3H1JE

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 46
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1jE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1jE02
4AAYB 1O7HA 3L71E 3FOUA 3H1LE 4H44D 4QDCA 4H0LD 2B1XA 2NVEA 2YFJA 4NBAD 1KYOE 3VCAA 1O7MA 2QJKC 4HM3A 4QCKA 4NBDD 3GL2A 3CX5E 1VF5D 2XR8A 3GZXA 2NVGA 3VCPA 5BOKA 2D2CD 1O7NA 3TGUE 4PD4E 2E74D 4HM4A 4HKVA 4NB8D 3H1HE 2DE5D 1JM1A 1PPJE 2A06E 2IBZE 2Q3WA 2ZT9D 1KB9E 3GTEA 5KLVE 3GOBA 2E4QA 1NTME 1UUVA 3GTSA 1G8KB 3H1IE 3VMGD 2GBWA 4HM6A 2HMOA 2NWFA 1EZVE 4HM8A 4QURA 1P84E 4EMJB 4QDFA 1NTZE 3GB4A 3CWBE 1L0NE 1SQVE 2BCCE 3L72E 3CXHE 2XSHA 4U3FE 4QUPA 1WQLA 4PV1D 1FQTA 3GL0A 1NU1E 2YIUC 1SQXE 5HL4A 4NBHD 1VM9A 3C0DA 2HMKA 4AIVA 5KLIC 2NUKA 3L74E 3N0QA 1ULIA 2BMOA 2FYNC 2YFIA 3L70E 3D89A 2CKFA 1SQPE 3EN1A 2E76D 4P1BH 2NVFA 3L73E 4QDDA 1VCKA 4HM2A 3VMHD 4HJLA 2HMJA 2FYUE 1RIEA 2DE6D 2GBXA 4HM7A 2ZYLA 1O7GA 2BMQA 3GZYA 1O7PA 1Q90C 1NDOA 1NYKA 5AEUA 2HMNA 4HM0A 2JZAA 2QPZA 2E4PA 1PP9E 2HMMA 2JO6A 1RFSA 4NBCD 2BMRA 1G8JB 1BE3E 4QDFB 4QUQA 3AZCA 2YFLA 2QJYC 1ULJA 4NBED 3H1KE 1EG9A 1BCCE 1L0LE 3GKEA 4NBBD 2B24A 2XRXA 2YVJB 2HMLA 4HM1A 3L75E 3H1JE 3VMID 3EQQA 5AEWA 2XSOA 1SJGA 5KKZC 2I7FA 4H13D 1BGYE 4NB9D 2QJPC 1SQQE 4HM5A 4NBGD 2NUMA 5CXMA 1SQBE 2DE7D 4P1CH 3GCEA 1ZRTE 1NTKE 3DQYA 4OGQD 4D6TE 4NBFD 2E75D 1UUWA 3BCCE 1O7WA
chains in the Genus database with same CATH superfamily
1OFCX 1SQPD 1U7MA 4H0LD 5EFWB 3AE9C 3M9QA 3AE5C 3IFMA 4I6MC 4QCKA 4NBDD 1VF5D 3GZXA 2I1JA 2YO2A 3RK3E 4HM4A 1FJPA 3H1HE 4JYBA 4HB1A 4H44C 3L70D 2KSJA 3RK2B 3VMYA 1UUVA 1OW8A 4WY4C 4QURA 2HFED 3O6QA 3VN0A 3Q5SA 1L0LJ 1WQLA 4I7ZC 5E79E 1EDIA 1Y8AA 3MUDC 1L0NG 1NU1D 3SWKA 2IZ1A 3TYYA 1VL2A 1ZP0C 5KJ7C 4DT0A 4N6JA 2QJYB 4W7ZA 2KLUA 1ZV8A 4JPZB 1FZCB 1NTZJ 1T8ZA 2BMQA 1Q90C 2OYHB 3RL0B 1WMKA 3H32B 5AW0B 2E5YA 3M9HA 1L4AD 4DCKA 2BMRA 1RH5B 1QLED 2QJYC 1BSHA 4GT1A 1L0LG 1DEBA 3KQGA 5KAIE 5KAFE 5E79H 4WY4B 4H13D 3HD7D 2NUMA 2V7QJ 1ZRTE 1CSBA 1GMJA 5AW5B 1CI6B 1UUWA 1CI6A 1EDJA 4W80A 1HGVA 3AECC 1S9KD 1NKNA 2NVEA 3KYQA 1PL5A 1IZNB 3L72D 4PD4H 2ZYAA 1N86A 1NU1K 5BOKA 1GDTA 4NB8D 2A45G 1AJYA 2IBZE 2Q3WA 2Y0CA 1PGOA 2D2CC 1H8AA 2M8RA 3VMGD 2OYHA 2JR8A 1KORA 2H8PD 4PJ0H 4Y28J 1G2CB 2C9LY 1KQLA 3TK1A 2OGUA 1NU1E 1SQXE 4LGDE 5HL4A 3FWLA 2AXTE 5AVYB 1LTAC 5GTIE 3AEBC 2YFIA 5CHXA 1JNMA 5BVZA 2LXBA 2WPSA 3HE5A 3AE2C 4L76A 1VCKA 4TLFA 1HJBA 2OARA 1PV3A 1L0ND 1SQVJ 2QG4A 3CCLP 1L0LK 4H0LC 3VTPC 3H1HD 4PV1C 2O1JA 1JY2N 1K9MQ 1N73B 3FXEA 2WSFJ 3D71A 3H1KD 3OJAB 1BE3E 3GKEA 1NVOA 5H2FE 2R3CA 1VQ6P 1YHQP 2ZAEB 2KLVA 4KT0J 3S9OA 5AVVB 2IBZD 1GK6A 1BE3J 3Q1MA 1D7MA 2E75D 2O1KA 1O7HA 3CL3D 3HUSB 2YKQA 1JY3O 4UB6E 1GK4A 2E76B 1IK7A 2QJKC 2YKOA 3L73D 1VQ5P 2QJPB 2LXCB 1X22A 2Z4EA 3H1IG 2E74D 3D6YA 2DE5D 1JM1A 1PP9J 4JYCA 3EWKA 1FZAA 1GW4A 1X9VA 1EDKA 1URQB 2KOGA 3AE6C 2NPSD 1EZVE 2B89A 2ZT9C 2RH0A 3RBZA 2YXRB 3CWBE 1OVRA 4OH8B 1S1CX 1NTKJ 4WBAA 5TISE 4EDFA 1N7SA 5AVRB 2K9JA 3RK3C 1GTWA 2ZVNB 1VQ8P 3V2NA 3CWBG 2R5DA 3L73E 2OYOA 3CLQA 4HJLA 5DJUB 1OX3A 3VP9A 2JWDA 4IL6H 3KZIH 1OW7A 1XTCC 3H1KJ 1JTHB 2JO1A 2Z5HA 2HMNA 4HM0A 2QPZA 1G8JB 2WPVB 3HTKB 3HTKA 2KZIA 1VPCA 2V7QH 3CXHD 4KJMA 5CBNA 1R5LA 2RKLA 2B87A 2FFDC 4MN4C 1JTHA 3L71E 4QDCA 2IYPA 1GW3A 2KZJA 2W83C 5KLVK 3VCAA 2N1TD 3G9RA 5CCGC 3I56P 2LR2A 4PD4E 2Q3EA 2BEQD 3V6IA 3MD0A 3FGAD 5CCHD 1JY2O 2C0XA 2HR3A 3RL0C 1IFDA 3E7KA 3LW5J 3A0BE 2IYOA 2PP6A 5APSA 1X79B 2GM4A 3SWYA 1KILA 2OTJP 1FAVA 3TDKA 5KAIH 5KAFH 3BATA 1YJWP 3FWNA 3L70E 3D89A 1JO5A 3H1HJ 1LP1A 3NTNA 1IK9A 1AFOA 1YITP 1Q81Q 3P8CE 1NTMG 3PTZA 2WSCJ 2B9BA 1JOCA 1NYKA 1ZRTD 2IBZG 1LTJA 3M06A 2W8ZA 5KLVJ 1OVUA 2W6AA 3BCCJ 2AEJA 1EXIA 3VMAA 2OQQA 1Y47A 4KHXA 3H1JE 1PP9G 2GA1A 3VYIA 2Y9YA 1KQFB 2N1TA 1KB9I 5AW9B 1M1JB 1JCCA 4ZNCA 3L35A 1VDFA 4C7NA 1GZLA 1RE4A 4L75A 1SFCD 2ZT9B 3H25A 1G1IA 1O7NA 3HD7A 3MGNA 2ZXXA 2YNYA 2FYNB 1RE3C 4IFFA 1YTZT 4HM8A 3HRNA 4C7NB 2R3SA 2P58A 1M1JC 5AW2B 1JY3N 4XE5B 1PGQA 4RO0A 3MTUE 3Q5PA 1LJ2A 1KTMA 3GW6A 2BMOA 1M7LA 1S5LE 4OGQB 3VMHD 4WY4A 3R2PA 3HUSC 2XDJA 3G71P 2ZYLA 5AW7B 5KKZB 1UIIA 4RKUJ 3A0HH 2ZJSE 2A06G 4O9BA 4NPDA 3SWFA 3L72G 3AEAC 1NU1J 2O3JA 5APYA 2YVJB 1RQUA 2E76C 1L0NK 3AE7C 2M5AB 4L73A 2QEXP 1QEXA 2YKPA 1CZQA 1O7WA 1PP9D 2PFXA 3WUUA 1HWTC 4EYYQ 1FZCC 3H1LD 1M56D 3F89A 2JJLA 4HM3A 2QSIA 3F5HA 2NVGA 3CCUP 1KILE 4BRYA 3AE4C 1JB0J 1MUUA 1SQQK 4UB6H 1NH4A 1L0NJ 5KLIB 4D6TG 3L71D 2KIKA 3HE5B 4NPFX 1M8OB 3HE4B 2Y0EA 4Y99C 5KLVG 2XSHA 2O01H 1X0TA 3B8EB 1SQBD 2FKWB 3A5TA 1ZXGA 2FYNC 3B71A 2G3AA 3M0DC 3EFFK 1SS1A 2Q9IA 3N7NA 1SQVD 1KILD 1AQTA 2D2CB 1URQC 2B87B 3P7KA 2FYUK 1LWUC 3ABVC 1S72P 4GOEA 1VQ4P 1RQVA 3OW2O 1RF1C 1H0TA 1L0LE 4JBZA 2I7FA 5CJ0A 5AW6B 4U3FD 2A45H 3RK3B 2DE7D 1PPJD 3B4SA 4P1CH 3QWOC 4PD4I 1NTKE 3KPEA 2QM8A 3T97A 1Q86Q 2OYIB 1Q7YQ 1QVGO 3CPWO 2N1TB 3CCQP 3CX5E 2WPRA 3KXDA 2B88A 4OGQC 4K3AA 3SSUA 3GTSA 4IL6X 4JQ0D 1K73Q 1FE6A 2QIWA 3CWBD 1KFMA 3O8ZA 2H89C 3A0HE 3PLNA 2QVAA 3CMEP 4C7RA 3GL0A 2JEEA 1PFIA 2Q1KA 3TNUA 3N0QA 5KLVD 2Q5UA 1YIJP 2E76D 1S5LH 4K35A 5AVXB 1SVFA 3M0DA 2M3BA 2GUSA 4QMAA 4R4MA 1YYCA 2ITAA 3VP8A 3G6EP 1GL2A 1NTKD 4RJTA 1NHLA 3LIEA 1GD2E 1ZW0A 4NBCD 4QDFB 2E75C 4WWIA 4NBED 4YPCA 4IFMA 1FJKA 3JCUH 3CX5D 3GHGA 2KB7P 5KKZC 1SQVK 2V4HA 4PV1B 3H1KG 5CXMA 1LTJC 2YXQB 3H6PA 4B86A 5C39A 3B5ND 2FYUJ 1FDMA 3L70J 3QH9A 4AAYB 4TT3H 3AEFC 2M5AA 1KYOE 1Q2NA 1JUNA 2BCCD 1FZCA 2N9BA 2FXPA 3RBXA 3P8CD 1AVYA 1KMIZ 1OIPA 2WSCH 3L71G 3GTEA 1N7LA 4XFJA 4I1LA 1J1EB 3KDPB 2JDIH 3H1ID 1EDLA 1BCCJ 4EMJB 2CPBA 2M3EA 3MP7B 1L4AB 4U3FE 3NMDA 3SFDC 3AE3C 1H88A 1DIPA 1RF1A 2WSFH 1YTZI 5AW3B 2WWWA 5KLIC 4WY4D 1AA0A 5AVUB 3C9IA 1PZQA 3H1HG 5CBOA 2DE6D 1AV1A 1FC2C 1ZLLA 3GG2A 5B5EE 1BGYG 3U1AA 1ZOYC 3WMM0 2E74C 4QUQA 3H1KE 1BCCE 5CCGD 1HUCA 4GKGA 1RE3A 1G2CA 1KB9H 1HTLC 2HYNA 1LTGC 3L75J 1SFCA 2Q3IA 4GDOA 2OYHC 4WB4A 3CCVP 3D70A 2I8DA 3TGUG 2QM7A 3DQYA 2Z5IA 3GF7A 1PGJA 3V2PA 2NRGA 5CCHA 3FOUA 2Q7CA 4H44D 2J59M 4UB8H 2MKVA 1N73C 2IZ0A 3Q3DA 3CWBJ 1ZMEC 3VMZA 1IC2A 2OYIA 2A06E 3I5CA 1Q82Q 2E4QA 2O01N 5GTHH 4HM6A 2KSEA 4JF7A 3EFGA 4QDFA 3RK2D 2WSSH 4QUPA 1DD4A 4IL6E 1NGMB 1P84I 2PAJA 1RHZB 2W27A 1NTZG 3C0DA 2QJKB 3MZWB 4GIFA 3OAKA 4AUWA 3GHGC 3A3YB 4P1BH 2C0WA 2KS1B 4N78E 4NPEA 1U57A 2KNCA 2KNCB 2GBXA 3L70G 3PP5A 3RK2C 3CCEP 1EZVG 1NAFA 4YXDC 5APWA 2PGDA 1NTKG 1M57D 2IX7C 2XU6A 3P32A 2YFLA 1N7SD 3HD7B 1WT6A 2WT7B 1NU1G 1SJGA 1URQD 3RK3D 2HPCA 1FU1A 4PD4D 1DH3A 4GODA 1JEKA 2AEMA 3VMXA 1EXJA 2WTYA 4RESB 2Y9ZA 4NBFD 5GTHE 1SFCC 1JY2P 1NTMD 2YMKA 3HD7C 1USEA 2QA4P 1HGZA 1MZ9A 3SFEC 1LTSC 2KYVA 1SQXJ 3BASA 4U7JA 3GL2A 3H1JD 3H1JJ 3I55P 1GL2B 1S2EA 4W7YA 2JWAA 2H7HA 2FFDA 3N4XA 1KB9E 4UB8E 1L4AA 5KLVE 1NTME 1G8KB 3B5NA 2N1TC 1P84E 2XZRA 1FZGA 3AEDC 2H43A 4HYTB 3ZDMA 5K5GB 2HODB 1R5SA 1VQKP 1SQXK 1SQQJ 4ZKPA 1U7JA 4Z1MH 4OWFA 1VQOP 2FFDB 1OZHA 1SQPE 1T6AA 1ZR4A 1SQPK 1QX8A 2OTLP 4GOFA 1S3JA 4HM2A 5B5EH 1NTZD 2HMJA 3A7OA 3CC7P 1FOSF 1J1DC 2R5BA 1K05A 1EC5A 3PRJA 1PIXA 1LNQA 1NDOA 5AVWB 2WSEJ 1KZUB 4LLHA 2E4PA 3PHLA 1BCCD 3RGUA 3V4QA 1YQ3C 1KYOD 2G8YA 1HBWA 3WUTA 4LC1A 1NO4A 1LTIC 2QE7H 2WVRA 3L71J 1GU4A 5APQA 4I7ZB 1KYOH 3L72J 3L4FA 3NFQA 1LP1B 1VQ9P 2YFJA 1J1EC 3RL0D 2NPSC 3GF3A 1Z56A 4HJGH 1KILB 1NTKK 2D2CD 1L4AC 4HKVA 1S5LX 3MUDA 4U3FJ 1SQPJ 2BASA 2ZXEB 1VQLP 4IFDK 2O01J 4BXLA 5TJHA 1X8YA 1NYHA 3USSA 2YMYA 2ZYGA 3T97B 1NKZB 1BDCA 3GMAA 1JM0A 2IDBA 3H1LG 3L73J 5KJ7D 3JCUE 2YIUC 1OVVA 2CK3H 2L5GB 1NAYA 3OA7A 1NTMJ 1BE3D 3HE4A 2KUBA 1EZVD 1HH0A 2FYUE 4IOIH 3AE8C 2WT7A 5AVTB 4YTPC 3U1CA 1J2JB 2JZAA 1PP9E 2HMMA 1P84H 4XA4A 2JO6A 3A0BH 1FZFA 3TNUB 2RN0A 3AZCA 2NPSA 2WQYC 2E42A 4BWNA 3MHVA 5AEWA 2XSOA 2KK7A 1S4XA 5KTBA 3CCMP 2NZ2A 2A06D 2K88A 2POHA 3L37A 4N3YB 3CX5I 4H44B 3U59A 4D6TD 1M1JA 1P84D 1IFMA 1Y9BA 3CD6P 4DOJA 2PRRA 3CMAP 2MJZA 2KI7B 3CX5H 3TGUE 1LWUA 1BGYD 2LKMA 3MIWA 5AW4B 1URQA 3FXDA 2OTKE 1DD3A 2RMZA 1H0TB 2HPCB 1SQVE 1K04A 3CXHE 4C46A 1TU3F 5DJTB 4PV1D 1SQBK 2BEZF 5CJ4A 1N2DC 3FX0A 1IFJA 1ULIA 2CKFA 2E74B 2HODA 1FDIA 2CPSA 3JC22 1W2EA 2WSEH 5APXA 2XNXA 4HM7A 1VF5B 3WU2E 1SLQA 1G1JA 1FZEA 2NPSB 3V4WA 4ZMDA 2JKVA 3O6QB 3GHGB 2E5TA 2B24A 3L75E 3AEEC 1EZVI 1NOHA 1T3JA 1PGPA 1T2KD 3EQ2A 2K3RA 1MFZA 2BCCJ 1QGKB 2YIUB 1A02J 1KQSO 2WMMA 3KHUA 1GU5A 2P10A 1O7MA 1SP4A 2HG5D 1AQ5A 3II6A 1SQXD 3G4SP 2XNDH 1SQQG 1WRGA 1JMMA 1SFCB 2ZT9D 1KN7A 3PH0A 5CCGA 2KS1A 3C1LA 1LT9A 2Q6QA 5M1BA 1NTZE 2K37A 2KP8A 1L0NE 2BCCE 1BSNA 1RE4C 2K1AA 2W6JH 3AEGC 1FBMA 1SQPG 4NBHD 1YJ9P 3L74E 5L8RJ 3G3ZA 1DX7A 3M9BA 3R4YA 2E43A 1YQ4C 3H1IJ 3EN1A 1SQXG 1UIXA 1E79H 2NVFA 3H1JG 2IFNA 2P2UA 3L75D 1K8AQ 4OVNF 2AXTH 3VOPA 4DJGA 1KYOI 1IJDB 3M91A 1KD1Q 4H13C 5KJ7A 1YJNP 5AEUA 1USDA 3S1KA 4R4LA 1N73A 3H1LJ 3L73G 1EG9A 3D6ZA 1OXZA 2I1KA 2XRXA 1T2KC 4ASVA 1DEEG 4HM5A 3BRTB 1BGYJ 3ITKA 1NWQA 4L74A 5AW1B 3GCEA 4EIJA 5B66E 1LGHB 4D6TE 3CC4P 2WZ7A 2B1XA 4CPGA 1SQBG 4H0LB 5BU5A 3RL0g 1SQVG 2YO3A 4NBAD 1RF0A 2P67A 3IF4A 5BU8B 3S4RA 2ZFCA 1E5WA 3TGUJ 1PPJE 5CMZA 1YBKA 2W90A 2C9NY 3GLMA 4N78D 2K9YA 1LWUB 4EI2A 3B5NC 3LIDA 4ASWA 3P8MC 3L74D 1QVFO 2HMKA 4AIVA 1IFNA 2ZVOB 2QRXA 3E1RA 1KILC 1LTJB 1RF0C 3BVHA 3CI9A 3IR9A 1JMBA 3B5NB 1GL2D 2IFMA 1BDDA 1LT1A 3GZYA 3A2AA 1NJIQ 2WITA 4DZOA 1T3UA 3K5BA 3IN6A 2WPQA 2Y0DA 1RFSA 2M0BA 4D6TJ 1NTMK 3EQQA 1R8EA 1M90Q 2K9JB 1MFTA 2J5UA 1BGYE 3L36A 3TGUD 4H13B 2N9YB 4NBGD 5AVQB 3CCJP 1SQBE 1KB9D 5CCHC 3UIAA 3V5BA 4OGQD 3BCCG 1N7SC 2J58A 1LTBC 3E1IA 1VQPP 1H89A 1LTTC 4HH2A 3H1LE 1FDOA 1N8RQ 3L74J 5AVZB 2FXOA 4BRYB 1A02F 5B66H 1CW5A 2AEFA 2XR8A 1OW6A 2R44A 4Y99B 1HF9A 1XTGB 3C8VA 1RF1B 1L2PA 2SPZA 3H32A 3H1IE 2GBWA 2HMOA 2NWFA 3JSVC 3W68A 1S9KE 2ZYDA 3L72E 3LW5H 2W6BA 3IAOA 2L91A 5APUA 2OYIC 3BCCD 4YXWH 4QDDA 3KZIE 3L74G 3WU2H 4I2LC 5TISH 1O7GA 1VQNP 1O7PA 3TSIA 4M3LA 2AXCA 2FY8A 2H88C 2BCCG 1BE3G 1M1KQ 2GUVA 2A45I 1ULJA 1RY3A 2P7JA 4NBBD 2R32A 2HMLA 4HM1A 1L0LD 1Q90D 1OWAA 1SQQE 2P1JA 1BCCG 1MV8A 2HLOA 2JP3A 4AQRD 1IFIA 1FZBA 4WVZA 1W5CE 3CXHI 3V2RA 2E75B 1IFPA 1KC8Q 3AE1C 4EOTA 1SQBJ 3M0AA 2DW3A 1LT9B 2VRSA 2FBWC 3WUVA 1JY3P 3NXSA 4HKZH 5AW8B 3VCPA 2XV5A 5AVSB 1YI2P 3Q2YA 1JCDA 1QL1A 1KFNA 1KQGB 5H2FH 1J1DB 3GOBA 3L75G 1VQMP 3PJSK 1KV4A 3V2QA 3CC2P 1IO4A 1HJ0A 4A7PA 2IPPA 3W67A 3GB4A 3Q5RA 5APTA 1N7SB 1FQTA 1VF5C 2FYZA 1W2BO 3CCSP 1VM9A 2NUKA 2FXMA 1EQ7A 1MKMA 3CCRP 1ZN5A 1HVVA 2XKMA 3TF5A 4ZKUA 1RIEA 2FYUG 1SQQD 1PPJG 3CXHH 1FS0E 5GTIH 4AYCA 1ZR2A 5APVA 1QL2A 1LT9C 3HUSA 1AVOA 2UWJE 3VMID 2KXPB 2FYUD 4NB9D 2QJPC 4PJ0E 2IBZI 1GL2C 1VQ7P 1OMIA 4U3FG 3BRVB 1NTZK 3BCCE 1FOSE
chains in the Genus database with same CATH topology
4AAYB 1O7HA 3L71E 3FOUA 3H1LE 4H44D 4QDCA 4H0LD 2B1XA 2NVEA 2YFJA 4NBAD 1KYOE 3VCAA 1O7MA 2QJKC 4HM3A 4QCKA 4NBDD 3GL2A 3CX5E 1VF5D 2XR8A 3GZXA 2NVGA 3VCPA 5BOKA 2D2CD 1O7NA 3TGUE 4PD4E 2E74D 4HM4A 4HKVA 4NB8D 3H1HE 2DE5D 1JM1A 1PPJE 2A06E 2IBZE 2Q3WA 2ZT9D 1KB9E 3GTEA 5KLVE 3GOBA 2E4QA 1NTME 1UUVA 3GTSA 1G8KB 3H1IE 3VMGD 2GBWA 4HM6A 2HMOA 2NWFA 1EZVE 4HM8A 4QURA 1P84E 4EMJB 4QDFA 1NTZE 3GB4A 3CWBE 1L0NE 1SQVE 2BCCE 3L72E 3CXHE 2XSHA 4U3FE 4QUPA 1WQLA 4PV1D 1FQTA 3GL0A 1NU1E 2YIUC 1SQXE 5HL4A 4NBHD 1VM9A 3C0DA 2HMKA 4AIVA 5KLIC 2NUKA 3L74E 3N0QA 1ULIA 2BMOA 2FYNC 2YFIA 3L70E 3D89A 2CKFA 1SQPE 3EN1A 2E76D 4P1BH 2NVFA 3L73E 4QDDA 1VCKA 4HM2A 3VMHD 4HJLA 2HMJA 2FYUE 1RIEA 2DE6D 2GBXA 4HM7A 2ZYLA 1O7GA 2BMQA 3GZYA 1O7PA 1Q90C 1NDOA 1NYKA 5AEUA 2HMNA 4HM0A 2JZAA 2QPZA 2E4PA 1PP9E 2HMMA 2JO6A 1RFSA 4NBCD 2BMRA 1G8JB 1BE3E 4QDFB 4QUQA 3AZCA 2YFLA 2QJYC 1ULJA 4NBED 3H1KE 1EG9A 1BCCE 1L0LE 3GKEA 4NBBD 2B24A 2XRXA 2YVJB 2HMLA 4HM1A 3L75E 3H1JE 3VMID 3EQQA 5AEWA 2XSOA 1SJGA 5KKZC 2I7FA 4H13D 1BGYE 4NB9D 2QJPC 1SQQE 4HM5A 4NBGD 2NUMA 5CXMA 1SQBE 2DE7D 4P1CH 3GCEA 1ZRTE 1NTKE 3DQYA 4OGQD 4D6TE 4NBFD 2E75D 1UUWA 3BCCE 1O7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AAY B;  1O7H A;  3L71 E;  3FOU A;  3H1L E;  4H44 D;  4QDC A;  4H0L D;  2B1X A;  2NVE A;  2YFJ A;  4NBA D;  1KYO E;  3VCA A;  1O7M A;  2QJK C;  4HM3 A;  4QCK A;  4NBD D;  3GL2 A;  3CX5 E;  1VF5 D;  2XR8 A;  3GZX A;  2NVG A;  3VCP A;  5BOK A;  2D2C D;  1O7N A;  3TGU E;  4PD4 E;  2E74 D;  4HM4 A;  4HKV A;  4NB8 D;  3H1H E;  2DE5 D;  1JM1 A;  1PPJ E;  2A06 E;  2IBZ E;  2Q3W A;  2ZT9 D;  1KB9 E;  3GTE A;  5KLV E;  3GOB A;  2E4Q A;  1NTM E;  1UUV A;  3GTS A;  1G8K B;  3H1I E;  3VMG D;  2GBW A;  4HM6 A;  2HMO A;  2NWF A;  1EZV E;  4HM8 A;  4QUR A;  1P84 E;  4EMJ B;  4QDF A;  1NTZ E;  3GB4 A;  3CWB E;  1L0N E;  1SQV E;  2BCC E;  3L72 E;  3CXH E;  2XSH A;  4U3F E;  4QUP A;  1WQL A;  4PV1 D;  1FQT A;  3GL0 A;  1NU1 E;  2YIU C;  1SQX E;  5HL4 A;  4NBH D;  1VM9 A;  3C0D A;  2HMK A;  4AIV A;  5KLI C;  2NUK A;  3L74 E;  3N0Q A;  1ULI A;  2BMO A;  2FYN C;  2YFI A;  3L70 E;  3D89 A;  2CKF A;  1SQP E;  3EN1 A;  2E76 D;  4P1B H;  2NVF A;  3L73 E;  4QDD A;  1VCK A;  4HM2 A;  3VMH D;  4HJL A;  2HMJ A;  2FYU E;  1RIE A;  2DE6 D;  2GBX A;  4HM7 A;  2ZYL A;  1O7G A;  2BMQ A;  3GZY A;  1O7P A;  1Q90 C;  1NDO A;  1NYK A;  5AEU A;  2HMN A;  4HM0 A;  2JZA A;  2QPZ A;  2E4P A;  1PP9 E;  2HMM A;  2JO6 A;  1RFS A;  4NBC D;  2BMR A;  1G8J B;  1BE3 E;  4QDF B;  4QUQ A;  3AZC A;  2YFL A;  2QJY C;  1ULJ A;  4NBE D;  3H1K E;  1EG9 A;  1BCC E;  1L0L E;  3GKE A;  4NBB D;  2B24 A;  2XRX A;  2YVJ B;  2HML A;  4HM1 A;  3L75 E;  3H1J E;  3VMI D;  3EQQ A;  5AEW A;  2XSO A;  1SJG A;  5KKZ C;  2I7F A;  4H13 D;  1BGY E;  4NB9 D;  2QJP C;  1SQQ E;  4HM5 A;  4NBG D;  2NUM A;  5CXM A;  1SQB E;  2DE7 D;  4P1C H;  3GCE A;  1ZRT E;  1NTK E;  3DQY A;  4OGQ D;  4D6T E;  4NBF D;  2E75 D;  1UUW A;  3BCC E;  1O7W A; 
#chains in the Genus database with same CATH topology
 1OFC X;  1SQP D;  1U7M A;  4H0L D;  5EFW B;  3AE9 C;  3M9Q A;  3AE5 C;  3IFM A;  4I6M C;  4QCK A;  4NBD D;  1VF5 D;  3GZX A;  2I1J A;  2YO2 A;  3RK3 E;  4HM4 A;  1FJP A;  3H1H E;  4JYB A;  4HB1 A;  4H44 C;  3L70 D;  2KSJ A;  3RK2 B;  3VMY A;  1UUV A;  1OW8 A;  4WY4 C;  4QUR A;  2HFE D;  3O6Q A;  3VN0 A;  3Q5S A;  1L0L J;  1WQL A;  4I7Z C;  5E79 E;  1EDI A;  1Y8A A;  3MUD C;  1L0N G;  1NU1 D;  3SWK A;  2IZ1 A;  3TYY A;  1VL2 A;  1ZP0 C;  5KJ7 C;  4DT0 A;  4N6J A;  2QJY B;  4W7Z A;  2KLU A;  1ZV8 A;  4JPZ B;  1FZC B;  1NTZ J;  1T8Z A;  2BMQ A;  1Q90 C;  2OYH B;  3RL0 B;  1WMK A;  3H32 B;  5AW0 B;  2E5Y A;  3M9H A;  1L4A D;  4DCK A;  2BMR A;  1RH5 B;  1QLE D;  2QJY C;  1BSH A;  4GT1 A;  1L0L G;  1DEB A;  3KQG A;  5KAI E;  5KAF E;  5E79 H;  4WY4 B;  4H13 D;  3HD7 D;  2NUM A;  2V7Q J;  1ZRT E;  1CSB A;  1GMJ A;  5AW5 B;  1CI6 B;  1UUW A;  1CI6 A;  1EDJ A;  4W80 A;  1HGV A;  3AEC C;  1S9K D;  1NKN A;  2NVE A;  3KYQ A;  1PL5 A;  1IZN B;  3L72 D;  4PD4 H;  2ZYA A;  1N86 A;  1NU1 K;  5BOK A;  1GDT A;  4NB8 D;  2A45 G;  1AJY A;  2IBZ E;  2Q3W A;  2Y0C A;  1PGO A;  2D2C C;  1H8A A;  2M8R A;  3VMG D;  2OYH A;  2JR8 A;  1KOR A;  2H8P D;  4PJ0 H;  4Y28 J;  1G2C B;  2C9L Y;  1KQL A;  3TK1 A;  2OGU A;  1NU1 E;  1SQX E;  4LGD E;  5HL4 A;  3FWL A;  2AXT E;  5AVY B;  1LTA C;  5GTI E;  3AEB C;  2YFI A;  5CHX A;  1JNM A;  5BVZ A;  2LXB A;  2WPS A;  3HE5 A;  3AE2 C;  4L76 A;  1VCK A;  4TLF A;  1HJB A;  2OAR A;  1PV3 A;  1L0N D;  1SQV J;  2QG4 A;  3CCL P;  1L0L K;  4H0L C;  3VTP C;  3H1H D;  4PV1 C;  2O1J A;  1JY2 N;  1K9M Q;  1N73 B;  3FXE A;  2WSF J;  3D71 A;  3H1K D;  3OJA B;  1BE3 E;  3GKE A;  1NVO A;  5H2F E;  2R3C A;  1VQ6 P;  1YHQ P;  2ZAE B;  2KLV A;  4KT0 J;  3S9O A;  5AVV B;  2IBZ D;  1GK6 A;  1BE3 J;  3Q1M A;  1D7M A;  2E75 D;  2O1K A;  1O7H A;  3CL3 D;  3HUS B;  2YKQ A;  1JY3 O;  4UB6 E;  1GK4 A;  2E76 B;  1IK7 A;  2QJK C;  2YKO A;  3L73 D;  1VQ5 P;  2QJP B;  2LXC B;  1X22 A;  2Z4E A;  3H1I G;  2E74 D;  3D6Y A;  2DE5 D;  1JM1 A;  1PP9 J;  4JYC A;  3EWK A;  1FZA A;  1GW4 A;  1X9V A;  1EDK A;  1URQ B;  2KOG A;  3AE6 C;  2NPS D;  1EZV E;  2B89 A;  2ZT9 C;  2RH0 A;  3RBZ A;  2YXR B;  3CWB E;  1OVR A;  4OH8 B;  1S1C X;  1NTK J;  4WBA A;  5TIS E;  4EDF A;  1N7S A;  5AVR B;  2K9J A;  3RK3 C;  1GTW A;  2ZVN B;  1VQ8 P;  3V2N A;  3CWB G;  2R5D A;  3L73 E;  2OYO A;  3CLQ A;  4HJL A;  5DJU B;  1OX3 A;  3VP9 A;  2JWD A;  4IL6 H;  3KZI H;  1OW7 A;  1XTC C;  3H1K J;  1JTH B;  2JO1 A;  2Z5H A;  2HMN A;  4HM0 A;  2QPZ A;  1G8J B;  2WPV B;  3HTK B;  3HTK A;  2KZI A;  1VPC A;  2V7Q H;  3CXH D;  4KJM A;  5CBN A;  1R5L A;  2RKL A;  2B87 A;  2FFD C;  4MN4 C;  1JTH A;  3L71 E;  4QDC A;  2IYP A;  1GW3 A;  2KZJ A;  2W83 C;  5KLV K;  3VCA A;  2N1T D;  3G9R A;  5CCG C;  3I56 P;  2LR2 A;  4PD4 E;  2Q3E A;  2BEQ D;  3V6I A;  3MD0 A;  3FGA D;  5CCH D;  1JY2 O;  2C0X A;  2HR3 A;  3RL0 C;  1IFD A;  3E7K A;  3LW5 J;  3A0B E;  2IYO A;  2PP6 A;  5APS A;  1X79 B;  2GM4 A;  3SWY A;  1KIL A;  2OTJ P;  1FAV A;  3TDK A;  5KAI H;  5KAF H;  3BAT A;  1YJW P;  3FWN A;  3L70 E;  3D89 A;  1JO5 A;  3H1H J;  1LP1 A;  3NTN A;  1IK9 A;  1AFO A;  1YIT P;  1Q81 Q;  3P8C E;  1NTM G;  3PTZ A;  2WSC J;  2B9B A;  1JOC A;  1NYK A;  1ZRT D;  2IBZ G;  1LTJ A;  3M06 A;  2W8Z A;  5KLV J;  1OVU A;  2W6A A;  3BCC J;  2AEJ A;  1EXI A;  3VMA A;  2OQQ A;  1Y47 A;  4KHX A;  3H1J E;  1PP9 G;  2GA1 A;  3VYI A;  2Y9Y A;  1KQF B;  2N1T A;  1KB9 I;  5AW9 B;  1M1J B;  1JCC A;  4ZNC A;  3L35 A;  1VDF A;  4C7N A;  1GZL A;  1RE4 A;  4L75 A;  1SFC D;  2ZT9 B;  3H25 A;  1G1I A;  1O7N A;  3HD7 A;  3MGN A;  2ZXX A;  2YNY A;  2FYN B;  1RE3 C;  4IFF A;  1YTZ T;  4HM8 A;  3HRN A;  4C7N B;  2R3S A;  2P58 A;  1M1J C;  5AW2 B;  1JY3 N;  4XE5 B;  1PGQ A;  4RO0 A;  3MTU E;  3Q5P A;  1LJ2 A;  1KTM A;  3GW6 A;  2BMO A;  1M7L A;  1S5L E;  4OGQ B;  3VMH D;  4WY4 A;  3R2P A;  3HUS C;  2XDJ A;  3G71 P;  2ZYL A;  5AW7 B;  5KKZ B;  1UII A;  4RKU J;  3A0H H;  2ZJS E;  2A06 G;  4O9B A;  4NPD A;  3SWF A;  3L72 G;  3AEA C;  1NU1 J;  2O3J A;  5APY A;  2YVJ B;  1RQU A;  2E76 C;  1L0N K;  3AE7 C;  2M5A B;  4L73 A;  2QEX P;  1QEX A;  2YKP A;  1CZQ A;  1O7W A;  1PP9 D;  2PFX A;  3WUU A;  1HWT C;  4EYY Q;  1FZC C;  3H1L D;  1M56 D;  3F89 A;  2JJL A;  4HM3 A;  2QSI A;  3F5H A;  2NVG A;  3CCU P;  1KIL E;  4BRY A;  3AE4 C;  1JB0 J;  1MUU A;  1SQQ K;  4UB6 H;  1NH4 A;  1L0N J;  5KLI B;  4D6T G;  3L71 D;  2KIK A;  3HE5 B;  4NPF X;  1M8O B;  3HE4 B;  2Y0E A;  4Y99 C;  5KLV G;  2XSH A;  2O01 H;  1X0T A;  3B8E B;  1SQB D;  2FKW B;  3A5T A;  1ZXG A;  2FYN C;  3B71 A;  2G3A A;  3M0D C;  3EFF K;  1SS1 A;  2Q9I A;  3N7N A;  1SQV D;  1KIL D;  1AQT A;  2D2C B;  1URQ C;  2B87 B;  3P7K A;  2FYU K;  1LWU C;  3ABV C;  1S72 P;  4GOE A;  1VQ4 P;  1RQV A;  3OW2 O;  1RF1 C;  1H0T A;  1L0L E;  4JBZ A;  2I7F A;  5CJ0 A;  5AW6 B;  4U3F D;  2A45 H;  3RK3 B;  2DE7 D;  1PPJ D;  3B4S A;  4P1C H;  3QWO C;  4PD4 I;  1NTK E;  3KPE A;  2QM8 A;  3T97 A;  1Q86 Q;  2OYI B;  1Q7Y Q;  1QVG O;  3CPW O;  2N1T B;  3CCQ P;  3CX5 E;  2WPR A;  3KXD A;  2B88 A;  4OGQ C;  4K3A A;  3SSU A;  3GTS A;  4IL6 X;  4JQ0 D;  1K73 Q;  1FE6 A;  2QIW A;  3CWB D;  1KFM A;  3O8Z A;  2H89 C;  3A0H E;  3PLN A;  2QVA A;  3CME P;  4C7R A;  3GL0 A;  2JEE A;  1PFI A;  2Q1K A;  3TNU A;  3N0Q A;  5KLV D;  2Q5U A;  1YIJ P;  2E76 D;  1S5L H;  4K35 A;  5AVX B;  1SVF A;  3M0D A;  2M3B A;  2GUS A;  4QMA A;  4R4M A;  1YYC A;  2ITA A;  3VP8 A;  3G6E P;  1GL2 A;  1NTK D;  4RJT A;  1NHL A;  3LIE A;  1GD2 E;  1ZW0 A;  4NBC D;  4QDF B;  2E75 C;  4WWI A;  4NBE D;  4YPC A;  4IFM A;  1FJK A;  3JCU H;  3CX5 D;  3GHG A;  2KB7 P;  5KKZ C;  1SQV K;  2V4H A;  4PV1 B;  3H1K G;  5CXM A;  1LTJ C;  2YXQ B;  3H6P A;  4B86 A;  5C39 A;  3B5N D;  2FYU J;  1FDM A;  3L70 J;  3QH9 A;  4AAY B;  4TT3 H;  3AEF C;  2M5A A;  1KYO E;  1Q2N A;  1JUN A;  2BCC D;  1FZC A;  2N9B A;  2FXP A;  3RBX A;  3P8C D;  1AVY A;  1KMI Z;  1OIP A;  2WSC H;  3L71 G;  3GTE A;  1N7L A;  4XFJ A;  4I1L A;  1J1E B;  3KDP B;  2JDI H;  3H1I D;  1EDL A;  1BCC J;  4EMJ B;  2CPB A;  2M3E A;  3MP7 B;  1L4A B;  4U3F E;  3NMD A;  3SFD C;  3AE3 C;  1H88 A;  1DIP A;  1RF1 A;  2WSF H;  1YTZ I;  5AW3 B;  2WWW A;  5KLI C;  4WY4 D;  1AA0 A;  5AVU B;  3C9I A;  1PZQ A;  3H1H G;  5CBO A;  2DE6 D;  1AV1 A;  1FC2 C;  1ZLL A;  3GG2 A;  5B5E E;  1BGY G;  3U1A A;  1ZOY C;  3WMM 0;  2E74 C;  4QUQ A;  3H1K E;  1BCC E;  5CCG D;  1HUC A;  4GKG A;  1RE3 A;  1G2C A;  1KB9 H;  1HTL C;  2HYN A;  1LTG C;  3L75 J;  1SFC A;  2Q3I A;  4GDO A;  2OYH C;  4WB4 A;  3CCV P;  3D70 A;  2I8D A;  3TGU G;  2QM7 A;  3DQY A;  2Z5I A;  3GF7 A;  1PGJ A;  3V2P A;  2NRG A;  5CCH A;  3FOU A;  2Q7C A;  4H44 D;  2J59 M;  4UB8 H;  2MKV A;  1N73 C;  2IZ0 A;  3Q3D A;  3CWB J;  1ZME C;  3VMZ A;  1IC2 A;  2OYI A;  2A06 E;  3I5C A;  1Q82 Q;  2E4Q A;  2O01 N;  5GTH H;  4HM6 A;  2KSE A;  4JF7 A;  3EFG A;  4QDF A;  3RK2 D;  2WSS H;  4QUP A;  1DD4 A;  4IL6 E;  1NGM B;  1P84 I;  2PAJ A;  1RHZ B;  2W27 A;  1NTZ G;  3C0D A;  2QJK B;  3MZW B;  4GIF A;  3OAK A;  4AUW A;  3GHG C;  3A3Y B;  4P1B H;  2C0W A;  2KS1 B;  4N78 E;  4NPE A;  1U57 A;  2KNC A;  2KNC B;  2GBX A;  3L70 G;  3PP5 A;  3RK2 C;  3CCE P;  1EZV G;  1NAF A;  4YXD C;  5APW A;  2PGD A;  1NTK G;  1M57 D;  2IX7 C;  2XU6 A;  3P32 A;  2YFL A;  1N7S D;  3HD7 B;  1WT6 A;  2WT7 B;  1NU1 G;  1SJG A;  1URQ D;  3RK3 D;  2HPC A;  1FU1 A;  4PD4 D;  1DH3 A;  4GOD A;  1JEK A;  2AEM A;  3VMX A;  1EXJ A;  2WTY A;  4RES B;  2Y9Z A;  4NBF D;  5GTH E;  1SFC C;  1JY2 P;  1NTM D;  2YMK A;  3HD7 C;  1USE A;  2QA4 P;  1HGZ A;  1MZ9 A;  3SFE C;  1LTS C;  2KYV A;  1SQX J;  3BAS A;  4U7J A;  3GL2 A;  3H1J D;  3H1J J;  3I55 P;  1GL2 B;  1S2E A;  4W7Y A;  2JWA A;  2H7H A;  2FFD A;  3N4X A;  1KB9 E;  4UB8 E;  1L4A A;  5KLV E;  1NTM E;  1G8K B;  3B5N A;  2N1T C;  1P84 E;  2XZR A;  1FZG A;  3AED C;  2H43 A;  4HYT B;  3ZDM A;  5K5G B;  2HOD B;  1R5S A;  1VQK P;  1SQX K;  1SQQ J;  4ZKP A;  1U7J A;  4Z1M H;  4OWF A;  1VQO P;  2FFD B;  1OZH A;  1SQP E;  1T6A A;  1ZR4 A;  1SQP K;  1QX8 A;  2OTL P;  4GOF A;  1S3J A;  4HM2 A;  5B5E H;  1NTZ D;  2HMJ A;  3A7O A;  3CC7 P;  1FOS F;  1J1D C;  2R5B A;  1K05 A;  1EC5 A;  3PRJ A;  1PIX A;  1LNQ A;  1NDO A;  5AVW B;  2WSE J;  1KZU B;  4LLH A;  2E4P A;  3PHL A;  1BCC D;  3RGU A;  3V4Q A;  1YQ3 C;  1KYO D;  2G8Y A;  1HBW A;  3WUT A;  4LC1 A;  1NO4 A;  1LTI C;  2QE7 H;  2WVR A;  3L71 J;  1GU4 A;  5APQ A;  4I7Z B;  1KYO H;  3L72 J;  3L4F A;  3NFQ A;  1LP1 B;  1VQ9 P;  2YFJ A;  1J1E C;  3RL0 D;  2NPS C;  3GF3 A;  1Z56 A;  4HJG H;  1KIL B;  1NTK K;  2D2C D;  1L4A C;  4HKV A;  1S5L X;  3MUD A;  4U3F J;  1SQP J;  2BAS A;  2ZXE B;  1VQL P;  4IFD K;  2O01 J;  4BXL A;  5TJH A;  1X8Y A;  1NYH A;  3USS A;  2YMY A;  2ZYG A;  3T97 B;  1NKZ B;  1BDC A;  3GMA A;  1JM0 A;  2IDB A;  3H1L G;  3L73 J;  5KJ7 D;  3JCU E;  2YIU C;  1OVV A;  2CK3 H;  2L5G B;  1NAY A;  3OA7 A;  1NTM J;  1BE3 D;  3HE4 A;  2KUB A;  1EZV D;  1HH0 A;  2FYU E;  4IOI H;  3AE8 C;  2WT7 A;  5AVT B;  4YTP C;  3U1C A;  1J2J B;  2JZA A;  1PP9 E;  2HMM A;  1P84 H;  4XA4 A;  2JO6 A;  3A0B H;  1FZF A;  3TNU B;  2RN0 A;  3AZC A;  2NPS A;  2WQY C;  2E42 A;  4BWN A;  3MHV A;  5AEW A;  2XSO A;  2KK7 A;  1S4X A;  5KTB A;  3CCM P;  2NZ2 A;  2A06 D;  2K88 A;  2POH A;  3L37 A;  4N3Y B;  3CX5 I;  4H44 B;  3U59 A;  4D6T D;  1M1J A;  1P84 D;  1IFM A;  1Y9B A;  3CD6 P;  4DOJ A;  2PRR A;  3CMA P;  2MJZ A;  2KI7 B;  3CX5 H;  3TGU E;  1LWU A;  1BGY D;  2LKM A;  3MIW A;  5AW4 B;  1URQ A;  3FXD A;  2OTK E;  1DD3 A;  2RMZ A;  1H0T B;  2HPC B;  1SQV E;  1K04 A;  3CXH E;  4C46 A;  1TU3 F;  5DJT B;  4PV1 D;  1SQB K;  2BEZ F;  5CJ4 A;  1N2D C;  3FX0 A;  1IFJ A;  1ULI A;  2CKF A;  2E74 B;  2HOD A;  1FDI A;  2CPS A;  3JC2 2;  1W2E A;  2WSE H;  5APX A;  2XNX A;  4HM7 A;  1VF5 B;  3WU2 E;  1SLQ A;  1G1J A;  1FZE A;  2NPS B;  3V4W A;  4ZMD A;  2JKV A;  3O6Q B;  3GHG B;  2E5T A;  2B24 A;  3L75 E;  3AEE C;  1EZV I;  1NOH A;  1T3J A;  1PGP A;  1T2K D;  3EQ2 A;  2K3R A;  1MFZ A;  2BCC J;  1QGK B;  2YIU B;  1A02 J;  1KQS O;  2WMM A;  3KHU A;  1GU5 A;  2P10 A;  1O7M A;  1SP4 A;  2HG5 D;  1AQ5 A;  3II6 A;  1SQX D;  3G4S P;  2XND H;  1SQQ G;  1WRG A;  1JMM A;  1SFC B;  2ZT9 D;  1KN7 A;  3PH0 A;  5CCG A;  2KS1 A;  3C1L A;  1LT9 A;  2Q6Q A;  5M1B A;  1NTZ E;  2K37 A;  2KP8 A;  1L0N E;  2BCC E;  1BSN A;  1RE4 C;  2K1A A;  2W6J H;  3AEG C;  1FBM A;  1SQP G;  4NBH D;  1YJ9 P;  3L74 E;  5L8R J;  3G3Z A;  1DX7 A;  3M9B A;  3R4Y A;  2E43 A;  1YQ4 C;  3H1I J;  3EN1 A;  1SQX G;  1UIX A;  1E79 H;  2NVF A;  3H1J G;  2IFN A;  2P2U A;  3L75 D;  1K8A Q;  4OVN F;  2AXT H;  3VOP A;  4DJG A;  1KYO I;  1IJD B;  3M91 A;  1KD1 Q;  4H13 C;  5KJ7 A;  1YJN P;  5AEU A;  1USD A;  3S1K A;  4R4L A;  1N73 A;  3H1L J;  3L73 G;  1EG9 A;  3D6Z A;  1OXZ A;  2I1K A;  2XRX A;  1T2K C;  4ASV A;  1DEE G;  4HM5 A;  3BRT B;  1BGY J;  3ITK A;  1NWQ A;  4L74 A;  5AW1 B;  3GCE A;  4EIJ A;  5B66 E;  1LGH B;  4D6T E;  3CC4 P;  2WZ7 A;  2B1X A;  4CPG A;  1SQB G;  4H0L B;  5BU5 A;  3RL0 g;  1SQV G;  2YO3 A;  4NBA D;  1RF0 A;  2P67 A;  3IF4 A;  5BU8 B;  3S4R A;  2ZFC A;  1E5W A;  3TGU J;  1PPJ E;  5CMZ A;  1YBK A;  2W90 A;  2C9N Y;  3GLM A;  4N78 D;  2K9Y A;  1LWU B;  4EI2 A;  3B5N C;  3LID A;  4ASW A;  3P8M C;  3L74 D;  1QVF O;  2HMK A;  4AIV A;  1IFN A;  2ZVO B;  2QRX A;  3E1R A;  1KIL C;  1LTJ B;  1RF0 C;  3BVH A;  3CI9 A;  3IR9 A;  1JMB A;  3B5N B;  1GL2 D;  2IFM A;  1BDD A;  1LT1 A;  3GZY A;  3A2A A;  1NJI Q;  2WIT A;  4DZO A;  1T3U A;  3K5B A;  3IN6 A;  2WPQ A;  2Y0D A;  1RFS A;  2M0B A;  4D6T J;  1NTM K;  3EQQ A;  1R8E A;  1M90 Q;  2K9J B;  1MFT A;  2J5U A;  1BGY E;  3L36 A;  3TGU D;  4H13 B;  2N9Y B;  4NBG D;  5AVQ B;  3CCJ P;  1SQB E;  1KB9 D;  5CCH C;  3UIA A;  3V5B A;  4OGQ D;  3BCC G;  1N7S C;  2J58 A;  1LTB C;  3E1I A;  1VQP P;  1H89 A;  1LTT C;  4HH2 A;  3H1L E;  1FDO A;  1N8R Q;  3L74 J;  5AVZ B;  2FXO A;  4BRY B;  1A02 F;  5B66 H;  1CW5 A;  2AEF A;  2XR8 A;  1OW6 A;  2R44 A;  4Y99 B;  1HF9 A;  1XTG B;  3C8V A;  1RF1 B;  1L2P A;  2SPZ A;  3H32 A;  3H1I E;  2GBW A;  2HMO A;  2NWF A;  3JSV C;  3W68 A;  1S9K E;  2ZYD A;  3L72 E;  3LW5 H;  2W6B A;  3IAO A;  2L91 A;  5APU A;  2OYI C;  3BCC D;  4YXW H;  4QDD A;  3KZI E;  3L74 G;  3WU2 H;  4I2L C;  5TIS H;  1O7G A;  1VQN P;  1O7P A;  3TSI A;  4M3L A;  2AXC A;  2FY8 A;  2H88 C;  2BCC G;  1BE3 G;  1M1K Q;  2GUV A;  2A45 I;  1ULJ A;  1RY3 A;  2P7J A;  4NBB D;  2R32 A;  2HML A;  4HM1 A;  1L0L D;  1Q90 D;  1OWA A;  1SQQ E;  2P1J A;  1BCC G;  1MV8 A;  2HLO A;  2JP3 A;  4AQR D;  1IFI A;  1FZB A;  4WVZ A;  1W5C E;  3CXH I;  3V2R A;  2E75 B;  1IFP A;  1KC8 Q;  3AE1 C;  4EOT A;  1SQB J;  3M0A A;  2DW3 A;  1LT9 B;  2VRS A;  2FBW C;  3WUV A;  1JY3 P;  3NXS A;  4HKZ H;  5AW8 B;  3VCP A;  2XV5 A;  5AVS B;  1YI2 P;  3Q2Y A;  1JCD A;  1QL1 A;  1KFN A;  1KQG B;  5H2F H;  1J1D B;  3GOB A;  3L75 G;  1VQM P;  3PJS K;  1KV4 A;  3V2Q A;  3CC2 P;  1IO4 A;  1HJ0 A;  4A7P A;  2IPP A;  3W67 A;  3GB4 A;  3Q5R A;  5APT A;  1N7S B;  1FQT A;  1VF5 C;  2FYZ A;  1W2B O;  3CCS P;  1VM9 A;  2NUK A;  2FXM A;  1EQ7 A;  1MKM A;  3CCR P;  1ZN5 A;  1HVV A;  2XKM A;  3TF5 A;  4ZKU A;  1RIE A;  2FYU G;  1SQQ D;  1PPJ G;  3CXH H;  1FS0 E;  5GTI H;  4AYC A;  1ZR2 A;  5APV A;  1QL2 A;  1LT9 C;  3HUS A;  1AVO A;  2UWJ E;  3VMI D;  2KXP B;  2FYU D;  4NB9 D;  2QJP C;  4PJ0 E;  2IBZ I;  1GL2 C;  1VQ7 P;  1OMI A;  4U3F G;  3BRV B;  1NTZ K;  3BCC E;  1FOS E; 
#chains in the Genus database with same CATH homology
 4AAY B;  1O7H A;  3L71 E;  3FOU A;  3H1L E;  4H44 D;  4QDC A;  4H0L D;  2B1X A;  2NVE A;  2YFJ A;  4NBA D;  1KYO E;  3VCA A;  1O7M A;  2QJK C;  4HM3 A;  4QCK A;  4NBD D;  3GL2 A;  3CX5 E;  1VF5 D;  2XR8 A;  3GZX A;  2NVG A;  3VCP A;  5BOK A;  2D2C D;  1O7N A;  3TGU E;  4PD4 E;  2E74 D;  4HM4 A;  4HKV A;  4NB8 D;  3H1H E;  2DE5 D;  1JM1 A;  1PPJ E;  2A06 E;  2IBZ E;  2Q3W A;  2ZT9 D;  1KB9 E;  3GTE A;  5KLV E;  3GOB A;  2E4Q A;  1NTM E;  1UUV A;  3GTS A;  1G8K B;  3H1I E;  3VMG D;  2GBW A;  4HM6 A;  2HMO A;  2NWF A;  1EZV E;  4HM8 A;  4QUR A;  1P84 E;  4EMJ B;  4QDF A;  1NTZ E;  3GB4 A;  3CWB E;  1L0N E;  1SQV E;  2BCC E;  3L72 E;  3CXH E;  2XSH A;  4U3F E;  4QUP A;  1WQL A;  4PV1 D;  1FQT A;  3GL0 A;  1NU1 E;  2YIU C;  1SQX E;  5HL4 A;  4NBH D;  1VM9 A;  3C0D A;  2HMK A;  4AIV A;  5KLI C;  2NUK A;  3L74 E;  3N0Q A;  1ULI A;  2BMO A;  2FYN C;  2YFI A;  3L70 E;  3D89 A;  2CKF A;  1SQP E;  3EN1 A;  2E76 D;  4P1B H;  2NVF A;  3L73 E;  4QDD A;  1VCK A;  4HM2 A;  3VMH D;  4HJL A;  2HMJ A;  2FYU E;  1RIE A;  2DE6 D;  2GBX A;  4HM7 A;  2ZYL A;  1O7G A;  2BMQ A;  3GZY A;  1O7P A;  1Q90 C;  1NDO A;  1NYK A;  5AEU A;  2HMN A;  4HM0 A;  2JZA A;  2QPZ A;  2E4P A;  1PP9 E;  2HMM A;  2JO6 A;  1RFS A;  4NBC D;  2BMR A;  1G8J B;  1BE3 E;  4QDF B;  4QUQ A;  3AZC A;  2YFL A;  2QJY C;  1ULJ A;  4NBE D;  3H1K E;  1EG9 A;  1BCC E;  1L0L E;  3GKE A;  4NBB D;  2B24 A;  2XRX A;  2YVJ B;  2HML A;  4HM1 A;  3L75 E;  3H1J E;  3VMI D;  3EQQ A;  5AEW A;  2XSO A;  1SJG A;  5KKZ C;  2I7F A;  4H13 D;  1BGY E;  4NB9 D;  2QJP C;  1SQQ E;  4HM5 A;  4NBG D;  2NUM A;  5CXM A;  1SQB E;  2DE7 D;  4P1C H;  3GCE A;  1ZRT E;  1NTK E;  3DQY A;  4OGQ D;  4D6T E;  4NBF D;  2E75 D;  1UUW A;  3BCC E;  1O7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...