;  3GHG B;  2WSC J;  3NTN A;  4U3F E;  2YVJ B;  1GD2 E;  2J58 A;  4N78 D;  4YXD C;  2N9Y B;  3CX5 D;  4NBC D;  1N73 A;  1NAY A;  3MUD A;  1SQP D;  4R4M A;  3L72 D;  4AIV A;  3MGN A;  2W90 A;  3CPW O;  4JQ0 D;  1FZB A;  2KB7 P;  5KLV E;  2QM8 A;  3TGU J;  4PD4 H;  1FZF A;  4A7P A;  1NU1 E;  2FYN C;  2KI7 B;  1BCC G;  2K1A A;  5KLI B;  4TLF A;  1PGO A;  2XDJ A;  1LTJ B;  1PGP A;  1NTM E;  2N1T A;  2GA1 A;  1CI6 A;  1SFC A;  2G8Y A;  2XRX A;  2B87 A;  1SQV E;  1L0N E;  3Q5S A;  4NBA D;  2O01 H;  4NPE A;  1BE3 G;  1JOC A;  2FXP A;  2H88 C;  3AZC A;  1M1J C;  5CJ4 A;  2WPS A;  5KKZ C;  3VMG D;  3L75 D;  3L73 J;  2Q1K A;  2QRX A;  1U7J A;  3V4Q A;  1MFZ A;  2BCC E;  3KQG A;  1P84 H;  4MN4 C;  1FZC C;  5APU A;  2JKV A;  4KT0 J;  5BU5 A;  1LWU C;  4B86 A;  3VTP C;  3JC2 2;  2W6B A;  4HKV A;  1DEB A;  3RK3 D;  5B66 E;  1KV4 A;  2HML A;  2NUM A;  3RK3 C;  1S4X A;  3KPE A;  4GKG A;  2R3S A;  3H1J D;  1S9K E;  1LP1 A;  3E7K A;  3MTU E;  2IBZ E;  1AVO A;  4I7Z C;  1FZC B;  3B8E B;  4GDO A;  3VYI A;  4EDF A;  1USE A;  1LWU B;  2XV5 A;  1Q90 D;  1Q90 C;  1HGV A;  3AEE C;  1SQP J;  3L72 J;  3RK3 B;  4C7N A;  2QSI A;  3VCA A;  1RQU A;  2NPS A;  1SP4 A;  3C8V A;  4HM4 A;  4I7Z B;  1UII A;  3GW6 A;  3L71 E;  2ZJS E;  1S5L X;  1H0T A;  1R5L A;  2PP6 A;  1NTZ G;  4W80 A;  3KYQ A;  3A2A A;  3R4Y A;  1SQQ G;  4L76 A;  4NBG D;  2FXM A;  1OMI A;  5HL4 A;  5KLV K;  2KK7 A;  4EI2 A;  4AYC A;  1NU1 K;  2OQQ A;  2HOD A;  1G2C B;  1NTM K;  1YJ9 P;  1QX8 A;  1J1D B;  1WT6 A;  1DD4 A;  2P1J A;  3EQQ A;  3H1K G;  2R5B A;  1OVV A;  1RE4 C;  2E75 D;  1EC5 A;  1SQV K;  2KSE A;  1L0N K;  1QVF O;  1PPJ D;  2QA4 P;  2E75 C;  3V4W A;  1JY2 O;  5CCG C;  3MIW A;  1HWT C;  3L75 J;  1NTZ E;  4PJ0 H;  4JPZ B;  1RQV A;  4GT1 A;  1OW8 A;  2W6A A;  1BSN A;  1JMM A;  1G8J B;  1GW4 A;  1M1K Q;  1FOS E;  2W83 C;  4QDF B;  1KYO D;  2M8R A;  3CXH I;  5E79 E;  1Y8A A;  2E75 B;  2IDB A;  2HLO A;  1JO5 A;  4C7R A;  4LLH A;  3AE9 C;  5CCH D;  2AEM A;  3E1R A;  2IFM A;  4M3L A;  3H1J J;  1VQK P;  3HD7 A;  2MKV A;  2HMO A;  2A06 G;  3GOB A;  1QL2 A;  2E5T A;  2R32 A;  3M9B A;  4O9B A;  3VMY A;  2JDI H;  4DT0 A;  2B24 A;  3KZI H;  4D6T G;  1KFN A;  3E1I A;  1Q81 Q;  3SFD C;  5CMZ A;  4U3F D;  2H7H A;  2GUV A;  2Y0E A;  2P7J A;  5BVZ A;  2JJL A;  1VQ7 P;  4NB9 D;  3V6I A;  2J5U A;  3FGA D;  1K04 A;  3L70 G;  1JCD A;  1URQ C;  5KLV D;  1M1J A;  3EFG A;  1NOH A;  1NU1 D;  2WWW A;  5AVR B;  2H8P D;  3L35 A;  4WB4 A;  1NTM D;  3Q1M A;  3TK1 A;  1G1J A;  5AW8 B;  1X9V A;  1EXJ A;  1GMJ A;  1SQV D;  2WTY A;  1L0N D;  4HKZ H;  1Q7Y Q;  1ULI A;  2WPR A;  4NBF D;  3Q3D A;  3G4S P;  1H8A A;  4JYC A;  1ZP0 C;  1YQ3 C;  1FJK A;  1N8R Q;  1KB9 H;  1PV3 A;  1AQT A;  4HM2 A;  3PRJ A;  2IYO A;  2M0B A;  1RH5 B;  1NTZ K;  2WPV B;  5KAF H;  4K35 A;  1N73 C;  2OYI B;  3MUD C;  3I55 P;  2BCC D;  1HJB A;  1VQM P;  3CCS P;  1VQ5 P;  3LID A;  3TNU B;  3W68 A;  1S72 P;  4HM7 A;  1VQL P;  3A7O A;  3VMH D;  1X0T A;  3RBZ A;  3CXH E;  1KFM A;  1AJY A;  1OZH A;  3GMA A;  2Z4E A;  1W5C E;  3L36 A;  3M06 A;  2KSJ A;  5GTH H;  2N1T D;  1N73 B;  1SFC D;  1NYH A;  2N9B A;  3EQ2 A;  1S9K D;  2N1T C;  1JM1 A;  2IBZ D;  1ZME C;  1DX7 A;  1YIJ P;  4RKU J;  4U3F J;  2BMO A;  5L8R J;  2FFD A;  5H2F H;  1ZN5 A;  4JBZ A;  1J1E B;  2HMM A;  2ZVO B;  5CJ0 A;  3L74 G;  1PP9 E;  4HM5 A;  1EDJ A;  1GZL A;  2N1T B;  1CI6 B;  1SFC B;  3AED C;  2B87 B;  5KLV J;  3L71 D;  4RO0 A;  4OVN F;  1RE4 A;  4NB8 D;  1AVY A;  1N2D C;  5CCG A;  2FYU G;  1NTM J;  5AVV B;  2JWA A;  3FWN A;  1OX3 A;  1SQV J;  1L0N J;  3RK2 C;  5AVW B;  3H1I G;  1E5W A;  3A0H H;  4QUQ A;  3F89 A;  3CC4 P;  4UB6 H;  2QJK C;  1WRG A;  3H1L G;  3BCC G;  1SQB G;  4P1C H;  2CK3 H;  2K37 A;  2HYN A;  1NTZ D;  3B4S A;  2IFN A;  1M57 D;  1NO4 A;  3LW5 J;  2AXT E;  1L0L E;  4YXW H;  3RL0 g;  2BCC J;  5GTI E;  2QJK B;  2NPS D;  2NRG A;  5AW7 B;  2OTK E;  2KNC A;  4IOI H;  2NPS C;  3A0B E;  4NBH D;  2HPC A;  1LP1 B;  1T6A A;  2YNY A;  4JF7 A;  1JUN A;  3H1I E;  2HMJ A;  3AEF C;  2YO2 A;  1JCC A;  3CWB G;  1JY3 O;  2P58 A;  3IF4 A;  1S3J A;  2ZYD A;  2QPZ A;  2OTL P;  3VCP A;  1IK9 A;  1LT9 C;  4C7N B;  3JCU E;  1NTK E;  1A02 F;  2NPS B;  1URQ A;  3F5H A;  1H0T B;  2E74 D;  3CL3 D;  3VMZ A;  2Z5I A;  1QEX A;  3L71 J;  1FOS F;  2HOD B;  2YXR B;  4OGQ D;  5CBO A;  1M90 Q;  2E76 C;  4PD4 E;  1T8Z A;  3AEC C;  1VQ4 P;  4N3Y B;  3KDP B;  3RL0 D;  3CCL P;  3C1L A;  1SQX G;  2E74 B;  1HVV A;  1H89 A;  2I7F A;  1G1I A;  2QJY B;  1SLQ A;  4YTP C;  1RIE A;  1CSB A;  2FKW B;  1A02 J;  5APW A;  3HD7 D;  4OGQ B;  4U7J A;  4W7Y A;  1ZOY C;  4H44 C;  3HD7 C;  3GLM A;  3H32 A;  3RL0 B;  4BWN A;  1NTZ J;  2IZ1 A;  1VDF A;  3CCM P;  3U1C A;  1JNM A;  2I1K A;  1GU5 A;  3AE4 C;  1EDL A;  4XE5 B;  2VRS A;  3BRV B;  1BGY E;  1SQX E;  2D2C C;  1P84 E;  2M5A A;  1E79 H;  5AVS B;  4ZKP A;  2B1X A;  3HD7 B;  2XR8 A;  1MV8 A;  2YKQ A;  1IK7 A;  1L0L K;  4DZO A;  2PRR A;  3S4R A;  3DQY A;  4HYT B;  3H25 A;  2KP8 A;  3L4F A;  2WSF J;  4N6J A;  3WMM 0;  2FYN B;  3CXH D;  4C46 A;  1L2P A;  2E43 A;  2WVR A;  3HUS C;  3BAS A;  3EWK A;  1SQB K;  2V7Q H;  4ZNC A;  1BCC E;  3CCQ P;  5AVY B;  5AW6 B;  2YXQ B;  2J59 M;  1NTK K;  1VQ8 P;  1N86 A;  3H1H G;  1L4A C;  1M1J B;  3FX0 A;  1GTW A;  2R3C A;  2XU6 A;  1KQL A;  5KKZ B;  1IFN A;  1PZQ A;  1PP9 D;  5AW4 B;  1BE3 E;  3NXS A;  2Q7C A;  3HE4 A;  5APT A;  1WMK A;  5BOK A;  2MJZ A;  2KXP B;  3EN1 A;  2YFL A;  2QG4 A;  4WY4 A;  3HE5 B;  2Y0C A;  1KB9 I;  3JSV C;  1VL2 A;  1X79 B;  2DE7 D;  1N7S C;  1M56 D;  1EG9 A;  5TIS H;  4PJ0 E;  3L74 D;  1JY2 N;  1IFM A;  3Q5P A;  3IFM A;  2FFD C;  1HGZ A;  1LT9 A;  2RMZ A;  1FU1 A;  3M91 A;  1L0L D;  4DCK A;  1U57 A;  1SQX K;  1AQ5 A;  2WSE J;  1Q86 Q;  3TGU G;  1QVG O;  2YIU C;  2QEX P;  4K3A A;  2HG5 D;  1KIL C;  4IFF A;  3AEG C;  3VN0 A;  3CX5 I;  3H1I D;  3CCV P;  5CCG D;  1Y47 A;  3S9O A;  1FAV A;  3MP7 B;  2FFD B;  1MKM A;  1PIX A;  3WU2 H;  1OXZ A;  4KJM A;  4IL6 H;  3MHV A;  1FJP A;  1VCK A;  1SS1 A;  2K3R A;  1NTK D;  3KZI E;  1SVF A;  1SQQ E;  1R8E A;  2HMK A;  3GB4 A;  4WVZ A;  4GOE A;  1KIL B;  3AE3 C;  3KXD A;  2O1K A;  2PGD A;  1AFO A;  1PP9 J;  2SPZ A;  1NKN A;  3L73 G;  1EQ7 A;  1FS0 E;  2RH0 A;  4L75 A;  4YPC A;  3H1K E;  1OW7 A;  3C0D A;  2WMM A;  5AVZ B;  4PD4 D;  5APV A;  1O7H A;  4XFJ A;  4XA4 A;  1OW6 A;  5EFW B;  4ASV A;  2OYH C;  1LJ2 A;  2BAS A;  3RGU A;  2BMQ A;  3RBX A;  2WSC H;  3U1A A;  2E4P A;  2WSS H;  2XKM A;  3PTZ A;  4ASW A;  3P8C E;  3CCJ P;  4QUP A;  5APY A;  2DE6 D;  3KHU A;  2QM7 A;  1K05 A;  5AVX B;  1CW5 A;  2BEQ D;  2ZVN B;  3AE7 C;  1YI2 P;  2ITA A;  2CPS A;  3GG2 A;  3O8Z A;  1LTA C;  2KNC B;  1KB9 E;  1JEK A;  2HPC B;  1URQ D;  3B5N C;  1AA0 A;  1VM9 A;  1SQP G;  5KAF E;  2A06 E;  1FDM A;  4QDC A;  3PJS K;  1L0L J;  2WPQ A;  2ZXE B;  1BGY D;  4HM0 A;  3HUS A;  1SQX D;  4NBD D;  3GF7 A;  1P84 D;  4D6T E;  1RHZ B;  3V2N A;  3SWY A;  1PFI A;  1AV1 A;  3D71 A;  5CHX A;  3SWK A;  1M7L A;  2I1J A;  1OWA A;  1LGH B;  4QCK A;  1L4A A;  1URQ B;  4UB8 H;  2FBW C;  3OJA B;  1HBW A;  1MZ9 A;  5GTH E;  2H89 C;  2M3E A;  2K9J A;  3HE5 A;  1NTK J;  3L70 E;  3AEA C;  1FQT A;  5H2F E;  5KAI H;  3BVH A;  1BCC D;  2B9B A;  2QE7 H;  2XNX A;  1SQQ K;  4BRY B;  3H6P A;  3L75 G;  2XSH A;  1KQF B;  2LXC B;  3CCE P;  4JYB A;  2IPP A;  4AUW A;  1ZXG A;  2Y9Y A;  4BXL A;  2XZR A;  1FZE A;  1BE3 D;  1N7S A;  2NVF A;  3SFE C;  3CMA P;  1T3J A;  3H32 B;  3CX5 H;  3GL0 A;  1HUC A;  1T2K C;  1VQ6 P;  3FWL A;  3OAK A;  3CCU P;  2QJP C;  2O01 J;  3A0H E;  3T97 B;  3H1J G;  1YTZ I;  4UB6 E;  2O01 N;  3AE2 C;  2C0W A;  1KMI Z;  1HF9 A;  1KYO I;  2JWD A;  2M5A B;  4IFD K;  2NVG A;  1KIL A;  1ULJ A;  3TF5 A;  4H0L D;  1NU1 J;  1FZA A;  2ZFC A;  1UUW A;  3D89 A;  1JMB A;  4H0L C;  4GIF A;  1BGY J;  1HH0 A;  2ZT9 C;  5B5E H;  2KOG A;  1XTC C;  2Z5H A;  1DD3 A;  1NDO A;  1IO4 A;  3WUU A;  2Q3W A;  1IFP A;  1LTB C;  2ZYA A;  3RK2 D;  1JY2 P;  3V2Q A;  2GBW A;  2W8Z A;  3L37 A;  1JB0 J;  1VQ9 P;  1YTZ T;  1YBK A;  5BU8 B;  1EDK A;  2H43 A;  1RF1 A;  4H0L B;  1X22 A;  1JY3 N;  3L74 E;  2ZT9 B;  1BDD A;  1NHL A;  2WT7 B;  2PAJ A;  1QLE D;  3FOU A;  3HTK A;  4WY4 D;  2YFI A;  1ZR4 A;  2GBX A;  2Q3E A;  5KJ7 A;  4WY4 C;  1BCC J;  3AEB C;  2CKF A;  1PPJ G;  3RK2 B; 
#chains in the Genus database with same CATH homology
 4HJL A;  2FYU E;  4NBB D;  2XR8 A;  2BMR A;  1SQP E;  2NUK A;  3L72 E;  4QUP A;  2QJY C;  3GZY A;  3DQY A;  2DE6 D;  1NTK E;  1VF5 D;  2NVF A;  3EQQ A;  2NVE A;  2HMM A;  4HM1 A;  2E75 D;  5KLI C;  1G8K B;  1PP9 E;  4HM5 A;  2E4Q A;  3GL2 A;  3H1H E;  4QUR A;  2BCC E;  2D2C D;  3GL0 A;  2E74 D;  5AEU A;  1NTZ E;  1KB9 E;  5AEW A;  3GZX A;  3H1L E;  2QJP C;  4NB8 D;  3BCC E;  4NBE D;  4AAY B;  1SQB E;  1UUV A;  2ZYL A;  4HKV A;  2YIU C;  3GTE A;  1G8J B;  1VM9 A;  1ULI A;  4NBF D;  2NUM A;  2A06 E;  2HML A;  1BCC E;  4QDC A;  4U3F E;  2YVJ B;  4HM6 A;  4QDF B;  4OGQ D;  4HM0 A;  2XSO A;  4PD4 E;  1WQL A;  4NBD D;  4P1B H;  4NBC D;  2IBZ E;  2NVG A;  3L73 E;  4HM2 A;  1ULJ A;  4D6T E;  4QUQ A;  4AIV A;  4H0L D;  1VCK A;  2QJK C;  1ZRT E;  1EZV E;  1UUW A;  3D89 A;  4EMJ B;  4QCK A;  1SQQ E;  3N0Q A;  2I7F A;  2HMK A;  1O7M A;  2DE5 D;  1Q90 C;  3L75 E;  5KLV E;  1O7G A;  3GB4 A;  4H13 D;  4P1C H;  1NDO A;  2E76 D;  3GCE A;  1BE3 E;  3VMI D;  2HMO A;  3GOB A;  2Q3W A;  1NU1 E;  1RIE A;  2FYN C;  5CXM A;  2NWF A;  3CWB E;  2YFJ A;  5KKZ C;  1PPJ E;  3VCA A;  1SJG A;  2GBW A;  4HM7 A;  4PV1 D;  3VMH D;  1NTM E;  2B24 A;  1NYK A;  4HM4 A;  3L70 E;  1O7P A;  3L71 E;  3CXH E;  5BOK A;  1L0L E;  3EN1 A;  1FQT A;  2XRX A;  2YFL A;  2ZT9 D;  3H1K E;  3GTS A;  2JO6 A;  1SQV E;  3C0D A;  2HMN A;  1L0N E;  3GKE A;  2B1X A;  3L74 E;  4NBH D;  4NBA D;  4QDD A;  1O7H A;  4NBG D;  1RFS A;  3FOU A;  5HL4 A;  4HM3 A;  1JM1 A;  2XSH A;  3H1I E;  2HMJ A;  2YFI A;  3AZC A;  2GBX A;  1BGY E;  1O7W A;  2BMQ A;  2DE7 D;  1KYO E;  2JZA A;  1SQX E;  4H44 D;  4QDF A;  3CX5 E;  4NB9 D;  2CKF A;  1P84 E;  3H1J E;  1EG9 A;  2BMO A;  2E4P A;  2QPZ A;  1O7N A;  4HM8 A;  3TGU E;  3VCP A;  3VMG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...