3H1JE

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 46
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1jE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1jE02
2FYNC 3GL0A 4QDCA 3CWBE 1SQBE 5KLVE 2HMMA 3H1HE 1NTME 3VMGD 3GB4A 4QUQA 4P1CH 2D2CD 3EN1A 2YFLA 4D6TE 3H1KE 1PP9E 4EMJB 3GL2A 3GTEA 4H0LD 2XRXA 2NUMA 4QDFB 1FQTA 3GKEA 4QDFA 4NBCD 4PD4E 2NUKA 3GZYA 1ULJA 2DE6D 2GBXA 1NDOA 1G8KB 1O7HA 1O7GA 4PV1D 4H13D 3H1LE 3H1JE 1O7WA 2E74D 2QJYC 2YIUC 3VCAA 5CXMA 2BMRA 4NBBD 1L0NE 1KB9E 2YFJA 4HM0A 1ULIA 2I7FA 3H1IE 4NB8D 2NVFA 2BCCE 2E75D 1KYOE 5BOKA 3BCCE 2CKFA 3FOUA 2JO6A 2HMKA 2QJKC 1O7MA 2YVJB 3D89A 1NYKA 1UUVA 2QJPC 4OGQD 1VM9A 3VMID 1L0LE 4HM3A 3CX5E 4HJLA 1SQQE 3GZXA 5AEWA 1SJGA 2ZT9D 3L75E 1WQLA 4NBHD 1BGYE 2HMLA 5AEUA 4HKVA 4HM4A 2E4QA 3GTSA 4NBDD 1G8JB 4U3FE 2E76D 2GBWA 1UUWA 3EQQA 1BE3E 2HMNA 1ZRTE 3VCPA 3L73E 1VCKA 2JZAA 2E4PA 4HM2A 5KLIC 1JM1A 1PPJE 3CXHE 1NTKE 5HL4A 4HM5A 2XR8A 4NBAD 5KKZC 2DE5D 4P1BH 1O7PA 3GCEA 2BMQA 3DQYA 4HM7A 2ZYLA 4HM8A 3L74E 1BCCE 1RIEA 1NU1E 2B1XA 3N0QA 2XSOA 4NBGD 1SQVE 1EG9A 2YFIA 4AAYB 4HM6A 1O7NA 4NB9D 2QPZA 3L71E 2NVEA 3L72E 2BMOA 3AZCA 4QCKA 4QUPA 1EZVE 3L70E 1Q90C 2B24A 4H44D 1P84E 2NWFA 4NBFD 1NTZE 2HMOA 4NBED 3VMHD 2HMJA 4HM1A 1VF5D 3GOBA 3TGUE 2XSHA 2NVGA 1RFSA 2DE7D 2FYUE 2Q3WA 2IBZE 4QURA 4AIVA 4QDDA 1SQPE 3C0DA 2A06E 1SQXE
chains in the Genus database with same CATH superfamily
1S9KE 1RE3C 2AXTH 2K1AA 3VMGD 2Q3IA 5CMZA 2Q5UA 1FS0E 1EQ7A 2H89C 1QEXA 4JYCA 3M06A 5KLVJ 3H1HJ 3VOPA 1YIJP 1AVOA 1K05A 1J1DB 1PP9G 3VYIA 4O9BA 1IZNB 3H1LJ 4HM0A 1JEKA 2ZT9B 3H1JG 3WUVA 3RL0C 1KQLA 4BXLA 1L0LE 4HM3A 1VPCA 2IYOA 2BCCG 3AE4C 3CX5I 1PPJD 4NBHD 1MV8A 2HMLA 2CPSA 1N8RQ 2CPBA 1SQQK 3A0HH 4EIJA 3MIWA 2E4PA 1FU1A 4TT3H 1BGYG 4C7NB 2HYNA 4TLFA 1O7PA 3QWOC 4WY4D 1KILB 3B5NC 1RY3A 3TGUD 2JDIH 1NTKG 2WVRA 1SQQJ 3D70A 3L71E 4EDFA 1OWAA 4QCKA 2N1TB 3O6QA 2R32A 5KJ7D 1FZCC 2BCCD 1NJIQ 1W2EA 4QURA 1SQPE 1NAFA 1EZVG 4Y99B 1DIPA 5KLVE 3H1HE 2XNXA 2YO3A 1SFCC 3VMAA 3Q3DA 2K9JB 2CK3H 1H88A 3IR9A 1A02J 2KYVA 3OAKA 1M1JC 3GKEA 1O7HA 1SQBG 3CD6P 3WU2E 4N78D 3H1LE 2E74D 4D6TG 3H1KG 4QMAA 2KNCB 4OGQB 1T8ZA 2KI7B 1T6AA 3M0AA 2E75D 4ASVA 1HGZA 2HODA 4L75A 2JP3A 2LXCB 3A3YB 2E76B 2YIUB 1EZVD 1GDTA 3AEAC 2QE7H 3SFEC 1BSNA 2JWAA 2Y0DA 3GTSA 1JCDA 3VMZA 1SS1A 5AW6B 2HMNA 3HD7A 3E1IA 1ZP0C 4GODA 4OWFA 4HM2A 2WTYA 3M9BA 1VQMP 1GW4A 4NBAD 4H44B 2HLOA 3DQYA 1RIEA 2ZYDA 2B1XA 1CI6A 4RO0A 4AAYB 4IL6E 4NB9D 4R4MA 1G1IA 1FJPA 3ABVC 2H43A 3BVHA 1CW5A 1NTMD 3L70J 1MKMA 3ITKA 4H0LB 3L75E 1R5LA 1QGKB 1USDA 1XTGB 5H2FH 2IX7C 3GB4A 1OMIA 4P1CH 3EN1A 1E79H 5CCHD 3GL2A 1S1CX 2ZT9C 2E42A 2Q6QA 2NUKA 1KQFB 4UB8H 1PP9J 3MZWB 2O1KA 1OFCX 3AE3C 4Z1MH 3KXDA 1FDMA 4JPZB 1ULIA 3AE1C 3E7KA 3H1JJ 1J2JB 4WB4A 2ZYGA 4Y28J 1M1KQ 3FOUA 3Q1MA 3JC22 1N7SD 3KZIE 2C0WA 2YKOA 2O01J 2BCCJ 2RN0A 3ZDMA 5TISH 1AVYA 2IZ1A 3VMID 2IPPA 3PJSK 2YMKA 1URQB 5GTIH 1VQ7P 2KLUA 1HWTC 3AEBC 1Z56A 1UIXA 2ZFCA 1DEEG 2PP6A 3AEEC 1BGYJ 1ZR4A 1EZVI 3BATA 1S2EA 3RBZA 4HM5A 1NVOA 4W7ZA 2DE5D 1P84H 4BRYB 1RF1A 1NTKJ 2RMZA 1EDLA 3AECC 1BDCA 3LIEA 2YFIA 4YXWH 2BMOA 3L70E 1OZHA 1S9KD 4NBFD 1SQBK 1KC8Q 1K73Q 3P8CE 2HR3A 3HE4B 2E5TA 4LLHA 4L73A 1NOHA 4PD4H 1IFNA 4RKUJ 1DEBA 2M8RA 2K9YA 3P8MC 1KQSO 1VQ6P 4OGQC 2IZ0A 4GOEA 1PP9E 1SQBJ 3M0DA 4R4LA 4EI2A 1NTMK 2M5AA 1LP1A 1LTJB 2DE6D 4D6TJ 2WSFH 3H1KJ 2FXMA 3FWLA 2O3JA 5B66E 2E76C 3H1JE 2Y9YA 2YIUC 1N2DC 1TU3F 1KB9E 1N73A 2KIKA 2DW3A 1FZEA 2BCCE 1KYOE 1MFTA 5AVWB 4DJGA 5AVYB 2I1JA 3BASA 4I1LA 1USEA 2GUVA 1DD4A 2W90A 3KQGA 1FOSF 1YJNP 4H44C 1BGYE 4XE5B 3C1LA 2QEXP 5BVZA 2AEFA 2NPSD 1NTKE 3V4QA 1AA0A 3L71D 1VQ4P 3CCVP 3E1RA 2XDJA 2UWJE 5KJ7C 1IFDA 4H0LC 3I5CA 1O7NA 2QPZA 1SQPD 4PJ0H 1EZVE 3Q2YA 1YJ9P 3O6QB 1X79B 5APUA 1J1EB 2B89A 3RK3B 1YITP 5KLVD 3H1HD 2O01N 3AE6C 3P32A 1SQVG 3GHGA 4ZKUA 2N9YB 1HBWA 2W6BA 2XU6A 4DZOA 1KFNA 1SQBE 3AEFC 4H13B 3H1LD 5CBNA 4D6TE 3H1KE 2OYHA 1BSHA 3GTEA 1SQXG 1FQTA 1FZAA 2WSEJ 2KSJA 5APYA 1AV1A 1HF9A 3CC4P 2E75C 1RHZB 1ZR2A 1D7MA 1VL2A 4C46A 2PAJA 4WY4A 5AVVB 2OGUA 2HODB 2K3RA 2QRXA 1JNMA 3L75G 2POHA 4N3YB 3CXHH 2ZT9D 1SJGA 4UB6H 1WQLA 3FGAD 1VQ9P 2WSCJ 1YHQP 5AVQB 3HD7B 1M7LA 3IFMA 1GL2A 3K5BA 2LR2A 2ZJSE 1BDDA 3F89A 1G2CA 1BE3G 1FC2C 1Q81Q 1KQGB 3VTPC 1EDJA 1RF0A 1CI6B 3EFFK 3M91A 3V2QA 1LWUA 1IFMA 3L75D 3BRVB 1KILD 1NU1G 2OYIA 1YI2P 1GMJA 1LTJC 2N1TD 1OIPA 1W5CE 3I56P 1OW8A 1SQPK 2W27A 2FKWB 2QG4A 1FZBA 1ULJA 1S5LH 1JUNA 4HB1A 5AVSB 3RK3E 2Y9ZA 3MUDA 1W2BO 2AXTE 1L4AA 4W80A 2KSEA 1N7SC 1RH5B 2A45I 1SQPJ 2R5BA 1T2KC 5AW5B 4CPGA 1NYHA 1L0NG 2YVJB 2BASA 1U7JA 4OGQD 1OVRA 4HJLA 1EXJA 4NBDD 1IK7A 2E76D 5KLIB 3T97A 2WQYC 1SQVK 3TSIA 2OQQA 3AE2C 3RK3C 3L70D 4ZKPA 2BMQA 1KZUB 2WT7B 5AW7B 3P8CD 4GOFA 2B88A 1LTIC 1SQXK 2IDBA 4H13C 4H44D 1SQVJ 2OTKE 4A7PA 1RE3A 2Q7CA 2DE7D 1PP9D 3OW2O 2WWWA 4HH2A 3M9HA 4WWIA 4NPDA 3USSA 3H1JD 1MUUA 1SQXJ 3AEDC 1M8OB 2HPCB 1KB9D 4IL6X 4H0LD 1R5SA 2V7QH 2M5AB 1N7LA 1YTZT 1LP1B 1NDOA 1KYOD 3N7NA 3CWBG 1G8KB 2WSSH 2FYNB 4M3LA 5CXMA 1N73B 5CJ4A 4OH8B 4NB8D 4MN4C 3L75J 2BEQD 2CKFA 4W7YA 1BGYD 2W8ZA 3HD7C 5CCGD 2KUBA 4IOIH 1UUVA 4I2LC 3V2PA 1FDOA 3GZXA 1FZFA 1NTKD 2FFDC 3R4YA 2NPSC 1T3JA 2WPSA 1T3UA 3U59A 3EQQA 5KKZB 1URQD 5APVA 1BE3J 3HE5A 1UIIA 3NXSA 1KV4A 3B5NA 2PRRA 1IC2A 3B8EB 3L73G 1SLQA 2GUSA 2JKVA 1SQVE 1U57A 2W6AA 4HKZH 1VDFA 1NU1J 2R3CA 2B9BA 3H32A 3N4XA 3D71A 4IFDK 1SQBD 1BCCG 3MTUE 1Q7YQ 4HM1A 1LT9B 3UIAA 3JCUH 4D6TD 3H1KD 3L72G 1SQXE 1SFCA 2R5DA 1M1JA 3VMXA 2KOGA 1L0NK 2FYUG 1M90Q 2OYHB 3PP5A 2NUMA 4QDFA 2QJYB 3G3ZA 1NKNA 5H2FE 3L73D 5APTA 4HJGH 1VQ5P 3CX5H 1KD1Q 5KTBA 2QJKB 1DD3A 1KB9I 1J1DC 1OVVA 3CMEP 1JB0J 1KILE 3NFQA 2XZRA 1L0NJ 1XTCC 4UB8E 1KYOI 1FAVA 3M9QA 2QJPB 2JO6A 3RBXA 3D89A 2WSFJ 3HUSB 3CCEP 2LKMA 5AEWA 3NMDA 3B4SA 3FXEA 1BE3E 5TISE 1GL2B 1T2KD 1LT1A 2W6JH 4ASWA 1KN7A 1LTTC 2J5UA 3QH9A 1G2CB 4C7RA 5E79H 1NTKK 1NU1E 2ZVNB 2E74B 2B87A 1KILC 5AW4B 2H88C 3AE5C 3II6A 1AQ5A 3GW6A 1Q90C 1K9MQ 1P84E 4JQ0D 2KS1A 3L74G 1FE6A 2N1TC 2M3EA 2HMJA 3KZIH 2OYIB 1HVVA 4I6MC 3H6PA 4QDDA 1ZN5A 1NTZG 2FYNC 2P2UA 5B5EH 3RK3D 4PV1B 4QUQA 3PRJA 4Y99C 1A02F 1VQLP 2YFLA 3CMAP 1Y47A 3CWBJ 4I7ZB 2XRXA 1FOSE 3CC2P 4PD4E 2ZXEB 3CC7P 1Q82Q 1GK4A 2QA4P 2YNYA 4H13D 3AE8C 1L4AB 4JF7A 1YQ3C 3HTKA 3FXDA 1L0NE 2P10A 2RH0A 5BU8B 2AEMA 3EQ2A 2NVFA 2Z5IA 1IFIA 3CCUP 1VM9A 3SWYA 1N86A 1VQNP 1MZ9A 1PL5A 4HKVA 4IFFA 2E4QA 1AQTA 3CCMP 3AE7C 4KJMA 3T97B 1K04A 2E43A 3W68A 1CSBA 1JY2N 2M0BA 1YQ4C 1JMBA 3L73J 4HM7A 2WPRA 1LT9C 3HD7D 4KHXA 1BCCJ 2R44A 2JEEA 5GTHH 2KLVA 2P7JA 3L72J 1QL2A 4EOTA 2D2CB 1VQ8P 1ZLLA 3EWKA 1YYCA 3CCLP 3V6IA 2AEJA 1HGVA 5AVUB 2QIWA 2H7HA 3TNUA 2OTLP 3V2NA 2FYUJ 2IFNA 3CWBE 2HMMA 2G3AA 1DH3A 1RE4C 4WBAA 3I55P 2BEZF 1GU4A 4U7JA 4EMJB 2A06G 3TF5A 1NKZB 4L76A 1O7GA 2L91A 2Y0CA 4ZMDA 3HUSC 2YO2A 5APSA 1ZMEC 3RL0B 5CCGC 5BOKA 3MP7B 3RK2B 2NZ2A 1GL2C 2FYZA 3H1IG 3BCCG 2Y0EA 1URQC 3C9IA 2P58A 1OW6A 4DOJA 2GBWA 1JTHA 2L5GB 1SQQG 3L73E 3CCJP 2Z4EA 1SQVD 3CXHE 2IYPA 2ZAEB 5KAIH 4UB6E 1HUCA 1NTZK 3B5NB 4U3FG 5KJ7A 2VRSA 3CI9A 1BCCE 1JCCA 1RQVA 5AW8B 1HTLC 3V4WA 2NRGA 2RKLA 3KPEA 3L74J 3Q5RA 3L72E 1SQXD 4PV1C 3H32B 4AQRD 1JY2O 3H1ID 1VQKP 1OW7A 2JR8A 1OXZA 2M3BA 1NTZJ 2FYUE 3FX0A 5AVRB 2Q3WA 2QM7A 2C0XA 5KAFH 1SFCB 3MUDC 2ITAA 1M1JB 3BRTB 2IBZG 1K8AQ 4QDFB 1Q90D 1O7WA 1GU5A 2JJLA 1FBMA 5APWA 1JM0A 3A0BH 1PIXA 1S5LE 4K35A 4NPEA 1O7MA 1X8YA 1GZLA 1BE3D 5AW0B 1GTWA 1NH4A 4NPFX 3VP9A 3U1CA 4HM4A 3RL0g 2HFED 2Z5HA 2IBZD 1G8JB 3TK1A 3L35A 1NU1D 2YKPA 2GA1A 5DJUB 3MD0A 2YKQA 1P84D 3L74E 3O8ZA 1VF5B 1QLED 4N6JA 3SSUA 1PPJG 4GT1A 2B87B 5EFWB 5BU5A 3TYYA 1NTZE 2WPVB 2KS1B 3VP8A 1LTJA 1S4XA 1YJWP 4HYTB 3LW5H 2NVGA 1J1EC 5CCHA 1RF1B 3CCQP 1IFPA 1Y9BA 1NHLA 5CHXA 3A0HE 4PD4D 2WSCH 3TDKA 3JSVC 1H89A 3TGUG 1L0ND 1SVFA 4NBCD 5AVXB 3GZYA 3G6EP 3RK2C 5AW3B 1N7SA 3HTKB 2BMRA 1PFIA 1PV3A 5AW9B 5AVTB 4JYBA 1AJYA 3H25A 3H1IJ 1NO4A 3BCCJ 1EC5A 1NYKA 4RJTA 2KK7A 4XFJA 4LGDE 4K3AA 1FZGA 3KHUA 1NWQA 1NAYA 2YXRB 2WPQA 2JO1A 2JZAA 4U3FJ 1CZQA 4XA4A 5HL4A 1EDIA 3IF4A 3GCEA 3W67A 2ZVOB 2IBZI 1LTGC 1GL2D 1R8EA 1JY3N 2O1JA 3S4RA 2PGDA 1NU1K 2NWFA 3CWBD 1P84I 1KFMA 3CPWO 1WT6A 2XSHA 1X9VA 2QM8A 3AEGC 2A06E 1KMIZ 3GF3A 3TNUB 1E5WA 3WU2H 4QDCA 2J58A 1FZCA 2ZYAA 2A45H 3JCUE 1QX8A 2W83C 1OVUA 2ZXXA 2G8YA 4PD4I 3GHGB 4PV1D 1NTMG 1IO4A 2KZJA 3SWKA 1QVFO 1QVGO 2R3SA 1YBKA 3U1AA 3KDPB 3H1IE 3BCCE 1G1JA 4GKGA 1L4AD 5DJTB 3S9OA 2J59M 4LC1A 2FFDA 1LGHB 3CX5E 3OA7A 1HJBA 1SQQE 1NGMB 2NPSA 3CXHD 3KYQA 3CLQA 4U3FE 1VF5C 4WY4B 1JTHB 1BCCD 1ZRTE 1GK6A 1JY2P 1VCKA 4IL6H 2XKMA 5APXA 5KLIC 1JM1A 3HRNA 2XR8A 2Q3EA 3L72D 4P1BH 2K88A 3Q5PA 1H0TA 2FY8A 1RF1C 4AYCA 1S3JA 3N0QA 4NBGD 3GLMA 2FYUD 2PFXA 2Q1KA 1WRGA 3PH0A 2LXBA 3D6YA 4NBED 1JOCA 5GTIE 5E79E 3GOBA 1FJKA 2IBZE 2FBWC 3IAOA 3TGUJ 4OVNF 3D6ZA 1JY3O 1U7MA 2KZIA 1M57D 2D2CD 1LWUB 1PGOA 1LTBC 3GG2A 3VN0A 5TJHA 1JO5A 2E75B 2GBXA 1JMMA 3M0DC 5B5EE 2K37A 5AW2B 5L8RJ 3CCSP 2YFJA 1ZV8A 3F5HA 2YMYA 4EYYQ 2C9NY 2XNDH 2QVAA 1N73C 3G9RA 1ZXGA 4WVZA 3RL0D 3SFDC 2WT7A 3RGUA 3G71P 3RK2D 2V4HA 3L37A 1Q86Q 3OJAB 3LIDA 1L0LG 3L74D 1Q2NA 3SWFA 3PLNA 4YPCA 3AE9C 1PPJE 4C7NA 5CBOA 5KKZC 3CXHI 1NTZD 4KT0J 2HG5D 4GDOA 3P7KA 1KILA 1S72P 1GD2E 2P67A 3V5BA 2WZ7A 1RQUA 2HPCA 2N1TA 1QL1A 3B5ND 1MFZA 3VMHD 3A7OA 1PGJA 3A2AA 3TGUE 4AIVA 3L71G 4RESB 3C0DA 2SPZA 2HMOA 3GHGC 1PZQA 2I8DA 1L0LD 5B66H 2FYUK 5GTHE 2GM4A 1FDIA 2K9JA 1KB9H 1SQPG 4L74A 1NTMJ 5CJ0A 1PGPA 2O01H 1SFCD 1KYOH 2N9BA 2H8PD 2OYHC 3MGNA 5C39A 1LNQA 5KLVG 3H1HG 1N7SB 2QJYC 4PJ0E 2KNCA 1LJ2A 1OX3A 2I7FA 2C9LY 4DCKA 3H1LG 4N78E 2HMKA 2QJKC 2YXQB 3VMYA 4WY4C 2A45G 2QJPC 1H8AA 2FXOA 1AFOA 3PHLA 1ZOYC 5AEUA 1GW3A 2AXCA 2I1KA 2FXPA 3VCPA 1S5LX 3WMM0 1LT9A 1HH0A 3C8VA 3GF7A 3V2RA 3S1KA 2ZYLA 4HM8A 2KXPB 4B86A 1L2PA 2KP8A 2JWDA 2QSIA 5KAIE 2NVEA 3AZCA 1RF0C 2A06D 3NTNA 4QUPA 2B24A 2E74C 3WUUA 1Y8AA 3A5TA 1KORA 1LWUC 3HE5B 1VF5D 2OARA 1RFSA 1IK9A 1IFJA 1WMKA 3CL3D 1RE4A 2OYIC 5M1BA 3GL0A 4JBZA 5K5GB 2E5YA 1NTME 1FZCB 1EXIA 3IN6A 2WMMA 1X22A 5KAFE 3HUSA 3L36A 4I7ZC 3BCCD 3LW5J 1HJ0A 4ZNCA 3VCAA 1KTMA 4BWNA 5CCGA 4NBBD 3Q5SA 2MJZA 1L0LK 1IJDB 1L4AC 3CX5D 1SQQD 3L4FA 1EDKA 2P1JA 3PTZA 4GIFA 2Q9IA 2IFMA 4U3FD 3WUTA 2FFDB 1ZRTD 3MHVA 1URQA 5AVZB 3A0BE 2NPSB 4YTPC 1SP4A 2KB7P 1L0LJ 3GMAA 5APQA 1VQOP 1UUWA 5AW1B 3FWNA 1LTSC 1PGQA 3CCRP 2WITA 4YXDC 1YTZI 2V7QJ 4BRYA 3R2PA 2MKVA 1DX7A 1X0TA 1M56D 1H0TB 5CCHC 4AUWA 1LTAC 1VQPP 3EFGA 2XSOA 1JY3P 1EG9A 4IFMA 4HM6A 4DT0A 1ZW0A 5KLVK 2XV5A 3L71J 2OYOA 2WSEH 3B71A 3HE4A 2OTJP 3G4SP 2D2CC 3L70G
chains in the Genus database with same CATH topology
2FYNC 3GL0A 4QDCA 3CWBE 1SQBE 5KLVE 2HMMA 3H1HE 1NTME 3VMGD 3GB4A 4QUQA 4P1CH 2D2CD 3EN1A 2YFLA 4D6TE 3H1KE 1PP9E 4EMJB 3GL2A 3GTEA 4H0LD 2XRXA 2NUMA 4QDFB 1FQTA 3GKEA 4QDFA 4NBCD 4PD4E 2NUKA 3GZYA 1ULJA 2DE6D 2GBXA 1NDOA 1G8KB 1O7HA 1O7GA 4PV1D 4H13D 3H1LE 3H1JE 1O7WA 2E74D 2QJYC 2YIUC 3VCAA 5CXMA 2BMRA 4NBBD 1L0NE 1KB9E 2YFJA 4HM0A 1ULIA 2I7FA 3H1IE 4NB8D 2NVFA 2BCCE 2E75D 1KYOE 5BOKA 3BCCE 2CKFA 3FOUA 2JO6A 2HMKA 2QJKC 1O7MA 2YVJB 3D89A 1NYKA 1UUVA 2QJPC 4OGQD 1VM9A 3VMID 1L0LE 4HM3A 3CX5E 4HJLA 1SQQE 3GZXA 5AEWA 1SJGA 2ZT9D 3L75E 1WQLA 4NBHD 1BGYE 2HMLA 5AEUA 4HKVA 4HM4A 2E4QA 3GTSA 4NBDD 1G8JB 4U3FE 2E76D 2GBWA 1UUWA 3EQQA 1BE3E 2HMNA 1ZRTE 3VCPA 3L73E 1VCKA 2JZAA 2E4PA 4HM2A 5KLIC 1JM1A 1PPJE 3CXHE 1NTKE 5HL4A 4HM5A 2XR8A 4NBAD 5KKZC 2DE5D 4P1BH 1O7PA 3GCEA 2BMQA 3DQYA 4HM7A 2ZYLA 4HM8A 3L74E 1BCCE 1RIEA 1NU1E 2B1XA 3N0QA 2XSOA 4NBGD 1SQVE 1EG9A 2YFIA 4AAYB 4HM6A 1O7NA 4NB9D 2QPZA 3L71E 2NVEA 3L72E 2BMOA 3AZCA 4QCKA 4QUPA 1EZVE 3L70E 1Q90C 2B24A 4H44D 1P84E 2NWFA 4NBFD 1NTZE 2HMOA 4NBED 3VMHD 2HMJA 4HM1A 1VF5D 3GOBA 3TGUE 2XSHA 2NVGA 1RFSA 2DE7D 2FYUE 2Q3WA 2IBZE 4QURA 4AIVA 4QDDA 1SQPE 3C0DA 2A06E 1SQXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYN C;  3GL0 A;  4QDC A;  3CWB E;  1SQB E;  5KLV E;  2HMM A;  3H1H E;  1NTM E;  3VMG D;  3GB4 A;  4QUQ A;  4P1C H;  2D2C D;  3EN1 A;  2YFL A;  4D6T E;  3H1K E;  1PP9 E;  4EMJ B;  3GL2 A;  3GTE A;  4H0L D;  2XRX A;  2NUM A;  4QDF B;  1FQT A;  3GKE A;  4QDF A;  4NBC D;  4PD4 E;  2NUK A;  3GZY A;  1ULJ A;  2DE6 D;  2GBX A;  1NDO A;  1G8K B;  1O7H A;  1O7G A;  4PV1 D;  4H13 D;  3H1L E;  3H1J E;  1O7W A;  2E74 D;  2QJY C;  2YIU C;  3VCA A;  5CXM A;  2BMR A;  4NBB D;  1L0N E;  1KB9 E;  2YFJ A;  4HM0 A;  1ULI A;  2I7F A;  3H1I E;  4NB8 D;  2NVF A;  2BCC E;  2E75 D;  1KYO E;  5BOK A;  3BCC E;  2CKF A;  3FOU A;  2JO6 A;  2HMK A;  2QJK C;  1O7M A;  2YVJ B;  3D89 A;  1NYK A;  1UUV A;  2QJP C;  4OGQ D;  1VM9 A;  3VMI D;  1L0L E;  4HM3 A;  3CX5 E;  4HJL A;  1SQQ E;  3GZX A;  5AEW A;  1SJG A;  2ZT9 D;  3L75 E;  1WQL A;  4NBH D;  1BGY E;  2HML A;  5AEU A;  4HKV A;  4HM4 A;  2E4Q A;  3GTS A;  4NBD D;  1G8J B;  4U3F E;  2E76 D;  2GBW A;  1UUW A;  3EQQ A;  1BE3 E;  2HMN A;  1ZRT E;  3VCP A;  3L73 E;  1VCK A;  2JZA A;  2E4P A;  4HM2 A;  5KLI C;  1JM1 A;  1PPJ E;  3CXH E;  1NTK E;  5HL4 A;  4HM5 A;  2XR8 A;  4NBA D;  5KKZ C;  2DE5 D;  4P1B H;  1O7P A;  3GCE A;  2BMQ A;  3DQY A;  4HM7 A;  2ZYL A;  4HM8 A;  3L74 E;  1BCC E;  1RIE A;  1NU1 E;  2B1X A;  3N0Q A;  2XSO A;  4NBG D;  1SQV E;  1EG9 A;  2YFI A;  4AAY B;  4HM6 A;  1O7N A;  4NB9 D;  2QPZ A;  3L71 E;  2NVE A;  3L72 E;  2BMO A;  3AZC A;  4QCK A;  4QUP A;  1EZV E;  3L70 E;  1Q90 C;  2B24 A;  4H44 D;  1P84 E;  2NWF A;  4NBF D;  1NTZ E;  2HMO A;  4NBE D;  3VMH D;  2HMJ A;  4HM1 A;  1VF5 D;  3GOB A;  3TGU E;  2XSH A;  2NVG A;  1RFS A;  2DE7 D;  2FYU E;  2Q3W A;  2IBZ E;  4QUR A;  4AIV A;  4QDD A;  1SQP E;  3C0D A;  2A06 E;  1SQX E; 
#chains in the Genus database with same CATH topology
 1S9K E;  1RE3 C;  2AXT H;  2K1A A;  3VMG D;  2Q3I A;  5CMZ A;  2Q5U A;  1FS0 E;  1EQ7 A;  2H89 C;  1QEX A;  4JYC A;  3M06 A;  5KLV J;  3H1H J;  3VOP A;  1YIJ P;  1AVO A;  1K05 A;  1J1D B;  1PP9 G;  3VYI A;  4O9B A;  1IZN B;  3H1L J;  4HM0 A;  1JEK A;  2ZT9 B;  3H1J G;  3WUV A;  3RL0 C;  1KQL A;  4BXL A;  1L0L E;  4HM3 A;  1VPC A;  2IYO A;  2BCC G;  3AE4 C;  3CX5 I;  1PPJ D;  4NBH D;  1MV8 A;  2HML A;  2CPS A;  1N8R Q;  2CPB A;  1SQQ K;  3A0H H;  4EIJ A;  3MIW A;  2E4P A;  1FU1 A;  4TT3 H;  1BGY G;  4C7N B;  2HYN A;  4TLF A;  1O7P A;  3QWO C;  4WY4 D;  1KIL B;  3B5N C;  1RY3 A;  3TGU D;  2JDI H;  1NTK G;  2WVR A;  1SQQ J;  3D70 A;  3L71 E;  4EDF A;  1OWA A;  4QCK A;  2N1T B;  3O6Q A;  2R32 A;  5KJ7 D;  1FZC C;  2BCC D;  1NJI Q;  1W2E A;  4QUR A;  1SQP E;  1NAF A;  1EZV G;  4Y99 B;  1DIP A;  5KLV E;  3H1H E;  2XNX A;  2YO3 A;  1SFC C;  3VMA A;  3Q3D A;  2K9J B;  2CK3 H;  1H88 A;  3IR9 A;  1A02 J;  2KYV A;  3OAK A;  1M1J C;  3GKE A;  1O7H A;  1SQB G;  3CD6 P;  3WU2 E;  4N78 D;  3H1L E;  2E74 D;  4D6T G;  3H1K G;  4QMA A;  2KNC B;  4OGQ B;  1T8Z A;  2KI7 B;  1T6A A;  3M0A A;  2E75 D;  4ASV A;  1HGZ A;  2HOD A;  4L75 A;  2JP3 A;  2LXC B;  3A3Y B;  2E76 B;  2YIU B;  1EZV D;  1GDT A;  3AEA C;  2QE7 H;  3SFE C;  1BSN A;  2JWA A;  2Y0D A;  3GTS A;  1JCD A;  3VMZ A;  1SS1 A;  5AW6 B;  2HMN A;  3HD7 A;  3E1I A;  1ZP0 C;  4GOD A;  4OWF A;  4HM2 A;  2WTY A;  3M9B A;  1VQM P;  1GW4 A;  4NBA D;  4H44 B;  2HLO A;  3DQY A;  1RIE A;  2ZYD A;  2B1X A;  1CI6 A;  4RO0 A;  4AAY B;  4IL6 E;  4NB9 D;  4R4M A;  1G1I A;  1FJP A;  3ABV C;  2H43 A;  3BVH A;  1CW5 A;  1NTM D;  3L70 J;  1MKM A;  3ITK A;  4H0L B;  3L75 E;  1R5L A;  1QGK B;  1USD A;  1XTG B;  5H2F H;  2IX7 C;  3GB4 A;  1OMI A;  4P1C H;  3EN1 A;  1E79 H;  5CCH D;  3GL2 A;  1S1C X;  2ZT9 C;  2E42 A;  2Q6Q A;  2NUK A;  1KQF B;  4UB8 H;  1PP9 J;  3MZW B;  2O1K A;  1OFC X;  3AE3 C;  4Z1M H;  3KXD A;  1FDM A;  4JPZ B;  1ULI A;  3AE1 C;  3E7K A;  3H1J J;  1J2J B;  4WB4 A;  2ZYG A;  4Y28 J;  1M1K Q;  3FOU A;  3Q1M A;  3JC2 2;  1N7S D;  3KZI E;  2C0W A;  2YKO A;  2O01 J;  2BCC J;  2RN0 A;  3ZDM A;  5TIS H;  1AVY A;  2IZ1 A;  3VMI D;  2IPP A;  3PJS K;  2YMK A;  1URQ B;  5GTI H;  1VQ7 P;  2KLU A;  1HWT C;  3AEB C;  1Z56 A;  1UIX A;  2ZFC A;  1DEE G;  2PP6 A;  3AEE C;  1BGY J;  1ZR4 A;  1EZV I;  3BAT A;  1S2E A;  3RBZ A;  4HM5 A;  1NVO A;  4W7Z A;  2DE5 D;  1P84 H;  4BRY B;  1RF1 A;  1NTK J;  2RMZ A;  1EDL A;  3AEC C;  1BDC A;  3LIE A;  2YFI A;  4YXW H;  2BMO A;  3L70 E;  1OZH A;  1S9K D;  4NBF D;  1SQB K;  1KC8 Q;  1K73 Q;  3P8C E;  2HR3 A;  3HE4 B;  2E5T A;  4LLH A;  4L73 A;  1NOH A;  4PD4 H;  1IFN A;  4RKU J;  1DEB A;  2M8R A;  2K9Y A;  3P8M C;  1KQS O;  1VQ6 P;  4OGQ C;  2IZ0 A;  4GOE A;  1PP9 E;  1SQB J;  3M0D A;  4R4L A;  4EI2 A;  1NTM K;  2M5A A;  1LP1 A;  1LTJ B;  2DE6 D;  4D6T J;  2WSF H;  3H1K J;  2FXM A;  3FWL A;  2O3J A;  5B66 E;  2E76 C;  3H1J E;  2Y9Y A;  2YIU C;  1N2D C;  1TU3 F;  1KB9 E;  1N73 A;  2KIK A;  2DW3 A;  1FZE A;  2BCC E;  1KYO E;  1MFT A;  5AVW B;  4DJG A;  5AVY B;  2I1J A;  3BAS A;  4I1L A;  1USE A;  2GUV A;  1DD4 A;  2W90 A;  3KQG A;  1FOS F;  1YJN P;  4H44 C;  1BGY E;  4XE5 B;  3C1L A;  2QEX P;  5BVZ A;  2AEF A;  2NPS D;  1NTK E;  3V4Q A;  1AA0 A;  3L71 D;  1VQ4 P;  3CCV P;  3E1R A;  2XDJ A;  2UWJ E;  5KJ7 C;  1IFD A;  4H0L C;  3I5C A;  1O7N A;  2QPZ A;  1SQP D;  4PJ0 H;  1EZV E;  3Q2Y A;  1YJ9 P;  3O6Q B;  1X79 B;  5APU A;  1J1E B;  2B89 A;  3RK3 B;  1YIT P;  5KLV D;  3H1H D;  2O01 N;  3AE6 C;  3P32 A;  1SQV G;  3GHG A;  4ZKU A;  2N9Y B;  1HBW A;  2W6B A;  2XU6 A;  4DZO A;  1KFN A;  1SQB E;  3AEF C;  4H13 B;  3H1L D;  5CBN A;  4D6T E;  3H1K E;  2OYH A;  1BSH A;  3GTE A;  1SQX G;  1FQT A;  1FZA A;  2WSE J;  2KSJ A;  5APY A;  1AV1 A;  1HF9 A;  3CC4 P;  2E75 C;  1RHZ B;  1ZR2 A;  1D7M A;  1VL2 A;  4C46 A;  2PAJ A;  4WY4 A;  5AVV B;  2OGU A;  2HOD B;  2K3R A;  2QRX A;  1JNM A;  3L75 G;  2POH A;  4N3Y B;  3CXH H;  2ZT9 D;  1SJG A;  4UB6 H;  1WQL A;  3FGA D;  1VQ9 P;  2WSC J;  1YHQ P;  5AVQ B;  3HD7 B;  1M7L A;  3IFM A;  1GL2 A;  3K5B A;  2LR2 A;  2ZJS E;  1BDD A;  3F89 A;  1G2C A;  1BE3 G;  1FC2 C;  1Q81 Q;  1KQG B;  3VTP C;  1EDJ A;  1RF0 A;  1CI6 B;  3EFF K;  3M91 A;  3V2Q A;  1LWU A;  1IFM A;  3L75 D;  3BRV B;  1KIL D;  1NU1 G;  2OYI A;  1YI2 P;  1GMJ A;  1LTJ C;  2N1T D;  1OIP A;  1W5C E;  3I56 P;  1OW8 A;  1SQP K;  2W27 A;  2FKW B;  2QG4 A;  1FZB A;  1ULJ A;  1S5L H;  1JUN A;  4HB1 A;  5AVS B;  3RK3 E;  2Y9Z A;  3MUD A;  1W2B O;  2AXT E;  1L4A A;  4W80 A;  2KSE A;  1N7S C;  1RH5 B;  2A45 I;  1SQP J;  2R5B A;  1T2K C;  5AW5 B;  4CPG A;  1NYH A;  1L0N G;  2YVJ B;  2BAS A;  1U7J A;  4OGQ D;  1OVR A;  4HJL A;  1EXJ A;  4NBD D;  1IK7 A;  2E76 D;  5KLI B;  3T97 A;  2WQY C;  1SQV K;  3TSI A;  2OQQ A;  3AE2 C;  3RK3 C;  3L70 D;  4ZKP A;  2BMQ A;  1KZU B;  2WT7 B;  5AW7 B;  3P8C D;  4GOF A;  2B88 A;  1LTI C;  1SQX K;  2IDB A;  4H13 C;  4H44 D;  1SQV J;  2OTK E;  4A7P A;  1RE3 A;  2Q7C A;  2DE7 D;  1PP9 D;  3OW2 O;  2WWW A;  4HH2 A;  3M9H A;  4WWI A;  4NPD A;  3USS A;  3H1J D;  1MUU A;  1SQX J;  3AED C;  1M8O B;  2HPC B;  1KB9 D;  4IL6 X;  4H0L D;  1R5S A;  2V7Q H;  2M5A B;  1N7L A;  1YTZ T;  1LP1 B;  1NDO A;  1KYO D;  3N7N A;  3CWB G;  1G8K B;  2WSS H;  2FYN B;  4M3L A;  5CXM A;  1N73 B;  5CJ4 A;  4OH8 B;  4NB8 D;  4MN4 C;  3L75 J;  2BEQ D;  2CKF A;  4W7Y A;  1BGY D;  2W8Z A;  3HD7 C;  5CCG D;  2KUB A;  4IOI H;  1UUV A;  4I2L C;  3V2P A;  1FDO A;  3GZX A;  1FZF A;  1NTK D;  2FFD C;  3R4Y A;  2NPS C;  1T3J A;  2WPS A;  1T3U A;  3U59 A;  3EQQ A;  5KKZ B;  1URQ D;  5APV A;  1BE3 J;  3HE5 A;  1UII A;  3NXS A;  1KV4 A;  3B5N A;  2PRR A;  1IC2 A;  3B8E B;  3L73 G;  1SLQ A;  2GUS A;  2JKV A;  1SQV E;  1U57 A;  2W6A A;  4HKZ H;  1VDF A;  1NU1 J;  2R3C A;  2B9B A;  3H32 A;  3N4X A;  3D71 A;  4IFD K;  1SQB D;  1BCC G;  3MTU E;  1Q7Y Q;  4HM1 A;  1LT9 B;  3UIA A;  3JCU H;  4D6T D;  3H1K D;  3L72 G;  1SQX E;  1SFC A;  2R5D A;  1M1J A;  3VMX A;  2KOG A;  1L0N K;  2FYU G;  1M90 Q;  2OYH B;  3PP5 A;  2NUM A;  4QDF A;  2QJY B;  3G3Z A;  1NKN A;  5H2F E;  3L73 D;  5APT A;  4HJG H;  1VQ5 P;  3CX5 H;  1KD1 Q;  5KTB A;  2QJK B;  1DD3 A;  1KB9 I;  1J1D C;  1OVV A;  3CME P;  1JB0 J;  1KIL E;  3NFQ A;  2XZR A;  1L0N J;  1XTC C;  4UB8 E;  1KYO I;  1FAV A;  3M9Q A;  2QJP B;  2JO6 A;  3RBX A;  3D89 A;  2WSF J;  3HUS B;  3CCE P;  2LKM A;  5AEW A;  3NMD A;  3B4S A;  3FXE A;  1BE3 E;  5TIS E;  1GL2 B;  1T2K D;  1LT1 A;  2W6J H;  4ASW A;  1KN7 A;  1LTT C;  2J5U A;  3QH9 A;  1G2C B;  4C7R A;  5E79 H;  1NTK K;  1NU1 E;  2ZVN B;  2E74 B;  2B87 A;  1KIL C;  5AW4 B;  2H88 C;  3AE5 C;  3II6 A;  1AQ5 A;  3GW6 A;  1Q90 C;  1K9M Q;  1P84 E;  4JQ0 D;  2KS1 A;  3L74 G;  1FE6 A;  2N1T C;  2M3E A;  2HMJ A;  3KZI H;  2OYI B;  1HVV A;  4I6M C;  3H6P A;  4QDD A;  1ZN5 A;  1NTZ G;  2FYN C;  2P2U A;  5B5E H;  3RK3 D;  4PV1 B;  4QUQ A;  3PRJ A;  4Y99 C;  1A02 F;  1VQL P;  2YFL A;  3CMA P;  1Y47 A;  3CWB J;  4I7Z B;  2XRX A;  1FOS E;  3CC2 P;  4PD4 E;  2ZXE B;  3CC7 P;  1Q82 Q;  1GK4 A;  2QA4 P;  2YNY A;  4H13 D;  3AE8 C;  1L4A B;  4JF7 A;  1YQ3 C;  3HTK A;  3FXD A;  1L0N E;  2P10 A;  2RH0 A;  5BU8 B;  2AEM A;  3EQ2 A;  2NVF A;  2Z5I A;  1IFI A;  3CCU P;  1VM9 A;  3SWY A;  1N86 A;  1VQN P;  1MZ9 A;  1PL5 A;  4HKV A;  4IFF A;  2E4Q A;  1AQT A;  3CCM P;  3AE7 C;  4KJM A;  3T97 B;  1K04 A;  2E43 A;  3W68 A;  1CSB A;  1JY2 N;  2M0B A;  1YQ4 C;  1JMB A;  3L73 J;  4HM7 A;  2WPR A;  1LT9 C;  3HD7 D;  4KHX A;  1BCC J;  2R44 A;  2JEE A;  5GTH H;  2KLV A;  2P7J A;  3L72 J;  1QL2 A;  4EOT A;  2D2C B;  1VQ8 P;  1ZLL A;  3EWK A;  1YYC A;  3CCL P;  3V6I A;  2AEJ A;  1HGV A;  5AVU B;  2QIW A;  2H7H A;  3TNU A;  2OTL P;  3V2N A;  2FYU J;  2IFN A;  3CWB E;  2HMM A;  2G3A A;  1DH3 A;  1RE4 C;  4WBA A;  3I55 P;  2BEZ F;  1GU4 A;  4U7J A;  4EMJ B;  2A06 G;  3TF5 A;  1NKZ B;  4L76 A;  1O7G A;  2L91 A;  2Y0C A;  4ZMD A;  3HUS C;  2YO2 A;  5APS A;  1ZME C;  3RL0 B;  5CCG C;  5BOK A;  3MP7 B;  3RK2 B;  2NZ2 A;  1GL2 C;  2FYZ A;  3H1I G;  3BCC G;  2Y0E A;  1URQ C;  3C9I A;  2P58 A;  1OW6 A;  4DOJ A;  2GBW A;  1JTH A;  2L5G B;  1SQQ G;  3L73 E;  3CCJ P;  2Z4E A;  1SQV D;  3CXH E;  2IYP A;  2ZAE B;  5KAI H;  4UB6 E;  1HUC A;  1NTZ K;  3B5N B;  4U3F G;  5KJ7 A;  2VRS A;  3CI9 A;  1BCC E;  1JCC A;  1RQV A;  5AW8 B;  1HTL C;  3V4W A;  2NRG A;  2RKL A;  3KPE A;  3L74 J;  3Q5R A;  3L72 E;  1SQX D;  4PV1 C;  3H32 B;  4AQR D;  1JY2 O;  3H1I D;  1VQK P;  1OW7 A;  2JR8 A;  1OXZ A;  2M3B A;  1NTZ J;  2FYU E;  3FX0 A;  5AVR B;  2Q3W A;  2QM7 A;  2C0X A;  5KAF H;  1SFC B;  3MUD C;  2ITA A;  1M1J B;  3BRT B;  2IBZ G;  1K8A Q;  4QDF B;  1Q90 D;  1O7W A;  1GU5 A;  2JJL A;  1FBM A;  5APW A;  1JM0 A;  3A0B H;  1PIX A;  1S5L E;  4K35 A;  4NPE A;  1O7M A;  1X8Y A;  1GZL A;  1BE3 D;  5AW0 B;  1GTW A;  1NH4 A;  4NPF X;  3VP9 A;  3U1C A;  4HM4 A;  3RL0 g;  2HFE D;  2Z5H A;  2IBZ D;  1G8J B;  3TK1 A;  3L35 A;  1NU1 D;  2YKP A;  2GA1 A;  5DJU B;  3MD0 A;  2YKQ A;  1P84 D;  3L74 E;  3O8Z A;  1VF5 B;  1QLE D;  4N6J A;  3SSU A;  1PPJ G;  4GT1 A;  2B87 B;  5EFW B;  5BU5 A;  3TYY A;  1NTZ E;  2WPV B;  2KS1 B;  3VP8 A;  1LTJ A;  1S4X A;  1YJW P;  4HYT B;  3LW5 H;  2NVG A;  1J1E C;  5CCH A;  1RF1 B;  3CCQ P;  1IFP A;  1Y9B A;  1NHL A;  5CHX A;  3A0H E;  4PD4 D;  2WSC H;  3TDK A;  3JSV C;  1H89 A;  3TGU G;  1L0N D;  1SVF A;  4NBC D;  5AVX B;  3GZY A;  3G6E P;  3RK2 C;  5AW3 B;  1N7S A;  3HTK B;  2BMR A;  1PFI A;  1PV3 A;  5AW9 B;  5AVT B;  4JYB A;  1AJY A;  3H25 A;  3H1I J;  1NO4 A;  3BCC J;  1EC5 A;  1NYK A;  4RJT A;  2KK7 A;  4XFJ A;  4LGD E;  4K3A A;  1FZG A;  3KHU A;  1NWQ A;  1NAY A;  2YXR B;  2WPQ A;  2JO1 A;  2JZA A;  4U3F J;  1CZQ A;  4XA4 A;  5HL4 A;  1EDI A;  3IF4 A;  3GCE A;  3W67 A;  2ZVO B;  2IBZ I;  1LTG C;  1GL2 D;  1R8E A;  1JY3 N;  2O1J A;  3S4R A;  2PGD A;  1NU1 K;  2NWF A;  3CWB D;  1P84 I;  1KFM A;  3CPW O;  1WT6 A;  2XSH A;  1X9V A;  2QM8 A;  3AEG C;  2A06 E;  1KMI Z;  3GF3 A;  3TNU B;  1E5W A;  3WU2 H;  4QDC A;  2J58 A;  1FZC A;  2ZYA A;  2A45 H;  3JCU E;  1QX8 A;  2W83 C;  1OVU A;  2ZXX A;  2G8Y A;  4PD4 I;  3GHG B;  4PV1 D;  1NTM G;  1IO4 A;  2KZJ A;  3SWK A;  1QVF O;  1QVG O;  2R3S A;  1YBK A;  3U1A A;  3KDP B;  3H1I E;  3BCC E;  1G1J A;  4GKG A;  1L4A D;  5DJT B;  3S9O A;  2J59 M;  4LC1 A;  2FFD A;  1LGH B;  3CX5 E;  3OA7 A;  1HJB A;  1SQQ E;  1NGM B;  2NPS A;  3CXH D;  3KYQ A;  3CLQ A;  4U3F E;  1VF5 C;  4WY4 B;  1JTH B;  1BCC D;  1ZRT E;  1GK6 A;  1JY2 P;  1VCK A;  4IL6 H;  2XKM A;  5APX A;  5KLI C;  1JM1 A;  3HRN A;  2XR8 A;  2Q3E A;  3L72 D;  4P1B H;  2K88 A;  3Q5P A;  1H0T A;  2FY8 A;  1RF1 C;  4AYC A;  1S3J A;  3N0Q A;  4NBG D;  3GLM A;  2FYU D;  2PFX A;  2Q1K A;  1WRG A;  3PH0 A;  2LXB A;  3D6Y A;  4NBE D;  1JOC A;  5GTI E;  5E79 E;  3GOB A;  1FJK A;  2IBZ E;  2FBW C;  3IAO A;  3TGU J;  4OVN F;  3D6Z A;  1JY3 O;  1U7M A;  2KZI A;  1M57 D;  2D2C D;  1LWU B;  1PGO A;  1LTB C;  3GG2 A;  3VN0 A;  5TJH A;  1JO5 A;  2E75 B;  2GBX A;  1JMM A;  3M0D C;  5B5E E;  2K37 A;  5AW2 B;  5L8R J;  3CCS P;  2YFJ A;  1ZV8 A;  3F5H A;  2YMY A;  4EYY Q;  2C9N Y;  2XND H;  2QVA A;  1N73 C;  3G9R A;  1ZXG A;  4WVZ A;  3RL0 D;  3SFD C;  2WT7 A;  3RGU A;  3G71 P;  3RK2 D;  2V4H A;  3L37 A;  1Q86 Q;  3OJA B;  3LID A;  1L0L G;  3L74 D;  1Q2N A;  3SWF A;  3PLN A;  4YPC A;  3AE9 C;  1PPJ E;  4C7N A;  5CBO A;  5KKZ C;  3CXH I;  1NTZ D;  4KT0 J;  2HG5 D;  4GDO A;  3P7K A;  1KIL A;  1S72 P;  1GD2 E;  2P67 A;  3V5B A;  2WZ7 A;  1RQU A;  2HPC A;  2N1T A;  1QL1 A;  3B5N D;  1MFZ A;  3VMH D;  3A7O A;  1PGJ A;  3A2A A;  3TGU E;  4AIV A;  3L71 G;  4RES B;  3C0D A;  2SPZ A;  2HMO A;  3GHG C;  1PZQ A;  2I8D A;  1L0L D;  5B66 H;  2FYU K;  5GTH E;  2GM4 A;  1FDI A;  2K9J A;  1KB9 H;  1SQP G;  4L74 A;  1NTM J;  5CJ0 A;  1PGP A;  2O01 H;  1SFC D;  1KYO H;  2N9B A;  2H8P D;  2OYH C;  3MGN A;  5C39 A;  1LNQ A;  5KLV G;  3H1H G;  1N7S B;  2QJY C;  4PJ0 E;  2KNC A;  1LJ2 A;  1OX3 A;  2I7F A;  2C9L Y;  4DCK A;  3H1L G;  4N78 E;  2HMK A;  2QJK C;  2YXQ B;  3VMY A;  4WY4 C;  2A45 G;  2QJP C;  1H8A A;  2FXO A;  1AFO A;  3PHL A;  1ZOY C;  5AEU A;  1GW3 A;  2AXC A;  2I1K A;  2FXP A;  3VCP A;  1S5L X;  3WMM 0;  1LT9 A;  1HH0 A;  3C8V A;  3GF7 A;  3V2R A;  3S1K A;  2ZYL A;  4HM8 A;  2KXP B;  4B86 A;  1L2P A;  2KP8 A;  2JWD A;  2QSI A;  5KAI E;  2NVE A;  3AZC A;  1RF0 C;  2A06 D;  3NTN A;  4QUP A;  2B24 A;  2E74 C;  3WUU A;  1Y8A A;  3A5T A;  1KOR A;  1LWU C;  3HE5 B;  1VF5 D;  2OAR A;  1RFS A;  1IK9 A;  1IFJ A;  1WMK A;  3CL3 D;  1RE4 A;  2OYI C;  5M1B A;  3GL0 A;  4JBZ A;  5K5G B;  2E5Y A;  1NTM E;  1FZC B;  1EXI A;  3IN6 A;  2WMM A;  1X22 A;  5KAF E;  3HUS A;  3L36 A;  4I7Z C;  3BCC D;  3LW5 J;  1HJ0 A;  4ZNC A;  3VCA A;  1KTM A;  4BWN A;  5CCG A;  4NBB D;  3Q5S A;  2MJZ A;  1L0L K;  1IJD B;  1L4A C;  3CX5 D;  1SQQ D;  3L4F A;  1EDK A;  2P1J A;  3PTZ A;  4GIF A;  2Q9I A;  2IFM A;  4U3F D;  3WUT A;  2FFD B;  1ZRT D;  3MHV A;  1URQ A;  5AVZ B;  3A0B E;  2NPS B;  4YTP C;  1SP4 A;  2KB7 P;  1L0L J;  3GMA A;  5APQ A;  1VQO P;  1UUW A;  5AW1 B;  3FWN A;  1LTS C;  1PGQ A;  3CCR P;  2WIT A;  4YXD C;  1YTZ I;  2V7Q J;  4BRY A;  3R2P A;  2MKV A;  1DX7 A;  1X0T A;  1M56 D;  1H0T B;  5CCH C;  4AUW A;  1LTA C;  1VQP P;  3EFG A;  2XSO A;  1JY3 P;  1EG9 A;  4IFM A;  4HM6 A;  4DT0 A;  1ZW0 A;  5KLV K;  2XV5 A;  3L71 J;  2OYO A;  2WSE H;  3B71 A;  3HE4 A;  2OTJ P;  3G4S P;  2D2C C;  3L70 G; 
#chains in the Genus database with same CATH homology
 2FYN C;  3GL0 A;  4QDC A;  3CWB E;  1SQB E;  5KLV E;  2HMM A;  3H1H E;  1NTM E;  3VMG D;  3GB4 A;  4QUQ A;  4P1C H;  2D2C D;  3EN1 A;  2YFL A;  4D6T E;  3H1K E;  1PP9 E;  4EMJ B;  3GL2 A;  3GTE A;  4H0L D;  2XRX A;  2NUM A;  4QDF B;  1FQT A;  3GKE A;  4QDF A;  4NBC D;  4PD4 E;  2NUK A;  3GZY A;  1ULJ A;  2DE6 D;  2GBX A;  1NDO A;  1G8K B;  1O7H A;  1O7G A;  4PV1 D;  4H13 D;  3H1L E;  3H1J E;  1O7W A;  2E74 D;  2QJY C;  2YIU C;  3VCA A;  5CXM A;  2BMR A;  4NBB D;  1L0N E;  1KB9 E;  2YFJ A;  4HM0 A;  1ULI A;  2I7F A;  3H1I E;  4NB8 D;  2NVF A;  2BCC E;  2E75 D;  1KYO E;  5BOK A;  3BCC E;  2CKF A;  3FOU A;  2JO6 A;  2HMK A;  2QJK C;  1O7M A;  2YVJ B;  3D89 A;  1NYK A;  1UUV A;  2QJP C;  4OGQ D;  1VM9 A;  3VMI D;  1L0L E;  4HM3 A;  3CX5 E;  4HJL A;  1SQQ E;  3GZX A;  5AEW A;  1SJG A;  2ZT9 D;  3L75 E;  1WQL A;  4NBH D;  1BGY E;  2HML A;  5AEU A;  4HKV A;  4HM4 A;  2E4Q A;  3GTS A;  4NBD D;  1G8J B;  4U3F E;  2E76 D;  2GBW A;  1UUW A;  3EQQ A;  1BE3 E;  2HMN A;  1ZRT E;  3VCP A;  3L73 E;  1VCK A;  2JZA A;  2E4P A;  4HM2 A;  5KLI C;  1JM1 A;  1PPJ E;  3CXH E;  1NTK E;  5HL4 A;  4HM5 A;  2XR8 A;  4NBA D;  5KKZ C;  2DE5 D;  4P1B H;  1O7P A;  3GCE A;  2BMQ A;  3DQY A;  4HM7 A;  2ZYL A;  4HM8 A;  3L74 E;  1BCC E;  1RIE A;  1NU1 E;  2B1X A;  3N0Q A;  2XSO A;  4NBG D;  1SQV E;  1EG9 A;  2YFI A;  4AAY B;  4HM6 A;  1O7N A;  4NB9 D;  2QPZ A;  3L71 E;  2NVE A;  3L72 E;  2BMO A;  3AZC A;  4QCK A;  4QUP A;  1EZV E;  3L70 E;  1Q90 C;  2B24 A;  4H44 D;  1P84 E;  2NWF A;  4NBF D;  1NTZ E;  2HMO A;  4NBE D;  3VMH D;  2HMJ A;  4HM1 A;  1VF5 D;  3GOB A;  3TGU E;  2XSH A;  2NVG A;  1RFS A;  2DE7 D;  2FYU E;  2Q3W A;  2IBZ E;  4QUR A;  4AIV A;  4QDD A;  1SQP E;  3C0D A;  2A06 E;  1SQX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...