3H1JE

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 46
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1jE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1jE02
1SQPE 1NYKA 2IBZE 1O7GA 1EG9A 2YFJA 1O7NA 1NTZE 1RFSA 4NBDD 3AZCA 4H44D 2BCCE 1BGYE 2B1XA 4HM8A 4P1CH 1NU1E 3DQYA 3L73E 1ULJA 1SJGA 1NDOA 1FQTA 1UUVA 4QCKA 2QJKC 1NTKE 2E4PA 1ZRTE 3TGUE 2HMJA 3GTEA 3L71E 1RIEA 4NBFD 2GBXA 1O7MA 4U3FE 4HKVA 1KYOE 1P84E 3GOBA 3CXHE 2YVJB 3GCEA 2XSOA 4HJLA 3H1IE 2HMMA 4QUQA 1EZVE 2NVGA 5BOKA 5HL4A 2HMKA 5AEUA 4HM7A 1VM9A 2QJPC 2E76D 3L70E 1L0LE 3VCPA 3VMGD 5KKZC 3L74E 1O7HA 1SQBE 2XSHA 4HM2A 4NBAD 4QDFB 3EQQA 1O7WA 2DE7D 3FOUA 3GB4A 4QDCA 4NBED 1UUWA 3L75E 5KLVE 4QDDA 2YFIA 4AIVA 3H1JE 3EN1A 3VMID 4QURA 5KLIC 2NUKA 2NVFA 3GTSA 3L72E 1Q90C 2XR8A 2DE5D 4QDFA 2BMQA 2ZYLA 4PV1D 4HM4A 2D2CD 1ULIA 3CWBE 4NB9D 1KB9E 3H1KE 4HM3A 4HM1A 3BCCE 2GBWA 2HMLA 2JO6A 2QPZA 4EMJB 2NVEA 1L0NE 4D6TE 4PD4E 2NWFA 3VCAA 3GZXA 3C0DA 2E74D 2E4QA 1BCCE 2I7FA 4NBCD 4NBHD 3GKEA 5AEWA 4HM0A 1VCKA 2E75D 3H1LE 2YIUC 2BMRA 2HMNA 1BE3E 3VMHD 1G8JB 4AAYB 1PP9E 2ZT9D 2NUMA 4HM5A 2A06E 4OGQD 3H1HE 4HM6A 3N0QA 1JM1A 1G8KB 1SQQE 1WQLA 1VF5D 1O7PA 5CXMA 2CKFA 3GL0A 1NTME 2HMOA 4H0LD 1PPJE 2FYUE 4P1BH 4QUPA 2FYNC 1SQVE 2B24A 2JZAA 2XRXA 2BMOA 4H13D 2YFLA 4NBGD 2QJYC 4NB8D 3D89A 2DE6D 4NBBD 3GL2A 2Q3WA 3GZYA 1SQXE 3CX5E
chains in the Genus database with same CATH superfamily
1SQPE 3SFEC 1EG9A 3P7KA 3O8ZA 4NBDD 4H44D 1K05A 4LLHA 5KAIH 1JM0A 2W8ZA 1EZVD 1IFJA 4DJGA 2QJPB 2L91A 1L0LK 3H1IE 4QUQA 1L4AC 1ZN5A 4H0LB 1CW5A 1KZUB 1ZW0A 3HE4A 1OIPA 1SQBE 2BCCG 2W6JH 4C46A 2JEEA 1PP9J 1IK9A 3FOUA 3QH9A 1U57A 3C8VA 4Y99C 4YXWH 1HGVA 1S1CX 1M7LA 3CCRP 1SFCA 1RF1B 4H44C 2KLUA 3L75D 1M57D 1FOSE 3D6YA 1NTZJ 5AW9B 1GU4A 1JB0J 3AEDC 3A7OA 3M0AA 2BMRA 3EWKA 3SWYA 3HUSA 3V4QA 1MFTA 1FZCC 4HM5A 1VL2A 1URQB 1SQQE 2OTKE 2YKQA 2CKFA 1NO4A 2FYNC 2N9YB 3H1KG 1JY2N 3BCCG 4NBBD 1S5LE 2HODB 4GOFA 1L0LJ 1U7JA 1J1EB 1GU5A 1HUCA 3M06A 1DEEG 4P1CH 1P84D 2BASA 4LC1A 3V6IA 1JCDA 2C0XA 1BGYG 3BVHA 4W7YA 3L72J 1FDOA 2POHA 1YQ3C 3A0HH 2HMJA 1RIEA 1FAVA 3GOBA 2R32A 4EIJA 1S2EA 3AE5C 3B5NA 4PD4H 1X9VA 3A3YB 1IFIA 2P58A 1SQPG 1OW6A 3HTKA 3GG2A 4XE5B 1WT6A 1VQMP 4RO0A 2W27A 1QGKB 4HM2A 3II6A 3BASA 4R4MA 1UUWA 3H1KD 1FZFA 2NUKA 4JF7A 2JO1A 1ZOYC 1SS1A 4ASVA 2W6BA 5GTHH 2I7FA 1A02J 1N8RQ 2WTYA 3CCEP 3H32B 4WY4B 1GW3A 1A02F 1Q7YQ 1L0ND 2XNXA 5CCGA 1EDLA 1JM1A 3C9IA 4PJ0E 1BDDA 5DJUB 1SQPD 1SQXJ 1CI6A 2GUSA 2YFIA 2YO3A 1NKNA 4WVZA 3CCSP 1KYOI 3AE6C 5CCHD 3V2NA 2KYVA 3SFDC 3H1ID 2WSSH 1SQQG 1CZQA 3TGUE 3IF4A 2Z4EA 2GBXA 1OFCX 4U3FE 3QWOC 5CHXA 5H2FH 5B5EH 1OMIA 2WSCH 1G1IA 1SQBD 4GDOA 3KQGA 1EC5A 1YJWP 2E76D 1RE4C 3L70E 2HODA 1BSHA 3L75J 1H0TA 1O7HA 2XSHA 4EI2A 1R5SA 2KXPB 4UB6H 4K35A 1VQ9P 3RK2B 3IR9A 2K9JB 3NTNA 2RH0A 2FY8A 1CSBA 4U7JA 1Q90C 4QDFA 4JBZA 4HKZH 3CWBE 2M0BA 3CCJP 2MJZA 5APSA 2J58A 2K9YA 1LGHB 4HB1A 2YKOA 2E4QA 1MV8A 1MZ9A 1ZV8A 1SQQD 4NPEA 2E75D 4AQRD 1GTWA 5TISH 1DH3A 2NPSA 1JY3P 2OYHA 5CBOA 2E76C 1G8KB 2E43A 2KNCB 1ZLLA 4H0LD 1SLQA 2PAJA 1SQPK 3CMEP 2R5BA 1JTHA 1KC8Q 1KD1Q 2P2UA 2J5UA 1GL2A 1RE3A 1X0TA 5AVXB 1LTSC 2XU6A 1WMKA 2JJLA 5GTIH 4A7PA 3FXDA 1ZR2A 1LNQA 1NTKE 3AEGC 2FFDC 1E79H 1O7MA 3PRJA 2M5AA 2E75C 3AE7C 4OGQB 3C1LA 5KAIE 1YI2P 2HMMA 5AW7B 5BOKA 2HMKA 2E42A 2QJPC 3AE2C 1JCCA 1X22A 3RBXA 4H0LC 1URQD 4KT0J 2NRGA 3EQQA 3GB4A 2JWAA 3G3ZA 2HLOA 1MFZA 1Y47A 1N7SD 1DD4A 2N1TD 1L0NJ 1LTJB 3TGUG 4U3FG 1AVOA 1ULIA 2XV5A 1GK6A 4HM3A 2QPZA 4ZKUA 1SQPJ 4EMJB 5AW2B 1RF1C 5CBNA 3L70G 2PRRA 4EDFA 3A2AA 5E79H 1SQQK 2R5DA 3HD7A 4C7NA 1X79B 2I8DA 1VF5D 2E74B 1VPCA 1PPJE 5AVYB 2ITAA 3CWBG 1URQC 4NPDA 3H1IJ 4NB8D 2R44A 1NYHA 2PP6A 1T2KD 4HM8A 1RH5B 1NYKA 3PJSK 1SQBJ 2WSFJ 3TGUD 1H8AA 1J1EC 4U3FD 1N86A 3CX5D 1KILE 1FZEA 1FDIA 2C9LY 3N7NA 4AYCA 3L70D 1VDFA 3CXHE 2P1JA 3HE4B 5CJ0A 2H8PD 4WB4A 4L76A 4WY4D 1K8AQ 3A0HE 1VF5C 3VCPA 1IO4A 3RBZA 5AW1B 3K5BA 3WU2E 1ZP0C 3HE5A 2QEXP 1SFCB 3CWBD 3CLQA 4PD4I 1T2KC 1SQQJ 1NTKG 4KHXA 4NB9D 4OVNF 2OYIC 2NVEA 3NFQA 3HUSB 3C0DA 2XDJA 3MUDC 2KS1B 4PV1B 3RL0B 2RN0A 1M1JA 5GTHE 4WY4C 3P32A 3N0QA 4JYBA 3PLNA 4HYTB 5AW6B 1JY2O 5B66E 3WUVA 2YFLA 2ZT9B 3Q5SA 3RK3B 1PV3A 3CCVP 2YMYA 3LW5J 2JDIH 1NTKD 3SWKA 3WUTA 1BGYE 4RESB 3ITKA 4GODA 5APXA 4KJMA 3B5NB 1HTLC 1OZHA 1ZRTE 1QEXA 1PPJG 2ZVOB 1S4XA 2UWJE 3HTKB 3HRNA 3GCEA 2KSEA 3E7KA 3CL3D 2WSEJ 1IC2A 1BSNA 5H2FE 5B5EE 2O01H 1T8ZA 1O7WA 4AIVA 1YYCA 2FYZA 3EN1A 3M0DA 3GF7A 5APVA 1NKZB 5AVQB 2BMQA 2C9NY 3CC2P 1KV4A 4HM4A 3T97A 1JMBA 2B9BA 3RK2C 3V2RA 4UB6E 3FXEA 3CPWO 2JO6A 1FS0E 4QMAA 3GZXA 2M8RA 3M9QA 1H88A 2FBWC 1PPJD 3VMHD 4EOTA 2NUMA 1W2BO 3VMAA 2AXTH 4OGQD 3TGUJ 1CI6B 1XTGB 1QL2A 3G9RA 5CJ4A 4U3FJ 5AW5B 2QG4A 1ZMEC 2HMOA 2FYUE 5TISE 3L36A 2XRXA 4NBGD 2QJYC 2Z5IA 5KJ7D 1GMJA 3L70J 2W83C 4CPGA 1O7GA 3VN0A 1KILD 4I1LA 2B1XA 1QL1A 1NTKK 2KS1A 4L74A 4H13B 1KQSO 3CXHD 1FJPA 1GZLA 2ZAEB 3WUUA 3SSUA 3CWBJ 2BCCD 5GTIE 1DEBA 4RJTA 1AQ5A 1X8YA 1YJ9P 1H0TB 2IYOA 4OGQC 2K88A 5APWA 3Q2YA 3NMDA 5CCHA 3VMGD 2A45H 1IFMA 4QDFB 1HJ0A 5KJ7C 2V4HA 2V7QJ 5DJTB 1J1DB 1KILC 2D2CD 1PGOA 1LTJC 2P10A 3I5CA 2NWFA 2YIUB 2NPSB 2J59M 4NBHD 2OYHB 1LWUB 2YXQB 3BCCD 4OWFA 1IJDB 2LR2A 2ZYDA 4DCKA 1VQKP 1NTKJ 1LT9A 2IBZI 5E79E 1P84H 5TJHA 1O7PA 1JTHB 5CXMA 3UIAA 1KMIZ 2QVAA 2E74C 1GL2B 1U7MA 2Q3IA 3D89A 1KFNA 1BGYD 4Z1MH 2FFDA 2R3CA 2WPSA 2WPRA 1EXIA 1SFCD 2YFJA 1N73A 1N7LA 1ZRTD 2D2CC 2M5AB 3KZIH 3JC22 2KSJA 2FYUG 1KYOE 2YVJB 3AE9C 1Q90D 1QX8A 3CCLP 2Z5HA 3F89A 5KKZC 4NBAD 4LGDE 3WMM0 4QDCA 2KLVA 4AUWA 3AE1C 1S9KE 3OW2O 3B4SA 3H1JE 3VMID 4IFMA 1XTCC 3R2PA 1SFCC 1YTZT 1FZGA 5AVTB 2HMLA 3HD7B 4C7NB 1JEKA 1YTZI 3IFMA 2OTJP 4W80A 2FYUD 1N7SA 2N1TA 4PV1C 1NAFA 5KTBA 4IL6H 2IYPA 4HM6A 3GHGA 2WITA 2CK3H 3SWFA 1VQNP 2BCCJ 2QSIA 2B87A 1RF0A 2G3AA 1FDMA 4O9BA 1GDTA 1LT1A 1LWUA 2QJKB 1HVVA 3B71A 1L2PA 4DOJA 1NDOA 1IK7A 1NJIQ 5AVSB 1Q82Q 2FKWB 4IL6X 4H44B 5CCGD 3HE5B 2KUBA 1JMMA 1KQGB 1VM9A 2K37A 4IOIH 1EDJA 2KOGA 4NPFX 2FXPA 3V5BA 4GKGA 2GUVA 4WBAA 2G8YA 3H1KJ 3BCCJ 2DE5D 1NH4A 3LIEA 1YBKA 5APTA 1M1JB 1PGJA 3O6QB 4NBCD 3GKEA 1BGYJ 1R5LA 1VCKA 3A0BH 4GOEA 1GK4A 5CCGC 1BE3E 2FYUK 3TNUA 2W90A 3VMZA 3H1HE 3H1JG 5AW0B 2LXBA 1NTME 4I2LC 2H88C 1SQVE 3CCQP 1NAYA 1S72P 2KIKA 2NZ2A 2AXTE 1KTMA 1AQTA 1TU3F 2Q5UA 3BRTB 3VYIA 1SQXE 3L37A 2WSCJ 2I1KA 3LW5H 4EYYQ 1K04A 3F5HA 1KYOD 2ZXEB 5BVZA 1EZVI 1ULJA 2WT7B 1JY2P 5CMZA 1FQTA 2CPSA 3D6ZA 3IN6A 3I56P 2IZ1A 1L4AA 1GW4A 1S9KD 3USSA 3H1JD 1DX7A 5BU8B 5M1BA 2DE7D 2E5YA 1KQLA 1R8EA 1VQ4P 3T97B 3L75E 1KB9H 3PTZA 4UB8H 3S1KA 4QURA 2FYUJ 2YXRB 2OGUA 1LP1B 4JQ0D 3PP5A 1FOSF 1J1DC 2A45I 4PD4E 2AEJA 2Q7CA 1HGZA 5BU5A 4JYCA 3IAOA 2YIUC 2HPCA 1YHQP 2OYHC 4AAYB 1PFIA 2OARA 4W7ZA 1FZCA 3LIDA 4OH8B 1GD2E 3AEAC 1YQ4C 1LJ2A 3CX5H 2A06G 1FBMA 1YITP 2HG5D 4RKUJ 3U1AA 1GL2C 1RE3C 1NHLA 2YO2A 1O7NA 4MN4C 1P84I 2XKMA 3O6QA 2KI7B 2N9BA 1BE3G 3W68A 1NU1E 1NGMB 3AEBC 3H1HG 1HH0A 3CD6P 1NTMG 2GM4A 3HD7D 2WMMA 1SQVG 1G2CA 3KZIE 1H89A 4BRYA 1K9MQ 1USDA 3VP9A 1SQXG 3RK2D 3H6PA 1OW8A 2KK7A 3V4WA 3NXSA 1FJKA 3L74E 1HWTC 4DZOA 1VQOP 2GA1A 2Y9ZA 3AEFC 3OJAB 4QDDA 3VOPA 3VMYA 3JCUH 1PGPA 2WT7A 3GTSA 2ZYLA 1MKMA 3L35A 1JY3N 1OVRA 1AA0A 1JOCA 2ZYGA 1L0NE 3ABVC 4D6TE 2Y9YA 3VCAA 1BE3D 3Q5RA 3E1IA 2Q1KA 2QRXA 5AEWA 1LT9B 3H1HD 2Q3EA 3AEEC 3HD7C 2Y0EA 4XA4A 3H1LE 5K5GB 1NTMD 2HMNA 2Q6QA 1SQVD 5L8RJ 1G1JA 2O3JA 3L75G 1FC2C 3W67A 2A45G 2I1JA 1RY3A 1SQXD 2FFDB 2XNDH 1HBWA 2CPBA 2PGDA 1AV1A 2JZAA 2E75B 1LP1A 3CI9A 4IL6E 3RK3E 5APYA 1N73B 1KN7A 1HF9A 4BXLA 1KQFB 2JP3A 1T3JA 5AVWB 1Q86Q 4ZMDA 1M90Q 4L75A 4N3YB 3AECC 3H1JJ 3BRVB 1M8OB 3L73E 2LKMA 1UUVA 2QJKC 1EXJA 3JSVC 3S4RA 3PH0A 5AW3B 2HYNA 1FU1A 2L5GB 5EFWB 2QM7A 4BWNA 2NVGA 4HM7A 3I55P 4YPCA 1RE4A 4ASWA 2VRSA 5KLIB 2FXOA 1NU1G 2LXCB 5KLVE 1DIPA 4PD4D 1AVYA 2WZ7A 2KP8A 5KAFH 4JPZB 1W2EA 2AEMA 3EFGA 2GBWA 3D71A 4YXDC 3OAKA 1N7SB 4XFJA 2AXCA 2E74D 2N1TB 1BCCE 3MTUE 1PIXA 3GHGB 1M56D 3L74G 1M1JC 3CMAP 1G8JB 1NTMK 3V2QA 2SPZA 1SQVK 3VMXA 2W6AA 4YTPC 3A0BE 1WQLA 3TF5A 1JO5A 3CXHH 2B87B 1SQXK 4N6JA 2DE6D 3GL2A 1L0NG 3A5TA 4D6TG 2IPPA 2IBZE 1PGQA 1NU1D 1VF5B 3WU2H 2K1AA 1IFDA 4HH2A 1JUNA 3AZCA 3H1LG 3PHLA 3DQYA 3M9BA 2O01J 2E4PA 1NOHA 3D70A 3GTEA 3L71E 1VQ5P 3MGNA 2R3SA 3EQ2A 3R4YA 1KORA 1KFMA 1QVGO 2OYIB 3L74D 3P8CE 2PFXA 2QE7H 3BATA 5AEUA 1Q81Q 2QIWA 1SVFA 1UIXA 3H1IG 3AE4C 3KDPB 1BE3J 3FWLA 2M3EA 3N4XA 3P8MC 1OVUA 1OX3A 3H1HJ 3M0DC 3GMAA 1SQBG 3L73G 3KYQA 4I7ZB 1NTMJ 4D6TD 2ZXXA 1SQVJ 5B66H 4PV1D 1JNMA 2O1KA 3TDKA 3M9HA 3RL0D 4C7RA 1KB9E 4UB8E 3H1LD 4TT3H 2RMZA 1RF1A 1KB9I 3TNUB 3MHVA 2ZYAA 1PP9E 2IZ0A 2ZT9D 3VTPC 5KLVG 3RK3D 1BDCA 3E1RA 4DT0A 1DD3A 4L73A 2B24A 1EQ7A 4GT1A 2O01N 2BMOA 1ZR4A 3CCUP 1URQA 4IFFA 3B5ND 5APUA 3CX5E 3HUSC 3Q1MA 3L73D 1BCCG 1NTZE 3KPEA 3TK1A 1NU1K 3CX5I 3RL0C 1YIJP 3MIWA 1OWAA 3MD0A 4IFDK 1SJGA 5AVRB 5C39A 1QLED 3KHUA 4NBFD 1L4AB 1VQ7P 4HKVA 3U59A 1AFOA 1PL5A 2XSOA 5AW4B 1OXZA 4HJLA 2ZT9C 5HL4A 2WSFH 3FGAD 3RK3C 2IBZG 3CC7P 1PZQA 5CCHC 5KLVD 1L0LE 2IFMA 1VQ8P 4Y99B 2P7JA 1WRGA 3G71P 4NBED 1OW7A 3B5NC 2KB7P 2JR8A 1HJBA 1VQLP 3Q5PA 3L72E 2C0WA 3L71G 1L0NK 2QM8A 3ZDMA 1BCCD 2QJYB 4N78E 4HM1A 2IFNA 2Y0DA 3JCUE 2HPCB 2OYIA 2O1JA 1IFNA 2Y0CA 1FZCB 3Q3DA 1USEA 2WWWA 3G6EP 3MUDA 1NU1J 2YKPA 2BEZF 3CC4P 3L4FA 1IFPA 1LT9C 1Z56A 2ZFCA 2H43A 2A06E 2FYNB 2BEQD 1RQVA 1S5LH 4WY4A 3H32A 3FWNA 3B8EB 3M91A 1ZXGA 2IBZD 1UIIA 3RL0g 4H13D 1MUUA 2Q3WA 3GZYA 2P67A 1N73C 4Y28J 1IZNB 3L74J 1SQBK 1Y9BA 3L71D 2HR3A 1EDKA 1G2CB 1PP9G 1NVOA 2IDBA 3MP7B 5AW8B 3P8CD 4BRYB 1KILB 1YJNP 5AVVB 3CCMP 1S5LX 3TYYA 4D6TJ 1SP4A 1VQ6P 1EZVE 3FX0A 2YNYA 3GF3A 1NTZG 3H1LJ 2YMKA 5KLVK 3EFFK 3AE3C 2H7HA 4H13C 1KB9D 3H25A 2NPSD 5KLIC 1T6AA 3V2PA 1QVFO 2B88A 1JY3O 4TLFA 2WSEH 1S3JA 1AJYA 1Q2NA 2MKVA 2K9JA 1W5CE 2OTLP 1PP9D 2AEFA 5KAFE 1L0LG 4HM0A 2D2CB 1N7SC 4PJ0H 1GL2D 2B89A 2N1TC 3L73J 2FXMA 5AVUB 2E5TA 3GHGC 4GIFA 1EDIA 2Q9IA 1KYOH 1FZAA 3L72G 1NTZD 1RHZB 2WPVB 1E5WA 2JKVA 1RF0C 3RGUA 2KNCA 1FZBA 2K3RA 2ZJSE 1Y8AA 2NPSC 1RFSA 5KKZB 4R4LA 1LWUC 2BCCE 3CXHI 5KLVJ 4K3AA 4ZNCA 3AE8C 2JWDA 5APQA 4QCKA 1RQUA 1FE6A 1VQPP 1P84E 2WQYC 1L0LD 2WPQA 1K73Q 2XZRA 4I6MC 1LTAC 1BCCJ 1OVVA 3TSIA 4B86A 3MZWB 2QA4P 2IX7C 3L72D 3S9OA 2DW3A 2ZVNB 1T3UA 4M3LA 2KZIA 4N78D 3U1CA 4ZKPA 5KJ7A 2NVFA 2OYOA 2RKLA 1NWQA 2XR8A 1J2JB 1KILA 4I7ZC 3H1KE 2KZJA 3BCCE 1EZVG 1LTJA 1LTIC 3VP8A 1LTTC 2A06D 1LTBC 3GW6A 2WVRA 4WWIA 2V7QH 2E76B 5AVZB 1D7MA 1L4AD 1M1KQ 1N2DC 3GLMA 4HJGH 3L71J 3OA7A 2OQQA 3G4SP 3GL0A 1LTGC 4P1BH 2H89C 4QUPA 1NTZK 3KXDA 2HFED 2M3BA
chains in the Genus database with same CATH topology
1SQPE 1NYKA 2IBZE 1O7GA 1EG9A 2YFJA 1O7NA 1NTZE 1RFSA 4NBDD 3AZCA 4H44D 2BCCE 1BGYE 2B1XA 4HM8A 4P1CH 1NU1E 3DQYA 3L73E 1ULJA 1SJGA 1NDOA 1FQTA 1UUVA 4QCKA 2QJKC 1NTKE 2E4PA 1ZRTE 3TGUE 2HMJA 3GTEA 3L71E 1RIEA 4NBFD 2GBXA 1O7MA 4U3FE 4HKVA 1KYOE 1P84E 3GOBA 3CXHE 2YVJB 3GCEA 2XSOA 4HJLA 3H1IE 2HMMA 4QUQA 1EZVE 2NVGA 5BOKA 5HL4A 2HMKA 5AEUA 4HM7A 1VM9A 2QJPC 2E76D 3L70E 1L0LE 3VCPA 3VMGD 5KKZC 3L74E 1O7HA 1SQBE 2XSHA 4HM2A 4NBAD 4QDFB 3EQQA 1O7WA 2DE7D 3FOUA 3GB4A 4QDCA 4NBED 1UUWA 3L75E 5KLVE 4QDDA 2YFIA 4AIVA 3H1JE 3EN1A 3VMID 4QURA 5KLIC 2NUKA 2NVFA 3GTSA 3L72E 1Q90C 2XR8A 2DE5D 4QDFA 2BMQA 2ZYLA 4PV1D 4HM4A 2D2CD 1ULIA 3CWBE 4NB9D 1KB9E 3H1KE 4HM3A 4HM1A 3BCCE 2GBWA 2HMLA 2JO6A 2QPZA 4EMJB 2NVEA 1L0NE 4D6TE 4PD4E 2NWFA 3VCAA 3GZXA 3C0DA 2E74D 2E4QA 1BCCE 2I7FA 4NBCD 4NBHD 3GKEA 5AEWA 4HM0A 1VCKA 2E75D 3H1LE 2YIUC 2BMRA 2HMNA 1BE3E 3VMHD 1G8JB 4AAYB 1PP9E 2ZT9D 2NUMA 4HM5A 2A06E 4OGQD 3H1HE 4HM6A 3N0QA 1JM1A 1G8KB 1SQQE 1WQLA 1VF5D 1O7PA 5CXMA 2CKFA 3GL0A 1NTME 2HMOA 4H0LD 1PPJE 2FYUE 4P1BH 4QUPA 2FYNC 1SQVE 2B24A 2JZAA 2XRXA 2BMOA 4H13D 2YFLA 4NBGD 2QJYC 4NB8D 3D89A 2DE6D 4NBBD 3GL2A 2Q3WA 3GZYA 1SQXE 3CX5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP E;  1NYK A;  2IBZ E;  1O7G A;  1EG9 A;  2YFJ A;  1O7N A;  1NTZ E;  1RFS A;  4NBD D;  3AZC A;  4H44 D;  2BCC E;  1BGY E;  2B1X A;  4HM8 A;  4P1C H;  1NU1 E;  3DQY A;  3L73 E;  1ULJ A;  1SJG A;  1NDO A;  1FQT A;  1UUV A;  4QCK A;  2QJK C;  1NTK E;  2E4P A;  1ZRT E;  3TGU E;  2HMJ A;  3GTE A;  3L71 E;  1RIE A;  4NBF D;  2GBX A;  1O7M A;  4U3F E;  4HKV A;  1KYO E;  1P84 E;  3GOB A;  3CXH E;  2YVJ B;  3GCE A;  2XSO A;  4HJL A;  3H1I E;  2HMM A;  4QUQ A;  1EZV E;  2NVG A;  5BOK A;  5HL4 A;  2HMK A;  5AEU A;  4HM7 A;  1VM9 A;  2QJP C;  2E76 D;  3L70 E;  1L0L E;  3VCP A;  3VMG D;  5KKZ C;  3L74 E;  1O7H A;  1SQB E;  2XSH A;  4HM2 A;  4NBA D;  4QDF B;  3EQQ A;  1O7W A;  2DE7 D;  3FOU A;  3GB4 A;  4QDC A;  4NBE D;  1UUW A;  3L75 E;  5KLV E;  4QDD A;  2YFI A;  4AIV A;  3H1J E;  3EN1 A;  3VMI D;  4QUR A;  5KLI C;  2NUK A;  2NVF A;  3GTS A;  3L72 E;  1Q90 C;  2XR8 A;  2DE5 D;  4QDF A;  2BMQ A;  2ZYL A;  4PV1 D;  4HM4 A;  2D2C D;  1ULI A;  3CWB E;  4NB9 D;  1KB9 E;  3H1K E;  4HM3 A;  4HM1 A;  3BCC E;  2GBW A;  2HML A;  2JO6 A;  2QPZ A;  4EMJ B;  2NVE A;  1L0N E;  4D6T E;  4PD4 E;  2NWF A;  3VCA A;  3GZX A;  3C0D A;  2E74 D;  2E4Q A;  1BCC E;  2I7F A;  4NBC D;  4NBH D;  3GKE A;  5AEW A;  4HM0 A;  1VCK A;  2E75 D;  3H1L E;  2YIU C;  2BMR A;  2HMN A;  1BE3 E;  3VMH D;  1G8J B;  4AAY B;  1PP9 E;  2ZT9 D;  2NUM A;  4HM5 A;  2A06 E;  4OGQ D;  3H1H E;  4HM6 A;  3N0Q A;  1JM1 A;  1G8K B;  1SQQ E;  1WQL A;  1VF5 D;  1O7P A;  5CXM A;  2CKF A;  3GL0 A;  1NTM E;  2HMO A;  4H0L D;  1PPJ E;  2FYU E;  4P1B H;  4QUP A;  2FYN C;  1SQV E;  2B24 A;  2JZA A;  2XRX A;  2BMO A;  4H13 D;  2YFL A;  4NBG D;  2QJY C;  4NB8 D;  3D89 A;  2DE6 D;  4NBB D;  3GL2 A;  2Q3W A;  3GZY A;  1SQX E;  3CX5 E; 
#chains in the Genus database with same CATH topology
 1SQP E;  3SFE C;  1EG9 A;  3P7K A;  3O8Z A;  4NBD D;  4H44 D;  1K05 A;  4LLH A;  5KAI H;  1JM0 A;  2W8Z A;  1EZV D;  1IFJ A;  4DJG A;  2QJP B;  2L91 A;  1L0L K;  3H1I E;  4QUQ A;  1L4A C;  1ZN5 A;  4H0L B;  1CW5 A;  1KZU B;  1ZW0 A;  3HE4 A;  1OIP A;  1SQB E;  2BCC G;  2W6J H;  4C46 A;  2JEE A;  1PP9 J;  1IK9 A;  3FOU A;  3QH9 A;  1U57 A;  3C8V A;  4Y99 C;  4YXW H;  1HGV A;  1S1C X;  1M7L A;  3CCR P;  1SFC A;  1RF1 B;  4H44 C;  2KLU A;  3L75 D;  1M57 D;  1FOS E;  3D6Y A;  1NTZ J;  5AW9 B;  1GU4 A;  1JB0 J;  3AED C;  3A7O A;  3M0A A;  2BMR A;  3EWK A;  3SWY A;  3HUS A;  3V4Q A;  1MFT A;  1FZC C;  4HM5 A;  1VL2 A;  1URQ B;  1SQQ E;  2OTK E;  2YKQ A;  2CKF A;  1NO4 A;  2FYN C;  2N9Y B;  3H1K G;  1JY2 N;  3BCC G;  4NBB D;  1S5L E;  2HOD B;  4GOF A;  1L0L J;  1U7J A;  1J1E B;  1GU5 A;  1HUC A;  3M06 A;  1DEE G;  4P1C H;  1P84 D;  2BAS A;  4LC1 A;  3V6I A;  1JCD A;  2C0X A;  1BGY G;  3BVH A;  4W7Y A;  3L72 J;  1FDO A;  2POH A;  1YQ3 C;  3A0H H;  2HMJ A;  1RIE A;  1FAV A;  3GOB A;  2R32 A;  4EIJ A;  1S2E A;  3AE5 C;  3B5N A;  4PD4 H;  1X9V A;  3A3Y B;  1IFI A;  2P58 A;  1SQP G;  1OW6 A;  3HTK A;  3GG2 A;  4XE5 B;  1WT6 A;  1VQM P;  4RO0 A;  2W27 A;  1QGK B;  4HM2 A;  3II6 A;  3BAS A;  4R4M A;  1UUW A;  3H1K D;  1FZF A;  2NUK A;  4JF7 A;  2JO1 A;  1ZOY C;  1SS1 A;  4ASV A;  2W6B A;  5GTH H;  2I7F A;  1A02 J;  1N8R Q;  2WTY A;  3CCE P;  3H32 B;  4WY4 B;  1GW3 A;  1A02 F;  1Q7Y Q;  1L0N D;  2XNX A;  5CCG A;  1EDL A;  1JM1 A;  3C9I A;  4PJ0 E;  1BDD A;  5DJU B;  1SQP D;  1SQX J;  1CI6 A;  2GUS A;  2YFI A;  2YO3 A;  1NKN A;  4WVZ A;  3CCS P;  1KYO I;  3AE6 C;  5CCH D;  3V2N A;  2KYV A;  3SFD C;  3H1I D;  2WSS H;  1SQQ G;  1CZQ A;  3TGU E;  3IF4 A;  2Z4E A;  2GBX A;  1OFC X;  4U3F E;  3QWO C;  5CHX A;  5H2F H;  5B5E H;  1OMI A;  2WSC H;  1G1I A;  1SQB D;  4GDO A;  3KQG A;  1EC5 A;  1YJW P;  2E76 D;  1RE4 C;  3L70 E;  2HOD A;  1BSH A;  3L75 J;  1H0T A;  1O7H A;  2XSH A;  4EI2 A;  1R5S A;  2KXP B;  4UB6 H;  4K35 A;  1VQ9 P;  3RK2 B;  3IR9 A;  2K9J B;  3NTN A;  2RH0 A;  2FY8 A;  1CSB A;  4U7J A;  1Q90 C;  4QDF A;  4JBZ A;  4HKZ H;  3CWB E;  2M0B A;  3CCJ P;  2MJZ A;  5APS A;  2J58 A;  2K9Y A;  1LGH B;  4HB1 A;  2YKO A;  2E4Q A;  1MV8 A;  1MZ9 A;  1ZV8 A;  1SQQ D;  4NPE A;  2E75 D;  4AQR D;  1GTW A;  5TIS H;  1DH3 A;  2NPS A;  1JY3 P;  2OYH A;  5CBO A;  2E76 C;  1G8K B;  2E43 A;  2KNC B;  1ZLL A;  4H0L D;  1SLQ A;  2PAJ A;  1SQP K;  3CME P;  2R5B A;  1JTH A;  1KC8 Q;  1KD1 Q;  2P2U A;  2J5U A;  1GL2 A;  1RE3 A;  1X0T A;  5AVX B;  1LTS C;  2XU6 A;  1WMK A;  2JJL A;  5GTI H;  4A7P A;  3FXD A;  1ZR2 A;  1LNQ A;  1NTK E;  3AEG C;  2FFD C;  1E79 H;  1O7M A;  3PRJ A;  2M5A A;  2E75 C;  3AE7 C;  4OGQ B;  3C1L A;  5KAI E;  1YI2 P;  2HMM A;  5AW7 B;  5BOK A;  2HMK A;  2E42 A;  2QJP C;  3AE2 C;  1JCC A;  1X22 A;  3RBX A;  4H0L C;  1URQ D;  4KT0 J;  2NRG A;  3EQQ A;  3GB4 A;  2JWA A;  3G3Z A;  2HLO A;  1MFZ A;  1Y47 A;  1N7S D;  1DD4 A;  2N1T D;  1L0N J;  1LTJ B;  3TGU G;  4U3F G;  1AVO A;  1ULI A;  2XV5 A;  1GK6 A;  4HM3 A;  2QPZ A;  4ZKU A;  1SQP J;  4EMJ B;  5AW2 B;  1RF1 C;  5CBN A;  3L70 G;  2PRR A;  4EDF A;  3A2A A;  5E79 H;  1SQQ K;  2R5D A;  3HD7 A;  4C7N A;  1X79 B;  2I8D A;  1VF5 D;  2E74 B;  1VPC A;  1PPJ E;  5AVY B;  2ITA A;  3CWB G;  1URQ C;  4NPD A;  3H1I J;  4NB8 D;  2R44 A;  1NYH A;  2PP6 A;  1T2K D;  4HM8 A;  1RH5 B;  1NYK A;  3PJS K;  1SQB J;  2WSF J;  3TGU D;  1H8A A;  1J1E C;  4U3F D;  1N86 A;  3CX5 D;  1KIL E;  1FZE A;  1FDI A;  2C9L Y;  3N7N A;  4AYC A;  3L70 D;  1VDF A;  3CXH E;  2P1J A;  3HE4 B;  5CJ0 A;  2H8P D;  4WB4 A;  4L76 A;  4WY4 D;  1K8A Q;  3A0H E;  1VF5 C;  3VCP A;  1IO4 A;  3RBZ A;  5AW1 B;  3K5B A;  3WU2 E;  1ZP0 C;  3HE5 A;  2QEX P;  1SFC B;  3CWB D;  3CLQ A;  4PD4 I;  1T2K C;  1SQQ J;  1NTK G;  4KHX A;  4NB9 D;  4OVN F;  2OYI C;  2NVE A;  3NFQ A;  3HUS B;  3C0D A;  2XDJ A;  3MUD C;  2KS1 B;  4PV1 B;  3RL0 B;  2RN0 A;  1M1J A;  5GTH E;  4WY4 C;  3P32 A;  3N0Q A;  4JYB A;  3PLN A;  4HYT B;  5AW6 B;  1JY2 O;  5B66 E;  3WUV A;  2YFL A;  2ZT9 B;  3Q5S A;  3RK3 B;  1PV3 A;  3CCV P;  2YMY A;  3LW5 J;  2JDI H;  1NTK D;  3SWK A;  3WUT A;  1BGY E;  4RES B;  3ITK A;  4GOD A;  5APX A;  4KJM A;  3B5N B;  1HTL C;  1OZH A;  1ZRT E;  1QEX A;  1PPJ G;  2ZVO B;  1S4X A;  2UWJ E;  3HTK B;  3HRN A;  3GCE A;  2KSE A;  3E7K A;  3CL3 D;  2WSE J;  1IC2 A;  1BSN A;  5H2F E;  5B5E E;  2O01 H;  1T8Z A;  1O7W A;  4AIV A;  1YYC A;  2FYZ A;  3EN1 A;  3M0D A;  3GF7 A;  5APV A;  1NKZ B;  5AVQ B;  2BMQ A;  2C9N Y;  3CC2 P;  1KV4 A;  4HM4 A;  3T97 A;  1JMB A;  2B9B A;  3RK2 C;  3V2R A;  4UB6 E;  3FXE A;  3CPW O;  2JO6 A;  1FS0 E;  4QMA A;  3GZX A;  2M8R A;  3M9Q A;  1H88 A;  2FBW C;  1PPJ D;  3VMH D;  4EOT A;  2NUM A;  1W2B O;  3VMA A;  2AXT H;  4OGQ D;  3TGU J;  1CI6 B;  1XTG B;  1QL2 A;  3G9R A;  5CJ4 A;  4U3F J;  5AW5 B;  2QG4 A;  1ZME C;  2HMO A;  2FYU E;  5TIS E;  3L36 A;  2XRX A;  4NBG D;  2QJY C;  2Z5I A;  5KJ7 D;  1GMJ A;  3L70 J;  2W83 C;  4CPG A;  1O7G A;  3VN0 A;  1KIL D;  4I1L A;  2B1X A;  1QL1 A;  1NTK K;  2KS1 A;  4L74 A;  4H13 B;  1KQS O;  3CXH D;  1FJP A;  1GZL A;  2ZAE B;  3WUU A;  3SSU A;  3CWB J;  2BCC D;  5GTI E;  1DEB A;  4RJT A;  1AQ5 A;  1X8Y A;  1YJ9 P;  1H0T B;  2IYO A;  4OGQ C;  2K88 A;  5APW A;  3Q2Y A;  3NMD A;  5CCH A;  3VMG D;  2A45 H;  1IFM A;  4QDF B;  1HJ0 A;  5KJ7 C;  2V4H A;  2V7Q J;  5DJT B;  1J1D B;  1KIL C;  2D2C D;  1PGO A;  1LTJ C;  2P10 A;  3I5C A;  2NWF A;  2YIU B;  2NPS B;  2J59 M;  4NBH D;  2OYH B;  1LWU B;  2YXQ B;  3BCC D;  4OWF A;  1IJD B;  2LR2 A;  2ZYD A;  4DCK A;  1VQK P;  1NTK J;  1LT9 A;  2IBZ I;  5E79 E;  1P84 H;  5TJH A;  1O7P A;  1JTH B;  5CXM A;  3UIA A;  1KMI Z;  2QVA A;  2E74 C;  1GL2 B;  1U7M A;  2Q3I A;  3D89 A;  1KFN A;  1BGY D;  4Z1M H;  2FFD A;  2R3C A;  2WPS A;  2WPR A;  1EXI A;  1SFC D;  2YFJ A;  1N73 A;  1N7L A;  1ZRT D;  2D2C C;  2M5A B;  3KZI H;  3JC2 2;  2KSJ A;  2FYU G;  1KYO E;  2YVJ B;  3AE9 C;  1Q90 D;  1QX8 A;  3CCL P;  2Z5H A;  3F89 A;  5KKZ C;  4NBA D;  4LGD E;  3WMM 0;  4QDC A;  2KLV A;  4AUW A;  3AE1 C;  1S9K E;  3OW2 O;  3B4S A;  3H1J E;  3VMI D;  4IFM A;  1XTC C;  3R2P A;  1SFC C;  1YTZ T;  1FZG A;  5AVT B;  2HML A;  3HD7 B;  4C7N B;  1JEK A;  1YTZ I;  3IFM A;  2OTJ P;  4W80 A;  2FYU D;  1N7S A;  2N1T A;  4PV1 C;  1NAF A;  5KTB A;  4IL6 H;  2IYP A;  4HM6 A;  3GHG A;  2WIT A;  2CK3 H;  3SWF A;  1VQN P;  2BCC J;  2QSI A;  2B87 A;  1RF0 A;  2G3A A;  1FDM A;  4O9B A;  1GDT A;  1LT1 A;  1LWU A;  2QJK B;  1HVV A;  3B71 A;  1L2P A;  4DOJ A;  1NDO A;  1IK7 A;  1NJI Q;  5AVS B;  1Q82 Q;  2FKW B;  4IL6 X;  4H44 B;  5CCG D;  3HE5 B;  2KUB A;  1JMM A;  1KQG B;  1VM9 A;  2K37 A;  4IOI H;  1EDJ A;  2KOG A;  4NPF X;  2FXP A;  3V5B A;  4GKG A;  2GUV A;  4WBA A;  2G8Y A;  3H1K J;  3BCC J;  2DE5 D;  1NH4 A;  3LIE A;  1YBK A;  5APT A;  1M1J B;  1PGJ A;  3O6Q B;  4NBC D;  3GKE A;  1BGY J;  1R5L A;  1VCK A;  3A0B H;  4GOE A;  1GK4 A;  5CCG C;  1BE3 E;  2FYU K;  3TNU A;  2W90 A;  3VMZ A;  3H1H E;  3H1J G;  5AW0 B;  2LXB A;  1NTM E;  4I2L C;  2H88 C;  1SQV E;  3CCQ P;  1NAY A;  1S72 P;  2KIK A;  2NZ2 A;  2AXT E;  1KTM A;  1AQT A;  1TU3 F;  2Q5U A;  3BRT B;  3VYI A;  1SQX E;  3L37 A;  2WSC J;  2I1K A;  3LW5 H;  4EYY Q;  1K04 A;  3F5H A;  1KYO D;  2ZXE B;  5BVZ A;  1EZV I;  1ULJ A;  2WT7 B;  1JY2 P;  5CMZ A;  1FQT A;  2CPS A;  3D6Z A;  3IN6 A;  3I56 P;  2IZ1 A;  1L4A A;  1GW4 A;  1S9K D;  3USS A;  3H1J D;  1DX7 A;  5BU8 B;  5M1B A;  2DE7 D;  2E5Y A;  1KQL A;  1R8E A;  1VQ4 P;  3T97 B;  3L75 E;  1KB9 H;  3PTZ A;  4UB8 H;  3S1K A;  4QUR A;  2FYU J;  2YXR B;  2OGU A;  1LP1 B;  4JQ0 D;  3PP5 A;  1FOS F;  1J1D C;  2A45 I;  4PD4 E;  2AEJ A;  2Q7C A;  1HGZ A;  5BU5 A;  4JYC A;  3IAO A;  2YIU C;  2HPC A;  1YHQ P;  2OYH C;  4AAY B;  1PFI A;  2OAR A;  4W7Z A;  1FZC A;  3LID A;  4OH8 B;  1GD2 E;  3AEA C;  1YQ4 C;  1LJ2 A;  3CX5 H;  2A06 G;  1FBM A;  1YIT P;  2HG5 D;  4RKU J;  3U1A A;  1GL2 C;  1RE3 C;  1NHL A;  2YO2 A;  1O7N A;  4MN4 C;  1P84 I;  2XKM A;  3O6Q A;  2KI7 B;  2N9B A;  1BE3 G;  3W68 A;  1NU1 E;  1NGM B;  3AEB C;  3H1H G;  1HH0 A;  3CD6 P;  1NTM G;  2GM4 A;  3HD7 D;  2WMM A;  1SQV G;  1G2C A;  3KZI E;  1H89 A;  4BRY A;  1K9M Q;  1USD A;  3VP9 A;  1SQX G;  3RK2 D;  3H6P A;  1OW8 A;  2KK7 A;  3V4W A;  3NXS A;  1FJK A;  3L74 E;  1HWT C;  4DZO A;  1VQO P;  2GA1 A;  2Y9Z A;  3AEF C;  3OJA B;  4QDD A;  3VOP A;  3VMY A;  3JCU H;  1PGP A;  2WT7 A;  3GTS A;  2ZYL A;  1MKM A;  3L35 A;  1JY3 N;  1OVR A;  1AA0 A;  1JOC A;  2ZYG A;  1L0N E;  3ABV C;  4D6T E;  2Y9Y A;  3VCA A;  1BE3 D;  3Q5R A;  3E1I A;  2Q1K A;  2QRX A;  5AEW A;  1LT9 B;  3H1H D;  2Q3E A;  3AEE C;  3HD7 C;  2Y0E A;  4XA4 A;  3H1L E;  5K5G B;  1NTM D;  2HMN A;  2Q6Q A;  1SQV D;  5L8R J;  1G1J A;  2O3J A;  3L75 G;  1FC2 C;  3W67 A;  2A45 G;  2I1J A;  1RY3 A;  1SQX D;  2FFD B;  2XND H;  1HBW A;  2CPB A;  2PGD A;  1AV1 A;  2JZA A;  2E75 B;  1LP1 A;  3CI9 A;  4IL6 E;  3RK3 E;  5APY A;  1N73 B;  1KN7 A;  1HF9 A;  4BXL A;  1KQF B;  2JP3 A;  1T3J A;  5AVW B;  1Q86 Q;  4ZMD A;  1M90 Q;  4L75 A;  4N3Y B;  3AEC C;  3H1J J;  3BRV B;  1M8O B;  3L73 E;  2LKM A;  1UUV A;  2QJK C;  1EXJ A;  3JSV C;  3S4R A;  3PH0 A;  5AW3 B;  2HYN A;  1FU1 A;  2L5G B;  5EFW B;  2QM7 A;  4BWN A;  2NVG A;  4HM7 A;  3I55 P;  4YPC A;  1RE4 A;  4ASW A;  2VRS A;  5KLI B;  2FXO A;  1NU1 G;  2LXC B;  5KLV E;  1DIP A;  4PD4 D;  1AVY A;  2WZ7 A;  2KP8 A;  5KAF H;  4JPZ B;  1W2E A;  2AEM A;  3EFG A;  2GBW A;  3D71 A;  4YXD C;  3OAK A;  1N7S B;  4XFJ A;  2AXC A;  2E74 D;  2N1T B;  1BCC E;  3MTU E;  1PIX A;  3GHG B;  1M56 D;  3L74 G;  1M1J C;  3CMA P;  1G8J B;  1NTM K;  3V2Q A;  2SPZ A;  1SQV K;  3VMX A;  2W6A A;  4YTP C;  3A0B E;  1WQL A;  3TF5 A;  1JO5 A;  3CXH H;  2B87 B;  1SQX K;  4N6J A;  2DE6 D;  3GL2 A;  1L0N G;  3A5T A;  4D6T G;  2IPP A;  2IBZ E;  1PGQ A;  1NU1 D;  1VF5 B;  3WU2 H;  2K1A A;  1IFD A;  4HH2 A;  1JUN A;  3AZC A;  3H1L G;  3PHL A;  3DQY A;  3M9B A;  2O01 J;  2E4P A;  1NOH A;  3D70 A;  3GTE A;  3L71 E;  1VQ5 P;  3MGN A;  2R3S A;  3EQ2 A;  3R4Y A;  1KOR A;  1KFM A;  1QVG O;  2OYI B;  3L74 D;  3P8C E;  2PFX A;  2QE7 H;  3BAT A;  5AEU A;  1Q81 Q;  2QIW A;  1SVF A;  1UIX A;  3H1I G;  3AE4 C;  3KDP B;  1BE3 J;  3FWL A;  2M3E A;  3N4X A;  3P8M C;  1OVU A;  1OX3 A;  3H1H J;  3M0D C;  3GMA A;  1SQB G;  3L73 G;  3KYQ A;  4I7Z B;  1NTM J;  4D6T D;  2ZXX A;  1SQV J;  5B66 H;  4PV1 D;  1JNM A;  2O1K A;  3TDK A;  3M9H A;  3RL0 D;  4C7R A;  1KB9 E;  4UB8 E;  3H1L D;  4TT3 H;  2RMZ A;  1RF1 A;  1KB9 I;  3TNU B;  3MHV A;  2ZYA A;  1PP9 E;  2IZ0 A;  2ZT9 D;  3VTP C;  5KLV G;  3RK3 D;  1BDC A;  3E1R A;  4DT0 A;  1DD3 A;  4L73 A;  2B24 A;  1EQ7 A;  4GT1 A;  2O01 N;  2BMO A;  1ZR4 A;  3CCU P;  1URQ A;  4IFF A;  3B5N D;  5APU A;  3CX5 E;  3HUS C;  3Q1M A;  3L73 D;  1BCC G;  1NTZ E;  3KPE A;  3TK1 A;  1NU1 K;  3CX5 I;  3RL0 C;  1YIJ P;  3MIW A;  1OWA A;  3MD0 A;  4IFD K;  1SJG A;  5AVR B;  5C39 A;  1QLE D;  3KHU A;  4NBF D;  1L4A B;  1VQ7 P;  4HKV A;  3U59 A;  1AFO A;  1PL5 A;  2XSO A;  5AW4 B;  1OXZ A;  4HJL A;  2ZT9 C;  5HL4 A;  2WSF H;  3FGA D;  3RK3 C;  2IBZ G;  3CC7 P;  1PZQ A;  5CCH C;  5KLV D;  1L0L E;  2IFM A;  1VQ8 P;  4Y99 B;  2P7J A;  1WRG A;  3G71 P;  4NBE D;  1OW7 A;  3B5N C;  2KB7 P;  2JR8 A;  1HJB A;  1VQL P;  3Q5P A;  3L72 E;  2C0W A;  3L71 G;  1L0N K;  2QM8 A;  3ZDM A;  1BCC D;  2QJY B;  4N78 E;  4HM1 A;  2IFN A;  2Y0D A;  3JCU E;  2HPC B;  2OYI A;  2O1J A;  1IFN A;  2Y0C A;  1FZC B;  3Q3D A;  1USE A;  2WWW A;  3G6E P;  3MUD A;  1NU1 J;  2YKP A;  2BEZ F;  3CC4 P;  3L4F A;  1IFP A;  1LT9 C;  1Z56 A;  2ZFC A;  2H43 A;  2A06 E;  2FYN B;  2BEQ D;  1RQV A;  1S5L H;  4WY4 A;  3H32 A;  3FWN A;  3B8E B;  3M91 A;  1ZXG A;  2IBZ D;  1UII A;  3RL0 g;  4H13 D;  1MUU A;  2Q3W A;  3GZY A;  2P67 A;  1N73 C;  4Y28 J;  1IZN B;  3L74 J;  1SQB K;  1Y9B A;  3L71 D;  2HR3 A;  1EDK A;  1G2C B;  1PP9 G;  1NVO A;  2IDB A;  3MP7 B;  5AW8 B;  3P8C D;  4BRY B;  1KIL B;  1YJN P;  5AVV B;  3CCM P;  1S5L X;  3TYY A;  4D6T J;  1SP4 A;  1VQ6 P;  1EZV E;  3FX0 A;  2YNY A;  3GF3 A;  1NTZ G;  3H1L J;  2YMK A;  5KLV K;  3EFF K;  3AE3 C;  2H7H A;  4H13 C;  1KB9 D;  3H25 A;  2NPS D;  5KLI C;  1T6A A;  3V2P A;  1QVF O;  2B88 A;  1JY3 O;  4TLF A;  2WSE H;  1S3J A;  1AJY A;  1Q2N A;  2MKV A;  2K9J A;  1W5C E;  2OTL P;  1PP9 D;  2AEF A;  5KAF E;  1L0L G;  4HM0 A;  2D2C B;  1N7S C;  4PJ0 H;  1GL2 D;  2B89 A;  2N1T C;  3L73 J;  2FXM A;  5AVU B;  2E5T A;  3GHG C;  4GIF A;  1EDI A;  2Q9I A;  1KYO H;  1FZA A;  3L72 G;  1NTZ D;  1RHZ B;  2WPV B;  1E5W A;  2JKV A;  1RF0 C;  3RGU A;  2KNC A;  1FZB A;  2K3R A;  2ZJS E;  1Y8A A;  2NPS C;  1RFS A;  5KKZ B;  4R4L A;  1LWU C;  2BCC E;  3CXH I;  5KLV J;  4K3A A;  4ZNC A;  3AE8 C;  2JWD A;  5APQ A;  4QCK A;  1RQU A;  1FE6 A;  1VQP P;  1P84 E;  2WQY C;  1L0L D;  2WPQ A;  1K73 Q;  2XZR A;  4I6M C;  1LTA C;  1BCC J;  1OVV A;  3TSI A;  4B86 A;  3MZW B;  2QA4 P;  2IX7 C;  3L72 D;  3S9O A;  2DW3 A;  2ZVN B;  1T3U A;  4M3L A;  2KZI A;  4N78 D;  3U1C A;  4ZKP A;  5KJ7 A;  2NVF A;  2OYO A;  2RKL A;  1NWQ A;  2XR8 A;  1J2J B;  1KIL A;  4I7Z C;  3H1K E;  2KZJ A;  3BCC E;  1EZV G;  1LTJ A;  1LTI C;  3VP8 A;  1LTT C;  2A06 D;  1LTB C;  3GW6 A;  2WVR A;  4WWI A;  2V7Q H;  2E76 B;  5AVZ B;  1D7M A;  1L4A D;  1M1K Q;  1N2D C;  3GLM A;  4HJG H;  3L71 J;  3OA7 A;  2OQQ A;  3G4S P;  3GL0 A;  1LTG C;  4P1B H;  2H89 C;  4QUP A;  1NTZ K;  3KXD A;  2HFE D;  2M3B A; 
#chains in the Genus database with same CATH homology
 1SQP E;  1NYK A;  2IBZ E;  1O7G A;  1EG9 A;  2YFJ A;  1O7N A;  1NTZ E;  1RFS A;  4NBD D;  3AZC A;  4H44 D;  2BCC E;  1BGY E;  2B1X A;  4HM8 A;  4P1C H;  1NU1 E;  3DQY A;  3L73 E;  1ULJ A;  1SJG A;  1NDO A;  1FQT A;  1UUV A;  4QCK A;  2QJK C;  1NTK E;  2E4P A;  1ZRT E;  3TGU E;  2HMJ A;  3GTE A;  3L71 E;  1RIE A;  4NBF D;  2GBX A;  1O7M A;  4U3F E;  4HKV A;  1KYO E;  1P84 E;  3GOB A;  3CXH E;  2YVJ B;  3GCE A;  2XSO A;  4HJL A;  3H1I E;  2HMM A;  4QUQ A;  1EZV E;  2NVG A;  5BOK A;  5HL4 A;  2HMK A;  5AEU A;  4HM7 A;  1VM9 A;  2QJP C;  2E76 D;  3L70 E;  1L0L E;  3VCP A;  3VMG D;  5KKZ C;  3L74 E;  1O7H A;  1SQB E;  2XSH A;  4HM2 A;  4NBA D;  4QDF B;  3EQQ A;  1O7W A;  2DE7 D;  3FOU A;  3GB4 A;  4QDC A;  4NBE D;  1UUW A;  3L75 E;  5KLV E;  4QDD A;  2YFI A;  4AIV A;  3H1J E;  3EN1 A;  3VMI D;  4QUR A;  5KLI C;  2NUK A;  2NVF A;  3GTS A;  3L72 E;  1Q90 C;  2XR8 A;  2DE5 D;  4QDF A;  2BMQ A;  2ZYL A;  4PV1 D;  4HM4 A;  2D2C D;  1ULI A;  3CWB E;  4NB9 D;  1KB9 E;  3H1K E;  4HM3 A;  4HM1 A;  3BCC E;  2GBW A;  2HML A;  2JO6 A;  2QPZ A;  4EMJ B;  2NVE A;  1L0N E;  4D6T E;  4PD4 E;  2NWF A;  3VCA A;  3GZX A;  3C0D A;  2E74 D;  2E4Q A;  1BCC E;  2I7F A;  4NBC D;  4NBH D;  3GKE A;  5AEW A;  4HM0 A;  1VCK A;  2E75 D;  3H1L E;  2YIU C;  2BMR A;  2HMN A;  1BE3 E;  3VMH D;  1G8J B;  4AAY B;  1PP9 E;  2ZT9 D;  2NUM A;  4HM5 A;  2A06 E;  4OGQ D;  3H1H E;  4HM6 A;  3N0Q A;  1JM1 A;  1G8K B;  1SQQ E;  1WQL A;  1VF5 D;  1O7P A;  5CXM A;  2CKF A;  3GL0 A;  1NTM E;  2HMO A;  4H0L D;  1PPJ E;  2FYU E;  4P1B H;  4QUP A;  2FYN C;  1SQV E;  2B24 A;  2JZA A;  2XRX A;  2BMO A;  4H13 D;  2YFL A;  4NBG D;  2QJY C;  4NB8 D;  3D89 A;  2DE6 D;  4NBB D;  3GL2 A;  2Q3W A;  3GZY A;  1SQX E;  3CX5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...