1BCCE

Cytochrome bc1 complex from chicken
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
molecule tags Oxidoreductase
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
total genus 44
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1bccE02
3CX5E 2E75D 2YFIA 4QDFA 3L72E 1NDOA 4NBFD 5BOKA 3GTSA 1JM1A 4NB9D 4HM1A 2NWFA 2NVFA 1BCCE 4AIVA 3H1JE 1NU1E 4NBHD 2QJPC 1SQXE 2B1XA 2YVJB 3GKEA 2HMOA 1P84E 3H1HE 1NTME 1ULJA 1UUWA 1RFSA 4HM3A 1L0LE 2HMKA 4QDCA 3EQQA 5KKZC 4NBAD 1O7MA 1VCKA 2YFJA 5AEWA 2ZYLA 1O7HA 1EZVE 4PD4E 1O7NA 2DE6D 2XSHA 3L70E 5AEUA 2D2CD 4H0LD 4HJLA 3L75E 1VF5D 3CWBE 2CKFA 2NVGA 2E76D 4HM6A 2JZAA 1O7WA 3GTEA 2QPZA 4HM4A 3H1LE 2DE5D 3C0DA 3L73E 2GBXA 4HM0A 4HM2A 4NBED 3L71E 4HM7A 4QUPA 3GOBA 1SQBE 5HL4A 1RIEA 4QUQA 4NBDD 2E74D 3H1IE 3TGUE 1O7PA 1KB9E 3VCPA 3DQYA 2JO6A 3GB4A 4AAYB 2BMRA 1SJGA 3BCCE 3CXHE 2I7FA 1ZRTE 3H1KE 3D89A 4EMJB 4H44D 1SQPE 4OGQD 4NB8D 3GCEA 1G8JB 4P1CH 3GZXA 4U3FE 1EG9A 4QDDA 5KLIC 1KYOE 1BE3E 2YIUC 2XR8A 4H13D 4NBCD 2HMNA 1FQTA 3EN1A 1UUVA 4QDFB 3GL0A 1Q90C 1ULIA 3VMGD 1VM9A 4HM8A 1L0NE 3N0QA 3FOUA 3GZYA 2NUKA 1NYKA 2E4PA 2FYNC 2DE7D 1NTKE 2HMLA 4QCKA 5KLVE 2B24A 3L74E 2HMMA 4QURA 1SQQE 1BGYE 2HMJA 4PV1D 2QJYC 2XRXA 2IBZE 2XSOA 4P1BH 3GL2A 3AZCA 1WQLA 1PPJE 4NBGD 1NTZE 2NUMA 4HM5A 2BCCE 5CXMA 2YFLA 2E4QA 1PP9E 2NVEA 4NBBD 2BMQA 1G8KB 2A06E 3VMID 1SQVE 2ZT9D 3VCAA 2BMOA 1O7GA 2FYUE 4D6TE 4HKVA 2GBWA 3VMHD 2Q3WA 2QJKC
chains in the Genus database with same CATH superfamily
1FU1A 2A45G 3OJAB 1H0TB 3IR9A 3SSUA 1VQNP 1IFMA 1KILA 3PLNA 1GL2B 4NB9D 1BE3J 3CXHH 3WMM0 2K1AA 4IOIH 3H1LJ 5KJ7A 2AXCA 4L73A 3BCCD 3GKEA 2YO3A 2HFED 2QJKB 2CPBA 1GK4A 3BASA 1RE3C 4D6TJ 3M0DC 2HPCB 2K9YA 2CKFA 2W6BA 1JOCA 1M8OB 3K5BA 2E76D 3VTPC 1T2KD 3GTEA 2QPZA 2RKLA 2KLUA 1YHQP 5GTHH 1SQBD 3N4XA 1YQ3C 4H13B 3FXDA 2BMRA 2O01H 1SQBG 5AW6B 4ZMDA 4WY4C 3HE4B 1LTTC 1G8JB 5AVZB 1U7MA 3G71P 3L72D 1BE3E 2Z5IA 4WWIA 2XR8A 1PGQA 3GMAA 1FS0E 1ZXGA 3P8CE 3GW6A 3CMAP 1BSHA 2PRRA 4JYBA 2E5YA 2NUKA 1M1JC 3V5BA 5APTA 3HD7D 5C39A 3GG2A 1BGYD 1Y9BA 4U3FD 4XE5B 1LP1A 1KC8Q 4KT0J 1N73C 1CSBA 1BGYG 2K37A 1Q7YQ 1MKMA 1PV3A 2QJYB 1QVFO 2Q9IA 1KB9D 4IFFA 1RF1B 1NKZB 1NJIQ 3PH0A 2M5AA 2LR2A 4C7RA 1HGZA 1OVRA 1RE4C 1G1IA 1JM1A 3O6QA 1VQ4P 3CD6P 3A7OA 5B66E 3HTKB 1LTAC 1NHLA 2SPZA 1MZ9A 1SQXE 3V2QA 3C1LA 1P84E 1NTME 5KTBA 2WT7B 1LTBC 1OVVA 1ZR4A 3EQQA 3H1KG 2W27A 1O7HA 3CX5I 1AJYA 2ZYAA 3VMYA 1DEBA 3L74J 1PGJA 1NVOA 1VQ7P 1BE3G 1VQMP 1IC2A 1O7WA 1USDA 2IYPA 2DE5D 4DZOA 2FYNB 1L4AC 4HM7A 1L4AA 1PP9G 3T97B 1BCCG 3V4WA 2FXPA 4NB8D 3HD7B 2IBZI 2KS1A 2ITAA 1JM0A 4NBCD 4HH2A 4WVZA 2IPPA 3L74D 5AW7B 4HYTB 1P84D 3MZWB 1EDKA 1S1CX 1LTIC 3L72J 1YJNP 3G3ZA 1VQ6P 4BWNA 3NMDA 1SQQD 4NPDA 2IZ1A 2QA4P 3MUDC 4IFMA 1G8KB 3F89A 1EDIA 2BMOA 4GODA 4K35A 1EQ7A 3CX5E 1DD4A 5APSA 4RO0A 1EXJA 4LGDE 4PJ0H 3GLMA 1NTZJ 2BEQD 2OTKE 2P67A 3H1ID 2M3EA 3WUTA 2AEMA 3CCRP 2ZAEB 3RK3D 1FC2C 1JY2O 1BE3D 1VF5D 3CWBE 1S72P 4W80A 2AEFA 2R44A 2LKMA 1SQXK 5DJTB 2I1KA 3L73E 2A06G 1GL2C 2P58A 4HB1A 4RJTA 2LXBA 5B66H 3IAOA 2K9JA 3HUSA 1SQPE 3B5NC 2K3RA 4LC1A 2Z5HA 1KYOE 1MUUA 3CCQP 1Q82Q 4DT0A 2KSEA 3NFQA 2FYUD 1S9KE 4L76A 1FE6A 5KLVE 2HMJA 3VN0A 1GDTA 2R3CA 2WPQA 3U1CA 1EDJA 2ZT9D 2W6JH 1NTKD 3VMAA 1JB0J 1EZVI 1L0ND 3L70J 1KQFB 1Z56A 3D6YA 4NBFD 1PPJD 2KNCB 1HWTC 2M8RA 2OYIA 3H32A 1HUCA 4L74A 2NVFA 1IK9A 3PRJA 3L73G 1UUWA 4QDCA 1N73A 3SWFA 1ZW0A 3JCUE 2XSHA 1K73Q 2HG5D 1FZFA 1OWAA 1JY3P 3G9RA 1QVGO 3S9OA 1ZOYC 4H13C 1SQXG 3MTUE 4GIFA 3OAKA 3CC7P 4QUQA 1T3JA 3R4YA 2AXTE 2WZ7A 4C7NA 2WITA 4JPZB 4EDFA 2QEXP 1VQ8P 3HD7A 3V4QA 1EC5A 1SQVG 3CX5D 1D7MA 3A3YB 3KZIH 1Q86Q 3O8ZA 4ZKUA 2QIWA 2FYNC 4ZKPA 1NTKE 5GTIE 1GZLA 2E74B 5CCHD 2XRXA 1GU5A 1JY3N 4I7ZB 2KK7A 1KN7A 3H1KD 5AW5B 5KAIH 2WQYC 5CJ0A 1AQTA 2WT7A 2JEEA 2H89C 3AE3C 1NYHA 2Y9YA 3HTKA 2XU6A 1NDOA 2FBWC 5BOKA 4RESB 1L2PA 3GTSA 1L0LK 3B5ND 4Y99C 3M0DA 2K9JB 3CXHD 1S3JA 1OXZA 1YYCA 1M1KQ 1X22A 4HM3A 5AW3B 1LTJA 3H1HD 2POHA 3A0BH 3AE2C 4L75A 1M90Q 3FWLA 3D6ZA 1ZRTD 1NTMJ 3F5HA 3FGAD 2FXMA 1KB9E 2JDIH 3VCPA 3H1JD 4AAYB 3MD0A 2O3JA 5E79E 1RHZB 5KLIC 3CWBG 1FZAA 4BXLA 2BEZF 3H1JJ 1YBKA 1AVYA 1FDIA 1M56D 1L0NK 3C9IA 1PIXA 2B24A 3P8CD 2Y0DA 1DIPA 2XSOA 1WQLA 1X9VA 2HPCA 2E4QA 2V7QH 1ZMEC 2KYVA 3CLQA 3L71J 1OW8A 1P84I 1L0LJ 1WRGA 3TNUB 4D6TG 3B71A 5APVA 3TYYA 4BRYB 3N7NA 4PD4I 2Q5UA 2ZXXA 3L72E 1AQ5A 3Q2YA 1LT9A 1BDCA 3TK1A 1OVUA 3TNUA 1L0LG 4U7JA 1VQ9P 1J2JB 1T6AA 4WY4D 1JEKA 1FAVA 4R4LA 2ZVOB 2KP8A 3NXSA 2OARA 2FYUG 1N7SB 3TSIA 3RK3B 2Q6QA 2O01N 5AVQB 2PGDA 3HE5A 1NTZK 5K5GB 3PTZA 2E75B 2W83C 3OW2O 1NTMG 1PFIA 3H1LG 1VQPP 2GBXA 1NU1J 3V2NA 1JMMA 1BSNA 2E74D 3VP9A 4YTPC 3GB4A 1FJKA 3CXHE 2E42A 1MV8A 4OGQD 2AEJA 4P1CH 1IFPA 2IDBA 2Q1KA 2DW3A 2WSCJ 5AVSB 2E5TA 5E79H 1K8AQ 3VMGD 1JTHA 5APQA 1MFZA 1JUNA 4QCKA 3L72G 1QX8A 1FZEA 2HR3A 4XFJA 3CCMP 2WSEJ 5TJHA 1FZGA 1SQVE 1QL1A 1URQD 2FYUE 2YFIA 4AUWA 2BCCD 4KJMA 4XA4A 3CWBJ 1EXIA 1SQPJ 2WMMA 1KD1Q 3B5NB 3WU2H 2JWAA 3RGUA 1GD2E 1FZCC 2FKWB 5L8RJ 2YFJA 3FWNA 2MJZA 3L70E 1RY3A 4HKZH 1ZN5A 4K3AA 4A7PA 4OGQB 5AW0B 1NAFA 5H2FE 1N7SA 3H1LE 1KILD 3MGNA 1HH0A 2O1KA 2E75C 1RIEA 5KAIE 3EFFK 5KLVJ 3BCCE 5BVZA 2IFMA 5CCGD 4N3YB 2P2UA 2ZFCA 3H1JG 1H0TA 2HMNA 2QM8A 1SQXJ 2PAJA 3L70G 4PV1B 3H32B 3QH9A 1LNQA 1JCDA 1SQVD 2LXCB 1OZHA 3BRTB 2RN0A 1FDOA 3GL2A 1Q2NA 4YPCA 1PP9E 3LIEA 2A06E 1VL2A 2WSCH 4D6TE 1VF5C 2PFXA 3H1IJ 3V2PA 1HBWA 2L91A 1NTZD 5DJUB 5KLVK 2K88A 2AXTH 3KZIE 1K05A 4NBHD 3AE8C 2YVJB 3AE1C 1IK7A 2ZJSE 1SQVK 1Y8AA 1VQLP 3ZDMA 1VCKA 2IFNA 1L0LD 1O7NA 4H44C 2DE6D 5AEUA 2WSFJ 1NU1K 4H0LD 1CI6A 2NPSA 3L75E 1SQQJ 3U1AA 1J1DB 1KYOI 4GKGA 1Q90D 2N9BA 4QMAA 3C0DA 4MN4C 5CBNA 4NBDD 3VP8A 1URQC 5CCGC 1O7PA 1KYOH 1DX7A 3E1RA 3D89A 1N86A 2GM4A 3MIWA 3H6PA 4DOJA 2KUBA 3C8VA 4OWFA 4Y28J 1KTMA 2HODA 4DCKA 1S5LE 1LT1A 3E1IA 3CCJP 4C7NB 1BGYE 2OGUA 3AE5C 5KJ7D 3JCUH 3I56P 1IO4A 3D71A 3AE7C 1URQB 1NKNA 2W6AA 1KQSO 4HJGH 1QL2A 1S2EA 3JC22 1KFMA 4H0LB 2ZXEB 2QJPC 2J5UA 2ZT9B 3CC4P 1TU3F 3RBXA 2YKPA 3AE9C 2H88C 2E76C 2N1TC 1SP4A 5CBOA 3L75G 1R8EA 4M3LA 2P10A 2OYHC 3L75D 3R2PA 2ZT9C 1YITP 2OQQA 4HJLA 3PP5A 1BGYJ 1FOSE 1UIIA 4DJGA 4HM6A 3P32A 3KDPB 2FFDB 2B87B 3IN6A 3L71E 2KS1B 4WY4B 2NRGA 3TGUE 1VQOP 2I1JA 2KNCA 2A06D 3B5NA 3G6EP 1SVFA 1PPJG 3KXDA 5AW1B 1NGMB 3E7KA 2O01J 2KOGA 1EG9A 1OFCX 1GU4A 4H13D 3RL0D 4JF7A 1UUVA 3EN1A 4QDFB 3L73J 5M1BA 4H44B 1SQBJ 5CJ4A 2WTYA 2WVRA 2R5BA 1G2CB 1GTWA 4GT1A 2H7HA 3IF4A 1NWQA 2M5AB 1X8YA 2QJYC 3AZCA 1OW7A 3VMZA 1OMIA 1CI6B 1KV4A 2Q3EA 4D6TD 2O1JA 1GMJA 1M7LA 3EWKA 1O7GA 5AW4B 2OYOA 4I7ZC 2N1TD 1JTHB 3CPWO 2L5GB 1H88A 2KIKA 3A2AA 3CCEP 1P84H 1MFTA 3FX0A 2NWFA 1BCCE 2Q3IA 4AIVA 1NU1E 1YTZT 1L0NJ 3L70D 3LW5H 2KZJA 2HMKA 1S5LX 3ABVC 1NTKJ 3UIAA 2HLOA 1EZVE 5AVRB 2Y0EA 2BASA 2OYIC 1KILE 1WT6A 2FYUK 3HRNA 2D2CB 3EFGA 2M0BA 1SQQK 3CX5H 5KAFH 2E76B 4HM0A 1NO4A 4NBED 2R32A 1S4XA 3Q1MA 3TGUG 1A02F 1VQ5P 2H8PD 4EMJB 3M06A 3GZXA 5APXA 1KB9H 1LT9B 1KORA 2XNDH 1Q81Q 1IFJA 3M91A 1AA0A 1N2DC 3GL0A 4HM8A 1GL2A 3B4SA 1NYKA 1KB9I 3EQ2A 2HMLA 3L35A 2HMMA 4EYYQ 2GA1A 3SWYA 5GTHE 1L4AB 2BCCE 3CCVP 3H25A 2YO2A 2B88A 1ZLLA 2WPVB 2WSFH 5TISH 4JQ0D 1R5SA 1G1JA 1RE3A 3LW5J 3BCCG 5AW2B 1LWUB 1SFCB 3SFEC 1W5CE 4U3FG 3B8EB 1JY2N 4OGQC 1GL2D 3H1JE 2ZYGA 4W7YA 3BATA 3VYIA 2B1XA 2YKQA 1E5WA 5KKZC 2C9NY 4GOEA 1LGHB 1FJPA 1VDFA 5AEWA 4I1LA 3II6A 1CW5A 3G4SP 3L73D 4TLFA 3RL0B 4AQRD 1RQVA 3GF7A 2ZVNB 3IFMA 3RL0g 1PP9J 4NPEA 2M3BA 1M1JB 1LP1B 3TGUD 1KQLA 3H1IG 3CL3D 1VF5B 4CPGA 3RK3C 3U59A 3GCEA 1RF1A 1U57A 1RF1C 1NTKG 3D70A 4PJ0E 4KHXA 5APYA 3N0QA 3BRVB 4OVNF 3RL0C 1M1JA 2D2CC 2R5DA 1SS1A 3AEDC 3L75J 3A0HE 3PJSK 1N8RQ 2YFLA 3HE5B 4NPFX 2H43A 1DH3A 5B5EE 2OTLP 1ZV8A 1T8ZA 4WBAA 4RKUJ 2E75D 2JP3A 5CCHA 4YXDC 1OIPA 3I5CA 5APWA 1SFCD 1X0TA 3MHVA 2W8ZA 5GTIH 3AEBC 2YMYA 1J1DC 1JMBA 5AW9B 2HMOA 3H1HE 5AVWB 4BRYA 1RFSA 2KSJA 2VRSA 1CZQA 3M0AA 1QEXA 1O7MA 3KHUA 1LT9C 3SWKA 3NTNA 3CCSP 1FZCB 2N9YB 3RBZA 1NOHA 4U3FJ 1NTZG 2FY8A 2WWWA 2G3AA 2JO1A 1AFOA 1NU1G 4QUPA 3GOBA 1N73B 1KFNA 3Q5PA 1ZR2A 2I7FA 1ZRTE 1ZP0C 1OX3A 3CMEP 5KLVG 4YXWH 4QDDA 1JCCA 4B86A 2P1JA 3SFDC 2WPSA 1L0NG 1RH5B 3I55P 2JWDA 1SQXD 5AVUB 1IFIA 2R3SA 4JYCA 3FOUA 2E4PA 2QRXA 3M9BA 3Q5SA 1H8AA 2Y9ZA 1NTKK 4PV1D 4P1BH 3S4RA 4NBGD 4H0LC 5CXMA 2JR8A 2WSSH 5KLVD 2NVEA 1HF9A 1KMIZ 3VMID 1GW4A 1LTJB 2N1TB 1EDLA 5KAFE 3H1HG 2OYHA 1SQBK 4ASVA 3BCCJ 2V4HA 4N78D 1KYOD 1LTGC 2Z4EA 3H1LD 4HM1A 5CCHC 3FXEA 3QWOC 3PHLA 3HD7C 4EI2A 3HUSB 1AV1A 3AE4C 2BCCG 1NAYA 1ULJA 3WU2E 1SQVJ 1YIJP 4IL6E 1HJBA 2ZYLA 1N7LA 2D2CD 1DEEG 3V2RA 3CWBD 1JY3O 2BCCJ 1K04A 3M9QA 3HUSC 2W90A 1IZNB 1K9MQ 2FXOA 3OA7A 2NPSC 3W68A 1YJ9P 3H1IE 3AECC 5KJ7C 1IFNA 3WUUA 3Q5RA 4I2LC 3AE6C 5CHXA 2E74C 4LLHA 1SFCC 1LWUC 2C0WA 1LWUA 1SFCA 2YIUC 2RH0A 2IZ0A 2YKOA 1FQTA 3TF5A 4ASWA 2UWJE 1L0NE 1IJDB 1U7JA 2IBZG 1UIXA 2DE7D 2B87A 1OW6A 1JY2P 1SQQE 1X79B 5TISE 1SQPG 3Q3DA 1BDDA 2NUMA 1H89A 4C46A 4ZNCA 1KQGB 3USSA 2KXPB 4NBBD 1SQPD 1RF0C 4UB8E 3BVHA 2QVAA 2V7QJ 3P7KA 2FYZA 1J1EB 2NZ2A 1YQ4C 2WPRA 1S9KD 1QGKB 3GHGA 3WUVA 2YXQB 2OYIB 2CK3H 1FZBA 3RK2C 4PD4H 1NH4A 3AEFC 2FFDC 1J1EC 4NBAD 1RE4A 3P8MC 4PD4E 2MKVA 3CC2P 3KYQA 1PZQA 4PV1C 1JO5A 1WMKA 4AYCA 2QJPB 3AEGC 5KKZB 1FBMA 4WB4A 3RK3E 1EZVD 3L71D 5CCGA 5AVXB 3DQYA 1KILC 5CMZA 1NU1D 1YI2P 2Q7CA 1BCCD 3KQGA 1N7SC 1FDMA 2GUSA 4I6MC 4N78E 1VM9A 4Z1MH 1HJ0A 5KLIB 3VMXA 1W2BO 3L74E 3CXHI 4QURA 2OYHB 5AW8B 2IBZE 2NPSB 4HM5A 2G8YA 1IFDA 2XV5A 1SQQG 4W7ZA 1YJWP 1G2CA 3ITKA 5APUA 1A02J 2QE7H 4O9BA 3V6IA 2GBWA 1RF0A 4QDFA 2ZYDA 2PP6A 3HE4A 2KZIA 3L71G 3L37A 1PL5A 4OH8B 1L0LE 4WY4A 2CPSA 4EIJA 3GHGB 5H2FH 3CCLP 2XZRA 1SQPK 3KPEA 2E43A 2FFDA 4EOTA 2OTJP 2XDJA 2B89A 2QSIA 2JZAA 2KI7B 4PD4D 3M9HA 4IL6X 3A0BE 2Y0CA 4Y99B 2C0XA 2YXRB 1USEA 2J59M 2JO6A 2KLVA 1NTMD 1SJGA 2NPSD 1M57D 2JJLA 3H1KE 1GW3A 3L74G 1LTSC 3AEEC 2WSEH 3CI9A 4U3FE 1XTCC 1BCCJ 1KILB 1DD3A 1GK6A 4IL6H 3RK2D 5AVYB 1YTZI 3H1HJ 3T97A 3GZYA 5AVTB 3TGUJ 3TDKA 1XTGB 1URQA 3A5TA 1FZCA 1PP9D 4GDOA 4GOFA 1PGOA 1QLED 1NTZE 2IBZD 2BMQA 4N6JA 1EZVG 4UB6H 1HGVA 1FOSF 2QG4A 2YIUB 4HKVA 2P7JA 3VMHD 2RMZA 2C9LY 1HTLC 2HODB 3MP7B 1VPCA 3H1KJ 5BU5A 1W2EA 4UB6E 1S5LH 4R4MA 3O6QB 1LTJC 2XKMA 4JBZA 1N7SD 3W67A 2KB7P 1LJ2A 3CCUP 4TT3H 1PGPA 2NVGA 5AVVB 2N1TA 1NTMK 3MUDA 2IYOA 1KZUB 4HM4A 3L4FA 2QM7A 4HM2A 1T2KC 1SQBE 5HL4A 3S1KA 4H44D 3JSVC 3GHGC 2XNXA 5BU8B 1R5LA 1Y47A 2A45H 1VQKP 1Q90C 1ULIA 1T3UA 3RK2B 2FYUJ 1E79H 1HVVA 3AEAC 3L36A 2JKVA 3GF3A 1SLQA 2A45I 3VOPA 5EFWB 2GUVA 2HYNA 2I8DA 4UB8H 1PPJE 2B9BA 1JNMA 5B5EH 1AVOA 1L4AD 2IX7C 3LIDA 3A0HH 2J58A 3VCAA 1RQUA 2YNYA 4IFDK 2YMKA 2Q3WA 2QJKC
chains in the Genus database with same CATH topology
3CX5E 2E75D 2YFIA 4QDFA 3L72E 1NDOA 4NBFD 5BOKA 3GTSA 1JM1A 4NB9D 4HM1A 2NWFA 2NVFA 1BCCE 4AIVA 3H1JE 1NU1E 4NBHD 2QJPC 1SQXE 2B1XA 2YVJB 3GKEA 2HMOA 1P84E 3H1HE 1NTME 1ULJA 1UUWA 1RFSA 4HM3A 1L0LE 2HMKA 4QDCA 3EQQA 5KKZC 4NBAD 1O7MA 1VCKA 2YFJA 5AEWA 2ZYLA 1O7HA 1EZVE 4PD4E 1O7NA 2DE6D 2XSHA 3L70E 5AEUA 2D2CD 4H0LD 4HJLA 3L75E 1VF5D 3CWBE 2CKFA 2NVGA 2E76D 4HM6A 2JZAA 1O7WA 3GTEA 2QPZA 4HM4A 3H1LE 2DE5D 3C0DA 3L73E 2GBXA 4HM0A 4HM2A 4NBED 3L71E 4HM7A 4QUPA 3GOBA 1SQBE 5HL4A 1RIEA 4QUQA 4NBDD 2E74D 3H1IE 3TGUE 1O7PA 1KB9E 3VCPA 3DQYA 2JO6A 3GB4A 4AAYB 2BMRA 1SJGA 3BCCE 3CXHE 2I7FA 1ZRTE 3H1KE 3D89A 4EMJB 4H44D 1SQPE 4OGQD 4NB8D 3GCEA 1G8JB 4P1CH 3GZXA 4U3FE 1EG9A 4QDDA 5KLIC 1KYOE 1BE3E 2YIUC 2XR8A 4H13D 4NBCD 2HMNA 1FQTA 3EN1A 1UUVA 4QDFB 3GL0A 1Q90C 1ULIA 3VMGD 1VM9A 4HM8A 1L0NE 3N0QA 3FOUA 3GZYA 2NUKA 1NYKA 2E4PA 2FYNC 2DE7D 1NTKE 2HMLA 4QCKA 5KLVE 2B24A 3L74E 2HMMA 4QURA 1SQQE 1BGYE 2HMJA 4PV1D 2QJYC 2XRXA 2IBZE 2XSOA 4P1BH 3GL2A 3AZCA 1WQLA 1PPJE 4NBGD 1NTZE 2NUMA 4HM5A 2BCCE 5CXMA 2YFLA 2E4QA 1PP9E 2NVEA 4NBBD 2BMQA 1G8KB 2A06E 3VMID 1SQVE 2ZT9D 3VCAA 2BMOA 1O7GA 2FYUE 4D6TE 4HKVA 2GBWA 3VMHD 2Q3WA 2QJKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 E;  2E75 D;  2YFI A;  4QDF A;  3L72 E;  1NDO A;  4NBF D;  5BOK A;  3GTS A;  1JM1 A;  4NB9 D;  4HM1 A;  2NWF A;  2NVF A;  1BCC E;  4AIV A;  3H1J E;  1NU1 E;  4NBH D;  2QJP C;  1SQX E;  2B1X A;  2YVJ B;  3GKE A;  2HMO A;  1P84 E;  3H1H E;  1NTM E;  1ULJ A;  1UUW A;  1RFS A;  4HM3 A;  1L0L E;  2HMK A;  4QDC A;  3EQQ A;  5KKZ C;  4NBA D;  1O7M A;  1VCK A;  2YFJ A;  5AEW A;  2ZYL A;  1O7H A;  1EZV E;  4PD4 E;  1O7N A;  2DE6 D;  2XSH A;  3L70 E;  5AEU A;  2D2C D;  4H0L D;  4HJL A;  3L75 E;  1VF5 D;  3CWB E;  2CKF A;  2NVG A;  2E76 D;  4HM6 A;  2JZA A;  1O7W A;  3GTE A;  2QPZ A;  4HM4 A;  3H1L E;  2DE5 D;  3C0D A;  3L73 E;  2GBX A;  4HM0 A;  4HM2 A;  4NBE D;  3L71 E;  4HM7 A;  4QUP A;  3GOB A;  1SQB E;  5HL4 A;  1RIE A;  4QUQ A;  4NBD D;  2E74 D;  3H1I E;  3TGU E;  1O7P A;  1KB9 E;  3VCP A;  3DQY A;  2JO6 A;  3GB4 A;  4AAY B;  2BMR A;  1SJG A;  3BCC E;  3CXH E;  2I7F A;  1ZRT E;  3H1K E;  3D89 A;  4EMJ B;  4H44 D;  1SQP E;  4OGQ D;  4NB8 D;  3GCE A;  1G8J B;  4P1C H;  3GZX A;  4U3F E;  1EG9 A;  4QDD A;  5KLI C;  1KYO E;  1BE3 E;  2YIU C;  2XR8 A;  4H13 D;  4NBC D;  2HMN A;  1FQT A;  3EN1 A;  1UUV A;  4QDF B;  3GL0 A;  1Q90 C;  1ULI A;  3VMG D;  1VM9 A;  4HM8 A;  1L0N E;  3N0Q A;  3FOU A;  3GZY A;  2NUK A;  1NYK A;  2E4P A;  2FYN C;  2DE7 D;  1NTK E;  2HML A;  4QCK A;  5KLV E;  2B24 A;  3L74 E;  2HMM A;  4QUR A;  1SQQ E;  1BGY E;  2HMJ A;  4PV1 D;  2QJY C;  2XRX A;  2IBZ E;  2XSO A;  4P1B H;  3GL2 A;  3AZC A;  1WQL A;  1PPJ E;  4NBG D;  1NTZ E;  2NUM A;  4HM5 A;  2BCC E;  5CXM A;  2YFL A;  2E4Q A;  1PP9 E;  2NVE A;  4NBB D;  2BMQ A;  1G8K B;  2A06 E;  3VMI D;  1SQV E;  2ZT9 D;  3VCA A;  2BMO A;  1O7G A;  2FYU E;  4D6T E;  4HKV A;  2GBW A;  3VMH D;  2Q3W A;  2QJK C; 
#chains in the Genus database with same CATH topology
 1FU1 A;  2A45 G;  3OJA B;  1H0T B;  3IR9 A;  3SSU A;  1VQN P;  1IFM A;  1KIL A;  3PLN A;  1GL2 B;  4NB9 D;  1BE3 J;  3CXH H;  3WMM 0;  2K1A A;  4IOI H;  3H1L J;  5KJ7 A;  2AXC A;  4L73 A;  3BCC D;  3GKE A;  2YO3 A;  2HFE D;  2QJK B;  2CPB A;  1GK4 A;  3BAS A;  1RE3 C;  4D6T J;  3M0D C;  2HPC B;  2K9Y A;  2CKF A;  2W6B A;  1JOC A;  1M8O B;  3K5B A;  2E76 D;  3VTP C;  1T2K D;  3GTE A;  2QPZ A;  2RKL A;  2KLU A;  1YHQ P;  5GTH H;  1SQB D;  3N4X A;  1YQ3 C;  4H13 B;  3FXD A;  2BMR A;  2O01 H;  1SQB G;  5AW6 B;  4ZMD A;  4WY4 C;  3HE4 B;  1LTT C;  1G8J B;  5AVZ B;  1U7M A;  3G71 P;  3L72 D;  1BE3 E;  2Z5I A;  4WWI A;  2XR8 A;  1PGQ A;  3GMA A;  1FS0 E;  1ZXG A;  3P8C E;  3GW6 A;  3CMA P;  1BSH A;  2PRR A;  4JYB A;  2E5Y A;  2NUK A;  1M1J C;  3V5B A;  5APT A;  3HD7 D;  5C39 A;  3GG2 A;  1BGY D;  1Y9B A;  4U3F D;  4XE5 B;  1LP1 A;  1KC8 Q;  4KT0 J;  1N73 C;  1CSB A;  1BGY G;  2K37 A;  1Q7Y Q;  1MKM A;  1PV3 A;  2QJY B;  1QVF O;  2Q9I A;  1KB9 D;  4IFF A;  1RF1 B;  1NKZ B;  1NJI Q;  3PH0 A;  2M5A A;  2LR2 A;  4C7R A;  1HGZ A;  1OVR A;  1RE4 C;  1G1I A;  1JM1 A;  3O6Q A;  1VQ4 P;  3CD6 P;  3A7O A;  5B66 E;  3HTK B;  1LTA C;  1NHL A;  2SPZ A;  1MZ9 A;  1SQX E;  3V2Q A;  3C1L A;  1P84 E;  1NTM E;  5KTB A;  2WT7 B;  1LTB C;  1OVV A;  1ZR4 A;  3EQQ A;  3H1K G;  2W27 A;  1O7H A;  3CX5 I;  1AJY A;  2ZYA A;  3VMY A;  1DEB A;  3L74 J;  1PGJ A;  1NVO A;  1VQ7 P;  1BE3 G;  1VQM P;  1IC2 A;  1O7W A;  1USD A;  2IYP A;  2DE5 D;  4DZO A;  2FYN B;  1L4A C;  4HM7 A;  1L4A A;  1PP9 G;  3T97 B;  1BCC G;  3V4W A;  2FXP A;  4NB8 D;  3HD7 B;  2IBZ I;  2KS1 A;  2ITA A;  1JM0 A;  4NBC D;  4HH2 A;  4WVZ A;  2IPP A;  3L74 D;  5AW7 B;  4HYT B;  1P84 D;  3MZW B;  1EDK A;  1S1C X;  1LTI C;  3L72 J;  1YJN P;  3G3Z A;  1VQ6 P;  4BWN A;  3NMD A;  1SQQ D;  4NPD A;  2IZ1 A;  2QA4 P;  3MUD C;  4IFM A;  1G8K B;  3F89 A;  1EDI A;  2BMO A;  4GOD A;  4K35 A;  1EQ7 A;  3CX5 E;  1DD4 A;  5APS A;  4RO0 A;  1EXJ A;  4LGD E;  4PJ0 H;  3GLM A;  1NTZ J;  2BEQ D;  2OTK E;  2P67 A;  3H1I D;  2M3E A;  3WUT A;  2AEM A;  3CCR P;  2ZAE B;  3RK3 D;  1FC2 C;  1JY2 O;  1BE3 D;  1VF5 D;  3CWB E;  1S72 P;  4W80 A;  2AEF A;  2R44 A;  2LKM A;  1SQX K;  5DJT B;  2I1K A;  3L73 E;  2A06 G;  1GL2 C;  2P58 A;  4HB1 A;  4RJT A;  2LXB A;  5B66 H;  3IAO A;  2K9J A;  3HUS A;  1SQP E;  3B5N C;  2K3R A;  4LC1 A;  2Z5H A;  1KYO E;  1MUU A;  3CCQ P;  1Q82 Q;  4DT0 A;  2KSE A;  3NFQ A;  2FYU D;  1S9K E;  4L76 A;  1FE6 A;  5KLV E;  2HMJ A;  3VN0 A;  1GDT A;  2R3C A;  2WPQ A;  3U1C A;  1EDJ A;  2ZT9 D;  2W6J H;  1NTK D;  3VMA A;  1JB0 J;  1EZV I;  1L0N D;  3L70 J;  1KQF B;  1Z56 A;  3D6Y A;  4NBF D;  1PPJ D;  2KNC B;  1HWT C;  2M8R A;  2OYI A;  3H32 A;  1HUC A;  4L74 A;  2NVF A;  1IK9 A;  3PRJ A;  3L73 G;  1UUW A;  4QDC A;  1N73 A;  3SWF A;  1ZW0 A;  3JCU E;  2XSH A;  1K73 Q;  2HG5 D;  1FZF A;  1OWA A;  1JY3 P;  3G9R A;  1QVG O;  3S9O A;  1ZOY C;  4H13 C;  1SQX G;  3MTU E;  4GIF A;  3OAK A;  3CC7 P;  4QUQ A;  1T3J A;  3R4Y A;  2AXT E;  2WZ7 A;  4C7N A;  2WIT A;  4JPZ B;  4EDF A;  2QEX P;  1VQ8 P;  3HD7 A;  3V4Q A;  1EC5 A;  1SQV G;  3CX5 D;  1D7M A;  3A3Y B;  3KZI H;  1Q86 Q;  3O8Z A;  4ZKU A;  2QIW A;  2FYN C;  4ZKP A;  1NTK E;  5GTI E;  1GZL A;  2E74 B;  5CCH D;  2XRX A;  1GU5 A;  1JY3 N;  4I7Z B;  2KK7 A;  1KN7 A;  3H1K D;  5AW5 B;  5KAI H;  2WQY C;  5CJ0 A;  1AQT A;  2WT7 A;  2JEE A;  2H89 C;  3AE3 C;  1NYH A;  2Y9Y A;  3HTK A;  2XU6 A;  1NDO A;  2FBW C;  5BOK A;  4RES B;  1L2P A;  3GTS A;  1L0L K;  3B5N D;  4Y99 C;  3M0D A;  2K9J B;  3CXH D;  1S3J A;  1OXZ A;  1YYC A;  1M1K Q;  1X22 A;  4HM3 A;  5AW3 B;  1LTJ A;  3H1H D;  2POH A;  3A0B H;  3AE2 C;  4L75 A;  1M90 Q;  3FWL A;  3D6Z A;  1ZRT D;  1NTM J;  3F5H A;  3FGA D;  2FXM A;  1KB9 E;  2JDI H;  3VCP A;  3H1J D;  4AAY B;  3MD0 A;  2O3J A;  5E79 E;  1RHZ B;  5KLI C;  3CWB G;  1FZA A;  4BXL A;  2BEZ F;  3H1J J;  1YBK A;  1AVY A;  1FDI A;  1M56 D;  1L0N K;  3C9I A;  1PIX A;  2B24 A;  3P8C D;  2Y0D A;  1DIP A;  2XSO A;  1WQL A;  1X9V A;  2HPC A;  2E4Q A;  2V7Q H;  1ZME C;  2KYV A;  3CLQ A;  3L71 J;  1OW8 A;  1P84 I;  1L0L J;  1WRG A;  3TNU B;  4D6T G;  3B71 A;  5APV A;  3TYY A;  4BRY B;  3N7N A;  4PD4 I;  2Q5U A;  2ZXX A;  3L72 E;  1AQ5 A;  3Q2Y A;  1LT9 A;  1BDC A;  3TK1 A;  1OVU A;  3TNU A;  1L0L G;  4U7J A;  1VQ9 P;  1J2J B;  1T6A A;  4WY4 D;  1JEK A;  1FAV A;  4R4L A;  2ZVO B;  2KP8 A;  3NXS A;  2OAR A;  2FYU G;  1N7S B;  3TSI A;  3RK3 B;  2Q6Q A;  2O01 N;  5AVQ B;  2PGD A;  3HE5 A;  1NTZ K;  5K5G B;  3PTZ A;  2E75 B;  2W83 C;  3OW2 O;  1NTM G;  1PFI A;  3H1L G;  1VQP P;  2GBX A;  1NU1 J;  3V2N A;  1JMM A;  1BSN A;  2E74 D;  3VP9 A;  4YTP C;  3GB4 A;  1FJK A;  3CXH E;  2E42 A;  1MV8 A;  4OGQ D;  2AEJ A;  4P1C H;  1IFP A;  2IDB A;  2Q1K A;  2DW3 A;  2WSC J;  5AVS B;  2E5T A;  5E79 H;  1K8A Q;  3VMG D;  1JTH A;  5APQ A;  1MFZ A;  1JUN A;  4QCK A;  3L72 G;  1QX8 A;  1FZE A;  2HR3 A;  4XFJ A;  3CCM P;  2WSE J;  5TJH A;  1FZG A;  1SQV E;  1QL1 A;  1URQ D;  2FYU E;  2YFI A;  4AUW A;  2BCC D;  4KJM A;  4XA4 A;  3CWB J;  1EXI A;  1SQP J;  2WMM A;  1KD1 Q;  3B5N B;  3WU2 H;  2JWA A;  3RGU A;  1GD2 E;  1FZC C;  2FKW B;  5L8R J;  2YFJ A;  3FWN A;  2MJZ A;  3L70 E;  1RY3 A;  4HKZ H;  1ZN5 A;  4K3A A;  4A7P A;  4OGQ B;  5AW0 B;  1NAF A;  5H2F E;  1N7S A;  3H1L E;  1KIL D;  3MGN A;  1HH0 A;  2O1K A;  2E75 C;  1RIE A;  5KAI E;  3EFF K;  5KLV J;  3BCC E;  5BVZ A;  2IFM A;  5CCG D;  4N3Y B;  2P2U A;  2ZFC A;  3H1J G;  1H0T A;  2HMN A;  2QM8 A;  1SQX J;  2PAJ A;  3L70 G;  4PV1 B;  3H32 B;  3QH9 A;  1LNQ A;  1JCD A;  1SQV D;  2LXC B;  1OZH A;  3BRT B;  2RN0 A;  1FDO A;  3GL2 A;  1Q2N A;  4YPC A;  1PP9 E;  3LIE A;  2A06 E;  1VL2 A;  2WSC H;  4D6T E;  1VF5 C;  2PFX A;  3H1I J;  3V2P A;  1HBW A;  2L91 A;  1NTZ D;  5DJU B;  5KLV K;  2K88 A;  2AXT H;  3KZI E;  1K05 A;  4NBH D;  3AE8 C;  2YVJ B;  3AE1 C;  1IK7 A;  2ZJS E;  1SQV K;  1Y8A A;  1VQL P;  3ZDM A;  1VCK A;  2IFN A;  1L0L D;  1O7N A;  4H44 C;  2DE6 D;  5AEU A;  2WSF J;  1NU1 K;  4H0L D;  1CI6 A;  2NPS A;  3L75 E;  1SQQ J;  3U1A A;  1J1D B;  1KYO I;  4GKG A;  1Q90 D;  2N9B A;  4QMA A;  3C0D A;  4MN4 C;  5CBN A;  4NBD D;  3VP8 A;  1URQ C;  5CCG C;  1O7P A;  1KYO H;  1DX7 A;  3E1R A;  3D89 A;  1N86 A;  2GM4 A;  3MIW A;  3H6P A;  4DOJ A;  2KUB A;  3C8V A;  4OWF A;  4Y28 J;  1KTM A;  2HOD A;  4DCK A;  1S5L E;  1LT1 A;  3E1I A;  3CCJ P;  4C7N B;  1BGY E;  2OGU A;  3AE5 C;  5KJ7 D;  3JCU H;  3I56 P;  1IO4 A;  3D71 A;  3AE7 C;  1URQ B;  1NKN A;  2W6A A;  1KQS O;  4HJG H;  1QL2 A;  1S2E A;  3JC2 2;  1KFM A;  4H0L B;  2ZXE B;  2QJP C;  2J5U A;  2ZT9 B;  3CC4 P;  1TU3 F;  3RBX A;  2YKP A;  3AE9 C;  2H88 C;  2E76 C;  2N1T C;  1SP4 A;  5CBO A;  3L75 G;  1R8E A;  4M3L A;  2P10 A;  2OYH C;  3L75 D;  3R2P A;  2ZT9 C;  1YIT P;  2OQQ A;  4HJL A;  3PP5 A;  1BGY J;  1FOS E;  1UII A;  4DJG A;  4HM6 A;  3P32 A;  3KDP B;  2FFD B;  2B87 B;  3IN6 A;  3L71 E;  2KS1 B;  4WY4 B;  2NRG A;  3TGU E;  1VQO P;  2I1J A;  2KNC A;  2A06 D;  3B5N A;  3G6E P;  1SVF A;  1PPJ G;  3KXD A;  5AW1 B;  1NGM B;  3E7K A;  2O01 J;  2KOG A;  1EG9 A;  1OFC X;  1GU4 A;  4H13 D;  3RL0 D;  4JF7 A;  1UUV A;  3EN1 A;  4QDF B;  3L73 J;  5M1B A;  4H44 B;  1SQB J;  5CJ4 A;  2WTY A;  2WVR A;  2R5B A;  1G2C B;  1GTW A;  4GT1 A;  2H7H A;  3IF4 A;  1NWQ A;  2M5A B;  1X8Y A;  2QJY C;  3AZC A;  1OW7 A;  3VMZ A;  1OMI A;  1CI6 B;  1KV4 A;  2Q3E A;  4D6T D;  2O1J A;  1GMJ A;  1M7L A;  3EWK A;  1O7G A;  5AW4 B;  2OYO A;  4I7Z C;  2N1T D;  1JTH B;  3CPW O;  2L5G B;  1H88 A;  2KIK A;  3A2A A;  3CCE P;  1P84 H;  1MFT A;  3FX0 A;  2NWF A;  1BCC E;  2Q3I A;  4AIV A;  1NU1 E;  1YTZ T;  1L0N J;  3L70 D;  3LW5 H;  2KZJ A;  2HMK A;  1S5L X;  3ABV C;  1NTK J;  3UIA A;  2HLO A;  1EZV E;  5AVR B;  2Y0E A;  2BAS A;  2OYI C;  1KIL E;  1WT6 A;  2FYU K;  3HRN A;  2D2C B;  3EFG A;  2M0B A;  1SQQ K;  3CX5 H;  5KAF H;  2E76 B;  4HM0 A;  1NO4 A;  4NBE D;  2R32 A;  1S4X A;  3Q1M A;  3TGU G;  1A02 F;  1VQ5 P;  2H8P D;  4EMJ B;  3M06 A;  3GZX A;  5APX A;  1KB9 H;  1LT9 B;  1KOR A;  2XND H;  1Q81 Q;  1IFJ A;  3M91 A;  1AA0 A;  1N2D C;  3GL0 A;  4HM8 A;  1GL2 A;  3B4S A;  1NYK A;  1KB9 I;  3EQ2 A;  2HML A;  3L35 A;  2HMM A;  4EYY Q;  2GA1 A;  3SWY A;  5GTH E;  1L4A B;  2BCC E;  3CCV P;  3H25 A;  2YO2 A;  2B88 A;  1ZLL A;  2WPV B;  2WSF H;  5TIS H;  4JQ0 D;  1R5S A;  1G1J A;  1RE3 A;  3LW5 J;  3BCC G;  5AW2 B;  1LWU B;  1SFC B;  3SFE C;  1W5C E;  4U3F G;  3B8E B;  1JY2 N;  4OGQ C;  1GL2 D;  3H1J E;  2ZYG A;  4W7Y A;  3BAT A;  3VYI A;  2B1X A;  2YKQ A;  1E5W A;  5KKZ C;  2C9N Y;  4GOE A;  1LGH B;  1FJP A;  1VDF A;  5AEW A;  4I1L A;  3II6 A;  1CW5 A;  3G4S P;  3L73 D;  4TLF A;  3RL0 B;  4AQR D;  1RQV A;  3GF7 A;  2ZVN B;  3IFM A;  3RL0 g;  1PP9 J;  4NPE A;  2M3B A;  1M1J B;  1LP1 B;  3TGU D;  1KQL A;  3H1I G;  3CL3 D;  1VF5 B;  4CPG A;  3RK3 C;  3U59 A;  3GCE A;  1RF1 A;  1U57 A;  1RF1 C;  1NTK G;  3D70 A;  4PJ0 E;  4KHX A;  5APY A;  3N0Q A;  3BRV B;  4OVN F;  3RL0 C;  1M1J A;  2D2C C;  2R5D A;  1SS1 A;  3AED C;  3L75 J;  3A0H E;  3PJS K;  1N8R Q;  2YFL A;  3HE5 B;  4NPF X;  2H43 A;  1DH3 A;  5B5E E;  2OTL P;  1ZV8 A;  1T8Z A;  4WBA A;  4RKU J;  2E75 D;  2JP3 A;  5CCH A;  4YXD C;  1OIP A;  3I5C A;  5APW A;  1SFC D;  1X0T A;  3MHV A;  2W8Z A;  5GTI H;  3AEB C;  2YMY A;  1J1D C;  1JMB A;  5AW9 B;  2HMO A;  3H1H E;  5AVW B;  4BRY A;  1RFS A;  2KSJ A;  2VRS A;  1CZQ A;  3M0A A;  1QEX A;  1O7M A;  3KHU A;  1LT9 C;  3SWK A;  3NTN A;  3CCS P;  1FZC B;  2N9Y B;  3RBZ A;  1NOH A;  4U3F J;  1NTZ G;  2FY8 A;  2WWW A;  2G3A A;  2JO1 A;  1AFO A;  1NU1 G;  4QUP A;  3GOB A;  1N73 B;  1KFN A;  3Q5P A;  1ZR2 A;  2I7F A;  1ZRT E;  1ZP0 C;  1OX3 A;  3CME P;  5KLV G;  4YXW H;  4QDD A;  1JCC A;  4B86 A;  2P1J A;  3SFD C;  2WPS A;  1L0N G;  1RH5 B;  3I55 P;  2JWD A;  1SQX D;  5AVU B;  1IFI A;  2R3S A;  4JYC A;  3FOU A;  2E4P A;  2QRX A;  3M9B A;  3Q5S A;  1H8A A;  2Y9Z A;  1NTK K;  4PV1 D;  4P1B H;  3S4R A;  4NBG D;  4H0L C;  5CXM A;  2JR8 A;  2WSS H;  5KLV D;  2NVE A;  1HF9 A;  1KMI Z;  3VMI D;  1GW4 A;  1LTJ B;  2N1T B;  1EDL A;  5KAF E;  3H1H G;  2OYH A;  1SQB K;  4ASV A;  3BCC J;  2V4H A;  4N78 D;  1KYO D;  1LTG C;  2Z4E A;  3H1L D;  4HM1 A;  5CCH C;  3FXE A;  3QWO C;  3PHL A;  3HD7 C;  4EI2 A;  3HUS B;  1AV1 A;  3AE4 C;  2BCC G;  1NAY A;  1ULJ A;  3WU2 E;  1SQV J;  1YIJ P;  4IL6 E;  1HJB A;  2ZYL A;  1N7L A;  2D2C D;  1DEE G;  3V2R A;  3CWB D;  1JY3 O;  2BCC J;  1K04 A;  3M9Q A;  3HUS C;  2W90 A;  1IZN B;  1K9M Q;  2FXO A;  3OA7 A;  2NPS C;  3W68 A;  1YJ9 P;  3H1I E;  3AEC C;  5KJ7 C;  1IFN A;  3WUU A;  3Q5R A;  4I2L C;  3AE6 C;  5CHX A;  2E74 C;  4LLH A;  1SFC C;  1LWU C;  2C0W A;  1LWU A;  1SFC A;  2YIU C;  2RH0 A;  2IZ0 A;  2YKO A;  1FQT A;  3TF5 A;  4ASW A;  2UWJ E;  1L0N E;  1IJD B;  1U7J A;  2IBZ G;  1UIX A;  2DE7 D;  2B87 A;  1OW6 A;  1JY2 P;  1SQQ E;  1X79 B;  5TIS E;  1SQP G;  3Q3D A;  1BDD A;  2NUM A;  1H89 A;  4C46 A;  4ZNC A;  1KQG B;  3USS A;  2KXP B;  4NBB D;  1SQP D;  1RF0 C;  4UB8 E;  3BVH A;  2QVA A;  2V7Q J;  3P7K A;  2FYZ A;  1J1E B;  2NZ2 A;  1YQ4 C;  2WPR A;  1S9K D;  1QGK B;  3GHG A;  3WUV A;  2YXQ B;  2OYI B;  2CK3 H;  1FZB A;  3RK2 C;  4PD4 H;  1NH4 A;  3AEF C;  2FFD C;  1J1E C;  4NBA D;  1RE4 A;  3P8M C;  4PD4 E;  2MKV A;  3CC2 P;  3KYQ A;  1PZQ A;  4PV1 C;  1JO5 A;  1WMK A;  4AYC A;  2QJP B;  3AEG C;  5KKZ B;  1FBM A;  4WB4 A;  3RK3 E;  1EZV D;  3L71 D;  5CCG A;  5AVX B;  3DQY A;  1KIL C;  5CMZ A;  1NU1 D;  1YI2 P;  2Q7C A;  1BCC D;  3KQG A;  1N7S C;  1FDM A;  2GUS A;  4I6M C;  4N78 E;  1VM9 A;  4Z1M H;  1HJ0 A;  5KLI B;  3VMX A;  1W2B O;  3L74 E;  3CXH I;  4QUR A;  2OYH B;  5AW8 B;  2IBZ E;  2NPS B;  4HM5 A;  2G8Y A;  1IFD A;  2XV5 A;  1SQQ G;  4W7Z A;  1YJW P;  1G2C A;  3ITK A;  5APU A;  1A02 J;  2QE7 H;  4O9B A;  3V6I A;  2GBW A;  1RF0 A;  4QDF A;  2ZYD A;  2PP6 A;  3HE4 A;  2KZI A;  3L71 G;  3L37 A;  1PL5 A;  4OH8 B;  1L0L E;  4WY4 A;  2CPS A;  4EIJ A;  3GHG B;  5H2F H;  3CCL P;  2XZR A;  1SQP K;  3KPE A;  2E43 A;  2FFD A;  4EOT A;  2OTJ P;  2XDJ A;  2B89 A;  2QSI A;  2JZA A;  2KI7 B;  4PD4 D;  3M9H A;  4IL6 X;  3A0B E;  2Y0C A;  4Y99 B;  2C0X A;  2YXR B;  1USE A;  2J59 M;  2JO6 A;  2KLV A;  1NTM D;  1SJG A;  2NPS D;  1M57 D;  2JJL A;  3H1K E;  1GW3 A;  3L74 G;  1LTS C;  3AEE C;  2WSE H;  3CI9 A;  4U3F E;  1XTC C;  1BCC J;  1KIL B;  1DD3 A;  1GK6 A;  4IL6 H;  3RK2 D;  5AVY B;  1YTZ I;  3H1H J;  3T97 A;  3GZY A;  5AVT B;  3TGU J;  3TDK A;  1XTG B;  1URQ A;  3A5T A;  1FZC A;  1PP9 D;  4GDO A;  4GOF A;  1PGO A;  1QLE D;  1NTZ E;  2IBZ D;  2BMQ A;  4N6J A;  1EZV G;  4UB6 H;  1HGV A;  1FOS F;  2QG4 A;  2YIU B;  4HKV A;  2P7J A;  3VMH D;  2RMZ A;  2C9L Y;  1HTL C;  2HOD B;  3MP7 B;  1VPC A;  3H1K J;  5BU5 A;  1W2E A;  4UB6 E;  1S5L H;  4R4M A;  3O6Q B;  1LTJ C;  2XKM A;  4JBZ A;  1N7S D;  3W67 A;  2KB7 P;  1LJ2 A;  3CCU P;  4TT3 H;  1PGP A;  2NVG A;  5AVV B;  2N1T A;  1NTM K;  3MUD A;  2IYO A;  1KZU B;  4HM4 A;  3L4F A;  2QM7 A;  4HM2 A;  1T2K C;  1SQB E;  5HL4 A;  3S1K A;  4H44 D;  3JSV C;  3GHG C;  2XNX A;  5BU8 B;  1R5L A;  1Y47 A;  2A45 H;  1VQK P;  1Q90 C;  1ULI A;  1T3U A;  3RK2 B;  2FYU J;  1E79 H;  1HVV A;  3AEA C;  3L36 A;  2JKV A;  3GF3 A;  1SLQ A;  2A45 I;  3VOP A;  5EFW B;  2GUV A;  2HYN A;  2I8D A;  4UB8 H;  1PPJ E;  2B9B A;  1JNM A;  5B5E H;  1AVO A;  1L4A D;  2IX7 C;  3LID A;  3A0H H;  2J58 A;  3VCA A;  1RQU A;  2YNY A;  4IFD K;  2YMK A;  2Q3W A;  2QJK C; 
#chains in the Genus database with same CATH homology
 3CX5 E;  2E75 D;  2YFI A;  4QDF A;  3L72 E;  1NDO A;  4NBF D;  5BOK A;  3GTS A;  1JM1 A;  4NB9 D;  4HM1 A;  2NWF A;  2NVF A;  1BCC E;  4AIV A;  3H1J E;  1NU1 E;  4NBH D;  2QJP C;  1SQX E;  2B1X A;  2YVJ B;  3GKE A;  2HMO A;  1P84 E;  3H1H E;  1NTM E;  1ULJ A;  1UUW A;  1RFS A;  4HM3 A;  1L0L E;  2HMK A;  4QDC A;  3EQQ A;  5KKZ C;  4NBA D;  1O7M A;  1VCK A;  2YFJ A;  5AEW A;  2ZYL A;  1O7H A;  1EZV E;  4PD4 E;  1O7N A;  2DE6 D;  2XSH A;  3L70 E;  5AEU A;  2D2C D;  4H0L D;  4HJL A;  3L75 E;  1VF5 D;  3CWB E;  2CKF A;  2NVG A;  2E76 D;  4HM6 A;  2JZA A;  1O7W A;  3GTE A;  2QPZ A;  4HM4 A;  3H1L E;  2DE5 D;  3C0D A;  3L73 E;  2GBX A;  4HM0 A;  4HM2 A;  4NBE D;  3L71 E;  4HM7 A;  4QUP A;  3GOB A;  1SQB E;  5HL4 A;  1RIE A;  4QUQ A;  4NBD D;  2E74 D;  3H1I E;  3TGU E;  1O7P A;  1KB9 E;  3VCP A;  3DQY A;  2JO6 A;  3GB4 A;  4AAY B;  2BMR A;  1SJG A;  3BCC E;  3CXH E;  2I7F A;  1ZRT E;  3H1K E;  3D89 A;  4EMJ B;  4H44 D;  1SQP E;  4OGQ D;  4NB8 D;  3GCE A;  1G8J B;  4P1C H;  3GZX A;  4U3F E;  1EG9 A;  4QDD A;  5KLI C;  1KYO E;  1BE3 E;  2YIU C;  2XR8 A;  4H13 D;  4NBC D;  2HMN A;  1FQT A;  3EN1 A;  1UUV A;  4QDF B;  3GL0 A;  1Q90 C;  1ULI A;  3VMG D;  1VM9 A;  4HM8 A;  1L0N E;  3N0Q A;  3FOU A;  3GZY A;  2NUK A;  1NYK A;  2E4P A;  2FYN C;  2DE7 D;  1NTK E;  2HML A;  4QCK A;  5KLV E;  2B24 A;  3L74 E;  2HMM A;  4QUR A;  1SQQ E;  1BGY E;  2HMJ A;  4PV1 D;  2QJY C;  2XRX A;  2IBZ E;  2XSO A;  4P1B H;  3GL2 A;  3AZC A;  1WQL A;  1PPJ E;  4NBG D;  1NTZ E;  2NUM A;  4HM5 A;  2BCC E;  5CXM A;  2YFL A;  2E4Q A;  1PP9 E;  2NVE A;  4NBB D;  2BMQ A;  1G8K B;  2A06 E;  3VMI D;  1SQV E;  2ZT9 D;  3VCA A;  2BMO A;  1O7G A;  2FYU E;  4D6T E;  4HKV A;  2GBW A;  3VMH D;  2Q3W A;  2QJK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...