3H1JE

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 46
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1jE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1jE02
1NTZE 4NBHD 2CKFA 4NBFD 3VMID 2YFIA 3EQQA 4NB9D 1O7NA 2QPZA 2BMOA 2QJPC 1WQLA 2HMLA 3D89A 3GZXA 4AAYB 4EMJB 1KYOE 3VMHD 1UUWA 1SQBE 2D2CD 2GBXA 3L75E 2BMRA 2QJYC 2ZYLA 4NBGD 1NTME 1JM1A 1SJGA 2ZT9D 1PP9E 3L70E 2Q3WA 2YFJA 1G8KB 4QDFB 1KB9E 1PPJE 3DQYA 2BCCE 1O7PA 1VM9A 3VCPA 2HMOA 4P1CH 3CWBE 1SQXE 1BGYE 2IBZE 1O7GA 4NBBD 4HM3A 3BCCE 4U3FE 4HM1A 1ZRTE 2NVFA 3CXHE 2DE7D 4HKVA 2E4PA 3VMGD 2B24A 4HM4A 2B1XA 2DE6D 3H1HE 3L73E 1BE3E 1NYKA 3GB4A 4H13D 2BMQA 3GOBA 5AEUA 3L74E 3C0DA 4QDCA 2NUKA 4HM2A 3H1IE 1NU1E 3AZCA 4PD4E 1L0NE 1ULIA 3EN1A 2HMMA 4NBDD 5HL4A 4QURA 1O7MA 2DE5D 4QDDA 2XR8A 4PV1D 4HM6A 1EZVE 2E76D 1NDOA 1UUVA 4NBAD 2HMKA 3H1KE 2NWFA 1SQQE 1O7HA 4QUPA 3GL0A 1FQTA 5CXMA 2A06E 4H44D 4HM7A 3GZYA 2E4QA 1NTKE 2JZAA 4P1BH 2NUMA 2I7FA 3L71E 1L0LE 3GKEA 4NB8D 2XSHA 3GTEA 1BCCE 3CX5E 1O7WA 4HM0A 1Q90C 5KKZC 4NBED 4D6TE 3FOUA 4H0LD 4QDFA 1SQVE 3GTSA 3TGUE 5KLIC 3H1LE 2E74D 1VF5D 2JO6A 3GCEA 4QUQA 3GL2A 1SQPE 2QJKC 3N0QA 3VCAA 2YFLA 2NVGA 2YIUC 1P84E 2YVJB 1VCKA 4NBCD 4QCKA 1G8JB 1ULJA 2HMNA 4OGQD 5AEWA 2FYNC 2NVEA 2XSOA 4HJLA 2HMJA 4AIVA 2FYUE 3H1JE 5KLVE 2XRXA 3L72E 2GBWA 4HM8A 1RFSA 5BOKA 4HM5A 2E75D 1RIEA 1EG9A
chains in the Genus database with same CATH superfamily
3IFMA 1SP4A 4KJMA 5GTHE 3VOPA 1NKZB 1BSNA 4JPZB 3Q5PA 2R3SA 2W6BA 1ZMEC 4I2LC 1OW8A 1KYOE 3GF3A 1OZHA 3BCCG 3RK2C 2NPSD 2C0WA 2PRRA 3H1LJ 1J1EC 2ZYLA 3GMAA 3VMYA 4WB4A 3H1KG 3CWBE 4JQ0D 3H1JJ 2O1JA 2R3CA 3S4RA 1LT9B 3D71A 1HVVA 1KN7A 3AE7C 1H0TB 2AXTE 1MFZA 3HE4A 2QJPB 1JO5A 3V5BA 1NTMK 2WVRA 1NDOA 1J1DB 1SQBJ 5AVRB 1PIXA 2QE7H 3RK3E 2H8PD 1KC8Q 4HJGH 4IL6H 3RL0B 3L70D 5CBOA 1FBMA 2I7FA 3GKEA 1CSBA 4D6TE 2ZAEB 5AVUB 2R5BA 1T2KD 1SQPE 4GOFA 3M06A 3H1HD 1S1CX 2WQYC 3A0BE 1AV1A 2XSOA 2KLVA 1L0NK 2WTYA 3CX5H 3H1ID 3V2PA 2ZYDA 4EI2A 2QG4A 2YXRB 1J1DC 3C1LA 4GOEA 4IL6E 1KILC 1L0ND 3HTKB 2RH0A 3L37A 3A3YB 1EDJA 1PGPA 3F89A 3C8VA 1N7LA 2B87B 1PV3A 2ZYGA 3S9OA 3L70E 3VN0A 3TK1A 2JO1A 1DEEG 1KB9D 1O7PA 1BGYD 3N7NA 5AVWB 2LXBA 4H13C 1JUNA 1ZN5A 3CXHD 3G6EP 1NTZG 3CD6P 2JWDA 1Y8AA 4OH8B 1IFIA 2KOGA 5AW2B 3A5TA 1NYKA 3M9HA 3GB4A 5BU5A 1X79B 3KQGA 3GW6A 3CCLP 1QLED 4JYCA 2NUKA 1VF5C 3H25A 2R32A 1JMBA 3AE1C 3AE2C 2MKVA 1EZVE 1NTMJ 4K35A 1G1JA 5E79H 2YO2A 1O7HA 4AYCA 4EOTA 1D7MA 3L74G 4IFFA 3KYQA 1IJDB 1MUUA 1PP9D 2W83C 5CCHA 1IFNA 1SQVE 2P58A 3MD0A 5K5GB 2KSEA 2KZIA 2M0BA 3W67A 2YIUC 5GTHH 2FYUD 2ZFCA 1Y9BA 1IFDA 2JKVA 3CC4P 5AVZB 2E75D 3HD7A 2KIKA 3C9IA 3L36A 4NBFD 2QPZA 1BGYJ 3AE5C 3A7OA 3RK2D 2QJYC 3P8MC 3L72G 2H88C 5KAFH 1JY2O 1T6AA 2KXPB 2PP6A 2QJKB 1L0LG 1VM9A 4L76A 1BCCJ 2K3RA 3VMAA 4BXLA 1URQB 1M8OB 3BCCE 4HM1A 3CCUP 4QMAA 3OJAB 2NZ2A 1PL5A 2BMQA 5KJ7A 3JCUH 2JWAA 3P7KA 5CJ0A 1SFCD 4RESB 3RBXA 4PD4E 5AVQB 1EDLA 3L71J 5AW6B 1ZXGA 1FAVA 2IYOA 1L0NG 1JMMA 4PV1B 5APYA 2AEFA 2KSJA 3GL0A 2CPBA 5KTBA 1FS0E 3IN6A 5CCHD 3NMDA 3RBZA 1BE3J 4H0LD 1FDIA 2B88A 1W5CE 1QX8A 1NH4A 4BRYB 3A0BH 1ZRTD 5AW0B 2C0XA 3H1JG 1ZP0C 2O1KA 3OAKA 5AEWA 4ZKUA 2FYNC 5AVVB 1GD2E 1BE3D 2HPCA 4HM8A 2YKPA 2WT7B 2A45H 3H1HG 3RGUA 3G71P 3Q5RA 1SVFA 3H1IG 3EFFK 1YQ4C 3EQQA 5E79E 1NTZK 4Y99C 4U3FG 1KILE 4PV1C 3FXDA 1OW7A 2OTJP 1GL2D 1T3JA 3VMXA 5L8RJ 3K5BA 3VMGD 1HF9A 3MIWA 2J58A 4W80A 3GLMA 1YJNP 3CWBJ 1OVRA 1RF1B 5HL4A 5KAIE 3P32A 3E1RA 2BEQD 3WUUA 1S3JA 3L73J 3RK3D 1YQ3C 1RQVA 1NAYA 4JBZA 4R4LA 1KILD 4H44B 1L0LE 4TT3H 2FXOA 4H0LB 1R8EA 1NTKK 5AW1B 3U1CA 3GTSA 1T3UA 2J5UA 1M90Q 4L75A 1FZAA 4HB1A 1P84E 1G8JB 1T8ZA 4HJLA 2RN0A 2FYUG 1OIPA 3L71G 1SQPJ 1SQQG 1NTZD 1YITP 1FZCC 2BMOA 1IFPA 4N78E 3CXHH 4EMJB 3VMHD 1HGZA 4H0LC 3LIEA 2IZ1A 1N73C 2ZXEB 3U59A 1K9MQ 2LKMA 3CX5D 1GTWA 2J59M 4WBAA 1IK7A 3L74J 5GTIH 1YJ9P 3H1HE 2C9LY 5KLVD 1KILA 1SFCA 1VQMP 2BCCG 1S72P 1K05A 4HM2A 3TYYA 2M5AA 3H1IE 2O01J 1OMIA 3BVHA 1ZV8A 4PV1D 5B5EH 3B5NA 3FXEA 3V2RA 2FY8A 3F5HA 1SQVJ 1U7JA 2A06E 3MZWB 3CI9A 2JZAA 2AXCA 2Q3IA 3RK3C 2M5AB 1FZEA 3L71E 1HBWA 2YMYA 2W8ZA 2OYIA 1Q90C 1SQVD 4O9BA 5APUA 2AEMA 1OXZA 1YI2P 1OX3A 1GW4A 1LT9A 1VCKA 1NHLA 3AEEC 2WPVB 4OGQD 1S5LE 4JF7A 3H1JD 2IX7C 1SQXG 1EG9A 2WZ7A 2VRSA 2K9JB 1H89A 1KTMA 4C7NB 3R2PA 2GUSA 3O8ZA 1DD3A 1NGMB 3D89A 2PAJA 5KKZB 3L75E 3BRTB 3WU2H 3U1AA 1GL2A 1ZR4A 1LTJC 1LTSC 4Y28J 3WMM0 1FE6A 2YKQA 3VCPA 2KB7P 3I56P 4WY4A 4ZKPA 3N4XA 4U3FE 2C9NY 1VL2A 1Q86Q 1RH5B 3CCRP 1A02J 2WMMA 1H8AA 3OW2O 1JEKA 1H88A 3AZCA 1L0NE 1G2CB 4QURA 3AEGC 1PPJG 3CC7P 3HUSA 3BASA 5CCHC 3NXSA 1VQ4P 4LC1A 2NUMA 5AW9B 2ZT9C 3FX0A 2ZVOB 3PP5A 5AW4B 2QJYB 3FWLA 1KQGB 2KNCA 1CW5A 2IDBA 4WWIA 1NTKJ 2Y0EA 4MN4C 3BCCD 2QJKC 2YFLA 1L4AD 3T97A 2HMNA 2KZJA 2WSCH 1GK6A 1FZCA 1JCDA 3V4WA 2N9BA 3CCEP 4HM5A 3HD7D 1LP1A 4C7RA 5CMZA 1KMIZ 2E5YA 2Z5HA 4NB9D 4YXDC 2QJPC 1EC5A 5APVA 4AAYB 2ZT9B 1SQQD 3M9BA 3SSUA 4RO0A 1FJPA 3I55P 4XE5B 2BASA 1NTME 1JY2N 1DX7A 1VQ8P 1NJIQ 3KZIH 1PP9G 3RL0C 4M3LA 1BGYE 4H44C 1TU3F 1ZRTE 5B5EE 2QM8A 3V2NA 2B1XA 3HUSC 1PGOA 1WT6A 1YTZT 2YXQB 1KV4A 4YXWH 1KQSO 3A0HE 5KLVG 2HMMA 2IPPA 2DE5D 1N86A 4PJ0H 2FYUJ 3SFEC 4D6TG 2HMKA 1N2DC 5CXMA 1SQBD 1EZVI 4HM7A 3II6A 4P1BH 1IFMA 4EYYQ 1NAFA 1KYOH 5AW8B 2H7HA 1P84I 1SQQJ 3TGUD 3GCEA 1QL1A 2HLOA 3M0AA 3VCAA 4L74A 4UB8E 2P2UA 3IR9A 1VQ9P 1RF1C 2M3EA 2K88A 1E5WA 1MV8A 3L70J 4N6JA 2HFED 1AJYA 1QVGO 1PGJA 1HJBA 1VQ5P 1A02F 4N78D 1JTHB 1SQBE 1NO4A 4XFJA 3CLQA 4NBGD 1DIPA 3CMAP 4QDFB 2WSCJ 2Q7CA 2FXMA 2BEZF 2IBZD 4HKVA 1EZVG 1URQD 3ZDMA 2KLUA 1HWTC 3G3ZA 1AVOA 1SS1A 3GOBA 3EFGA 2OYIB 1T2KC 3D70A 3C0DA 1W2BO 4HH2A 2QRXA 2V4HA 2N1TB 3D6ZA 3CCMP 2A06G 1N73B 1SQBK 3SWKA 4LGDE 3H1KE 2NWFA 5AVYB 3Q2YA 5B66H 1VQNP 3KPEA 5H2FH 4CPGA 3SWYA 1O7WA 1DEBA 1PFIA 3FOUA 4OGQC 2IFMA 1LTTC 3GF7A 1N73A 2ZVNB 1SQQK 3QH9A 3PTZA 2POHA 3I5CA 2PGDA 3PRJA 1H0TA 3H1JE 1Q7YQ 1MZ9A 3IAOA 1PP9J 1M1JB 3AE4C 1CI6A 4D6TJ 1W2EA 1VQKP 1VQOP 4KT0J 2CKFA 3VMID 1S9KE 1HJ0A 1O7NA 2DW3A 3RK3B 2N1TC 1VQPP 5APSA 2OYHC 2SPZA 2K37A 2BMRA 3VP8A 1JB0J 2B87A 1SJGA 1KYOI 2KI7B 1L2PA 1YTZI 1PPJD 2YIUB 1VQ7P 1K8AQ 3VP9A 3HE5B 1DH3A 1AFOA 1LJ2A 4PJ0E 4HM4A 5KLIB 2Q9IA 4NPFX 3AEDC 1EQ7A 1YJWP 1NTKG 3D6YA 1LTAC 3EN1A 1JM0A 1J2JB 3L70G 1KORA 2XV5A 3JSVC 1BDCA 4ZNCA 1GL2C 4NBAD 3PHLA 2IBZI 2E42A 1L0NJ 2E43A 1AA0A 1EXJA 3E7KA 4NB8D 4Y99B 3HRNA 2OYHB 1GU4A 3USSA 4NBED 3H32B 1HTLC 4RJTA 4HKZH 1NYHA 4ASVA 4U3FD 3L73D 3VTPC 4QCKA 4AIVA 2HMJA 1KQLA 2O01H 5KLVJ 4N3YB 2OYOA 1XTCC 1VQ6P 2W90A 1KFNA 4WY4C 1WQLA 2L91A 1USDA 3PLNA 3L71D 1PP9E 2OARA 5KLVK 1Z56A 1FOSE 1G8KB 5BVZA 2Q3EA 3P8CD 3S1KA 1JY3O 4EDFA 1GW3A 1O7GA 4OWFA 1URQA 1SQBG 3KXDA 2JP3A 2H89C 4YPCA 1L4AB 1AQ5A 4GT1A 1L0LK 3M9QA 5KAFE 1ULIA 5BU8B 2WT7A 4WY4B 2IZ0A 2NPSC 1YBKA 1KZUB 1WMKA 4HM6A 2K9JA 1UUVA 1J1EB 3AECC 5TISE 2ZJSE 2Z5IA 2JEEA 2WSFJ 2E74C 4B86A 1VPCA 2XDJA 2WSEH 3HUSB 3JC22 3H1LD 1CZQA 3CPWO 1JY3P 3GL2A 2NVGA 2YVJB 2NVEA 1EXIA 2KS1A 2GBWA 2E5TA 3TGUJ 5BOKA 2L5GB 1RHZB 1RE3A 1VQLP 3PH0A 1LTBC 1NTZE 4NBHD 2KK7A 3CX5I 4UB6E 5AVSB 3MUDA 3CMEP 1S9KD 3BRVB 1IC2A 1UUWA 1RF0C 2I1JA 3E1IA 2ZT9D 3M91A 1LWUC 3GHGC 4R4MA 3DQYA 1S2EA 2BCCE 3MHVA 5EFWB 1RY3A 3B5ND 2WITA 2DE7D 4OGQB 2B24A 2KUBA 1BE3E 1SQVG 2HODA 2YNYA 1DD4A 2OTLP 2LXCB 4TLFA 1RF1A 1QL2A 2HG5D 1KD1Q 1KILB 1SQQE 4QUPA 1FQTA 2BCCJ 2KS1B 1NTKE 5CCGA 1CI6B 1X9VA 1LTGC 4IFMA 2XU6A 3GTEA 2R44A 5H2FE 2E74D 2WSSH 3KHUA 1FZBA 1G1IA 3CXHI 4NBCD 2W6JH 1SQPD 3VYIA 2QM7A 2HYNA 3L73G 2UWJE 2WPSA 2N1TD 3CCSP 1YHQP 1BCCG 2MJZA 2W27A 1BE3G 2Q1KA 1JOCA 1SQXJ 3H1KD 2M8RA 1ZLLA 5CBNA 1LT1A 2GA1A 2OQQA 1NTMD 4DOJA 2FKWB 2KP8A 1MFTA 2YKOA 1S4XA 2ZYAA 2Q6QA 3TGUG 2NVFA 1SQXK 3CXHE 3CCJP 3H1LG 1FZFA 3AE9C 1GDTA 1LNQA 2QEXP 3R4YA 5AEUA 1QGKB 1VDFA 4IL6X 1NU1E 3WU2E 4ZMDA 3TNUB 4W7YA 2WSEJ 2V7QJ 3CCQP 2E76D 3CL3D 2ZXXA 3H1HJ 4C7NA 3LIDA 1YYCA 4H44D 1LTJB 4U7JA 1JCCA 4K3AA 1Y47A 2FFDC 4I1LA 4NPDA 3MP7B 4HYTB 1BCCE 2FYUK 3CX5E 1GK4A 4D6TD 1QEXA 5KKZC 2G8YA 4GODA 3H1KJ 5CHXA 3H6PA 2WSFH 4Z1MH 3WUTA 1K04A 3L75J 5AVXB 1JTHA 1Q82Q 2FBWC 1SLQA 3N0QA 2IBZG 4A7PA 3L4FA 2YO3A 1LTIC 3HE4B 3AEFC 3MUDC 1R5SA 2E76C 1HGVA 1PGQA 1OW6A 2A45I 3TF5A 1G2CA 2YFIA 4U3FJ 2Y0CA 1BGYG 2A06D 1AVYA 2GUVA 1GZLA 5KJ7D 4PD4I 4KHXA 4LLHA 4RKUJ 4BWNA 3SFDC 2Q3WA 2YFJA 1Q2NA 4L73A 1L0LJ 2BCCD 1SQXE 1SQPK 2PFXA 1OVVA 1Q90D 3ITKA 2IFNA 2I8DA 4AQRD 3AE6C 2Z4EA 1JY3N 2OGUA 2DE6D 3L73E 5AVTB 3LW5J 1N8RQ 1KB9H 4QDCA 5CJ4A 1M1JA 2FYNB 1O7MA 1EZVD 3V4QA 1R5LA 1LP1B 1N7SA 1UIXA 1LGHB 3L75D 2XNDH 3GZYA 1RE4A 2RMZA 1URQC 1NVOA 3MTUE 1NTMG 2B89A 3O6QB 3TGUE 1L4AC 1IK9A 3H1LE 4GDOA 1ULJA 2JR8A 1NU1G 1NU1J 1FU1A 2O01N 1LT9C 3CCVP 3SWFA 2W6AA 2YMKA 4AUWA 1RE3C 3L72J 4I7ZB 1RIEA 2QIWA 4ASWA 1NOHA 3L72D 1IO4A 1WRGA 2Q5UA 3HE5A 3QWOC 2OYIC 1U7MA 3Q1MA 3GZXA 1X8YA 1OVUA 5M1BA 1RF0A 2QVAA 2GBXA 5APQA 3RL0g 1OFCX 2AXTH 1NTZJ 3AEAC 3A0HH 2R5DA 2OYHA 3NFQA 2IBZE 2V7QH 3CWBD 4HM3A 1M56D 2XZRA 5APXA 1FDOA 1RE4C 5GTIE 4DZOA 1JNMA 1XTGB 1SFCB 4I7ZC 3WUVA 2NRGA 1KQFB 3LW5H 1N7SC 5DJTB 2P67A 3CC2P 3B8EB 5KJ7C 1E79H 4NPEA 1M1KQ 1M1JC 4DJGA 3Q5SA 3HD7C 1ZW0A 4WY4D 3AEBC 5AW5B 1L4AA 5APWA 1LWUB 3GHGB 1EDIA 3M0DC 2E4QA 1NWQA 2FYZA 2N1TA 3TDKA 1U57A 1L0LD 2P10A 1BCCD 1UIIA 4UB8H 4DCKA 5APTA 4QUQA 3OA7A 1HH0A 1N7SB 5C39A 1OWAA 1VF5B 4H13B 3NTNA 4WVZA 1FOSF 2WPQA 1KB9I 1USEA 2XRXA 2M3BA 5TJHA 1RFSA 3HD7B 3B4SA 1SFCC 3HTKA 5AW3B 4PD4D 4W7ZA 4DT0A 1PZQA 3TNUA 1ZR2A 2B9BA 1RQUA 2QSIA 1IFJA 1M7LA 2WPRA 2D2CD 1GL2B 1NTKD 2WWWA 2P1JA 3FWNA 1FC2C 2O3JA 4GKGA 4PD4H 4C46A 1FDMA 1PPJE 4JYBA 2HMOA 1AQTA 4P1CH 3GG2A 1BDDA 1LTJA 3B5NB 5KAIH 2Y9ZA 1X0TA 2A45G 4H13D 2NPSA 3UIAA 3KZIE 1NU1D 1MKMA 2Y0DA 2I1KA 3V6IA 1FZCB 1X22A 1QVFO 4NBDD 2Y9YA 2XR8A 2HODB 3BATA 2E76B 3TSIA 1GU5A 3L35A 1FZGA 2G3AA 4UB6H 4GIFA 1SQVK 3Q3DA 3PJSK 5CCGD 2XSHA 3W68A 4HM0A 4BRYA 3A2AA 4IOIH 3B5NC 2OTKE 5KLIC 1VF5D 2JO6A 2KYVA 1N7SD 2QA4P 2FXPA 3CWBG 3T97B 5B66E 2HPCB 2FYUE 3G9RA 3L74D 4XA4A 2AEJA 2JJLA 4OVNF 3H32A 3B71A 3IF4A 2CPSA 5TISH 3BCCJ 2FFDB 2JDIH 3MGNA 2HMLA 3AE8C 2NPSB 5CCGC 1NKNA 2D2CB 1JM1A 3JCUE 1KB9E 3P8CE 2XKMA 3V2QA 2FFDA 4NBBD 2E75C 2E74B 1FJKA 4I6MC 3L75G 4EIJA 2E4PA 3EWKA 1S5LX 2CK3H 1P84D 1SQPG 2H43A 1KFMA 1YIJP 3L74E 1BSHA 3H1IJ 3EQ2A 2N9YB 3VMZA 4IFDK 4QDDA 2IYPA 2D2CC 1ZOYC 1Q81Q 3FGAD 1HUCA 1IZNB 2HR3A 1K73Q 2KNCB 1KYOD 1P84H 3RL0D 3ABVC 3AE3C 4YTPC 1GMJA 3KDPB 2RKLA 3RK2B 1NU1K 3G4SP 1S5LH 4QDFA 3M0DA 1EDKA 2K9YA 3O6QA 1SQXD 1LWUA 3GHGA 2P7JA 2XNXA 2K1AA 5DJUB 2GM4A 5AW7B 2ITAA 2LR2A 2E75B 1M57D 5KLVE 3L72E 1JY2P
chains in the Genus database with same CATH topology
1NTZE 4NBHD 2CKFA 4NBFD 3VMID 2YFIA 3EQQA 4NB9D 1O7NA 2QPZA 2BMOA 2QJPC 1WQLA 2HMLA 3D89A 3GZXA 4AAYB 4EMJB 1KYOE 3VMHD 1UUWA 1SQBE 2D2CD 2GBXA 3L75E 2BMRA 2QJYC 2ZYLA 4NBGD 1NTME 1JM1A 1SJGA 2ZT9D 1PP9E 3L70E 2Q3WA 2YFJA 1G8KB 4QDFB 1KB9E 1PPJE 3DQYA 2BCCE 1O7PA 1VM9A 3VCPA 2HMOA 4P1CH 3CWBE 1SQXE 1BGYE 2IBZE 1O7GA 4NBBD 4HM3A 3BCCE 4U3FE 4HM1A 1ZRTE 2NVFA 3CXHE 2DE7D 4HKVA 2E4PA 3VMGD 2B24A 4HM4A 2B1XA 2DE6D 3H1HE 3L73E 1BE3E 1NYKA 3GB4A 4H13D 2BMQA 3GOBA 5AEUA 3L74E 3C0DA 4QDCA 2NUKA 4HM2A 3H1IE 1NU1E 3AZCA 4PD4E 1L0NE 1ULIA 3EN1A 2HMMA 4NBDD 5HL4A 4QURA 1O7MA 2DE5D 4QDDA 2XR8A 4PV1D 4HM6A 1EZVE 2E76D 1NDOA 1UUVA 4NBAD 2HMKA 3H1KE 2NWFA 1SQQE 1O7HA 4QUPA 3GL0A 1FQTA 5CXMA 2A06E 4H44D 4HM7A 3GZYA 2E4QA 1NTKE 2JZAA 4P1BH 2NUMA 2I7FA 3L71E 1L0LE 3GKEA 4NB8D 2XSHA 3GTEA 1BCCE 3CX5E 1O7WA 4HM0A 1Q90C 5KKZC 4NBED 4D6TE 3FOUA 4H0LD 4QDFA 1SQVE 3GTSA 3TGUE 5KLIC 3H1LE 2E74D 1VF5D 2JO6A 3GCEA 4QUQA 3GL2A 1SQPE 2QJKC 3N0QA 3VCAA 2YFLA 2NVGA 2YIUC 1P84E 2YVJB 1VCKA 4NBCD 4QCKA 1G8JB 1ULJA 2HMNA 4OGQD 5AEWA 2FYNC 2NVEA 2XSOA 4HJLA 2HMJA 4AIVA 2FYUE 3H1JE 5KLVE 2XRXA 3L72E 2GBWA 4HM8A 1RFSA 5BOKA 4HM5A 2E75D 1RIEA 1EG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ E;  4NBH D;  2CKF A;  4NBF D;  3VMI D;  2YFI A;  3EQQ A;  4NB9 D;  1O7N A;  2QPZ A;  2BMO A;  2QJP C;  1WQL A;  2HML A;  3D89 A;  3GZX A;  4AAY B;  4EMJ B;  1KYO E;  3VMH D;  1UUW A;  1SQB E;  2D2C D;  2GBX A;  3L75 E;  2BMR A;  2QJY C;  2ZYL A;  4NBG D;  1NTM E;  1JM1 A;  1SJG A;  2ZT9 D;  1PP9 E;  3L70 E;  2Q3W A;  2YFJ A;  1G8K B;  4QDF B;  1KB9 E;  1PPJ E;  3DQY A;  2BCC E;  1O7P A;  1VM9 A;  3VCP A;  2HMO A;  4P1C H;  3CWB E;  1SQX E;  1BGY E;  2IBZ E;  1O7G A;  4NBB D;  4HM3 A;  3BCC E;  4U3F E;  4HM1 A;  1ZRT E;  2NVF A;  3CXH E;  2DE7 D;  4HKV A;  2E4P A;  3VMG D;  2B24 A;  4HM4 A;  2B1X A;  2DE6 D;  3H1H E;  3L73 E;  1BE3 E;  1NYK A;  3GB4 A;  4H13 D;  2BMQ A;  3GOB A;  5AEU A;  3L74 E;  3C0D A;  4QDC A;  2NUK A;  4HM2 A;  3H1I E;  1NU1 E;  3AZC A;  4PD4 E;  1L0N E;  1ULI A;  3EN1 A;  2HMM A;  4NBD D;  5HL4 A;  4QUR A;  1O7M A;  2DE5 D;  4QDD A;  2XR8 A;  4PV1 D;  4HM6 A;  1EZV E;  2E76 D;  1NDO A;  1UUV A;  4NBA D;  2HMK A;  3H1K E;  2NWF A;  1SQQ E;  1O7H A;  4QUP A;  3GL0 A;  1FQT A;  5CXM A;  2A06 E;  4H44 D;  4HM7 A;  3GZY A;  2E4Q A;  1NTK E;  2JZA A;  4P1B H;  2NUM A;  2I7F A;  3L71 E;  1L0L E;  3GKE A;  4NB8 D;  2XSH A;  3GTE A;  1BCC E;  3CX5 E;  1O7W A;  4HM0 A;  1Q90 C;  5KKZ C;  4NBE D;  4D6T E;  3FOU A;  4H0L D;  4QDF A;  1SQV E;  3GTS A;  3TGU E;  5KLI C;  3H1L E;  2E74 D;  1VF5 D;  2JO6 A;  3GCE A;  4QUQ A;  3GL2 A;  1SQP E;  2QJK C;  3N0Q A;  3VCA A;  2YFL A;  2NVG A;  2YIU C;  1P84 E;  2YVJ B;  1VCK A;  4NBC D;  4QCK A;  1G8J B;  1ULJ A;  2HMN A;  4OGQ D;  5AEW A;  2FYN C;  2NVE A;  2XSO A;  4HJL A;  2HMJ A;  4AIV A;  2FYU E;  3H1J E;  5KLV E;  2XRX A;  3L72 E;  2GBW A;  4HM8 A;  1RFS A;  5BOK A;  4HM5 A;  2E75 D;  1RIE A;  1EG9 A; 
#chains in the Genus database with same CATH topology
 3IFM A;  1SP4 A;  4KJM A;  5GTH E;  3VOP A;  1NKZ B;  1BSN A;  4JPZ B;  3Q5P A;  2R3S A;  2W6B A;  1ZME C;  4I2L C;  1OW8 A;  1KYO E;  3GF3 A;  1OZH A;  3BCC G;  3RK2 C;  2NPS D;  2C0W A;  2PRR A;  3H1L J;  1J1E C;  2ZYL A;  3GMA A;  3VMY A;  4WB4 A;  3H1K G;  3CWB E;  4JQ0 D;  3H1J J;  2O1J A;  2R3C A;  3S4R A;  1LT9 B;  3D71 A;  1HVV A;  1KN7 A;  3AE7 C;  1H0T B;  2AXT E;  1MFZ A;  3HE4 A;  2QJP B;  1JO5 A;  3V5B A;  1NTM K;  2WVR A;  1NDO A;  1J1D B;  1SQB J;  5AVR B;  1PIX A;  2QE7 H;  3RK3 E;  2H8P D;  1KC8 Q;  4HJG H;  4IL6 H;  3RL0 B;  3L70 D;  5CBO A;  1FBM A;  2I7F A;  3GKE A;  1CSB A;  4D6T E;  2ZAE B;  5AVU B;  2R5B A;  1T2K D;  1SQP E;  4GOF A;  3M06 A;  3H1H D;  1S1C X;  2WQY C;  3A0B E;  1AV1 A;  2XSO A;  2KLV A;  1L0N K;  2WTY A;  3CX5 H;  3H1I D;  3V2P A;  2ZYD A;  4EI2 A;  2QG4 A;  2YXR B;  1J1D C;  3C1L A;  4GOE A;  4IL6 E;  1KIL C;  1L0N D;  3HTK B;  2RH0 A;  3L37 A;  3A3Y B;  1EDJ A;  1PGP A;  3F89 A;  3C8V A;  1N7L A;  2B87 B;  1PV3 A;  2ZYG A;  3S9O A;  3L70 E;  3VN0 A;  3TK1 A;  2JO1 A;  1DEE G;  1KB9 D;  1O7P A;  1BGY D;  3N7N A;  5AVW B;  2LXB A;  4H13 C;  1JUN A;  1ZN5 A;  3CXH D;  3G6E P;  1NTZ G;  3CD6 P;  2JWD A;  1Y8A A;  4OH8 B;  1IFI A;  2KOG A;  5AW2 B;  3A5T A;  1NYK A;  3M9H A;  3GB4 A;  5BU5 A;  1X79 B;  3KQG A;  3GW6 A;  3CCL P;  1QLE D;  4JYC A;  2NUK A;  1VF5 C;  3H25 A;  2R32 A;  1JMB A;  3AE1 C;  3AE2 C;  2MKV A;  1EZV E;  1NTM J;  4K35 A;  1G1J A;  5E79 H;  2YO2 A;  1O7H A;  4AYC A;  4EOT A;  1D7M A;  3L74 G;  4IFF A;  3KYQ A;  1IJD B;  1MUU A;  1PP9 D;  2W83 C;  5CCH A;  1IFN A;  1SQV E;  2P58 A;  3MD0 A;  5K5G B;  2KSE A;  2KZI A;  2M0B A;  3W67 A;  2YIU C;  5GTH H;  2FYU D;  2ZFC A;  1Y9B A;  1IFD A;  2JKV A;  3CC4 P;  5AVZ B;  2E75 D;  3HD7 A;  2KIK A;  3C9I A;  3L36 A;  4NBF D;  2QPZ A;  1BGY J;  3AE5 C;  3A7O A;  3RK2 D;  2QJY C;  3P8M C;  3L72 G;  2H88 C;  5KAF H;  1JY2 O;  1T6A A;  2KXP B;  2PP6 A;  2QJK B;  1L0L G;  1VM9 A;  4L76 A;  1BCC J;  2K3R A;  3VMA A;  4BXL A;  1URQ B;  1M8O B;  3BCC E;  4HM1 A;  3CCU P;  4QMA A;  3OJA B;  2NZ2 A;  1PL5 A;  2BMQ A;  5KJ7 A;  3JCU H;  2JWA A;  3P7K A;  5CJ0 A;  1SFC D;  4RES B;  3RBX A;  4PD4 E;  5AVQ B;  1EDL A;  3L71 J;  5AW6 B;  1ZXG A;  1FAV A;  2IYO A;  1L0N G;  1JMM A;  4PV1 B;  5APY A;  2AEF A;  2KSJ A;  3GL0 A;  2CPB A;  5KTB A;  1FS0 E;  3IN6 A;  5CCH D;  3NMD A;  3RBZ A;  1BE3 J;  4H0L D;  1FDI A;  2B88 A;  1W5C E;  1QX8 A;  1NH4 A;  4BRY B;  3A0B H;  1ZRT D;  5AW0 B;  2C0X A;  3H1J G;  1ZP0 C;  2O1K A;  3OAK A;  5AEW A;  4ZKU A;  2FYN C;  5AVV B;  1GD2 E;  1BE3 D;  2HPC A;  4HM8 A;  2YKP A;  2WT7 B;  2A45 H;  3H1H G;  3RGU A;  3G71 P;  3Q5R A;  1SVF A;  3H1I G;  3EFF K;  1YQ4 C;  3EQQ A;  5E79 E;  1NTZ K;  4Y99 C;  4U3F G;  1KIL E;  4PV1 C;  3FXD A;  1OW7 A;  2OTJ P;  1GL2 D;  1T3J A;  3VMX A;  5L8R J;  3K5B A;  3VMG D;  1HF9 A;  3MIW A;  2J58 A;  4W80 A;  3GLM A;  1YJN P;  3CWB J;  1OVR A;  1RF1 B;  5HL4 A;  5KAI E;  3P32 A;  3E1R A;  2BEQ D;  3WUU A;  1S3J A;  3L73 J;  3RK3 D;  1YQ3 C;  1RQV A;  1NAY A;  4JBZ A;  4R4L A;  1KIL D;  4H44 B;  1L0L E;  4TT3 H;  2FXO A;  4H0L B;  1R8E A;  1NTK K;  5AW1 B;  3U1C A;  3GTS A;  1T3U A;  2J5U A;  1M90 Q;  4L75 A;  1FZA A;  4HB1 A;  1P84 E;  1G8J B;  1T8Z A;  4HJL A;  2RN0 A;  2FYU G;  1OIP A;  3L71 G;  1SQP J;  1SQQ G;  1NTZ D;  1YIT P;  1FZC C;  2BMO A;  1IFP A;  4N78 E;  3CXH H;  4EMJ B;  3VMH D;  1HGZ A;  4H0L C;  3LIE A;  2IZ1 A;  1N73 C;  2ZXE B;  3U59 A;  1K9M Q;  2LKM A;  3CX5 D;  1GTW A;  2J59 M;  4WBA A;  1IK7 A;  3L74 J;  5GTI H;  1YJ9 P;  3H1H E;  2C9L Y;  5KLV D;  1KIL A;  1SFC A;  1VQM P;  2BCC G;  1S72 P;  1K05 A;  4HM2 A;  3TYY A;  2M5A A;  3H1I E;  2O01 J;  1OMI A;  3BVH A;  1ZV8 A;  4PV1 D;  5B5E H;  3B5N A;  3FXE A;  3V2R A;  2FY8 A;  3F5H A;  1SQV J;  1U7J A;  2A06 E;  3MZW B;  3CI9 A;  2JZA A;  2AXC A;  2Q3I A;  3RK3 C;  2M5A B;  1FZE A;  3L71 E;  1HBW A;  2YMY A;  2W8Z A;  2OYI A;  1Q90 C;  1SQV D;  4O9B A;  5APU A;  2AEM A;  1OXZ A;  1YI2 P;  1OX3 A;  1GW4 A;  1LT9 A;  1VCK A;  1NHL A;  3AEE C;  2WPV B;  4OGQ D;  1S5L E;  4JF7 A;  3H1J D;  2IX7 C;  1SQX G;  1EG9 A;  2WZ7 A;  2VRS A;  2K9J B;  1H89 A;  1KTM A;  4C7N B;  3R2P A;  2GUS A;  3O8Z A;  1DD3 A;  1NGM B;  3D89 A;  2PAJ A;  5KKZ B;  3L75 E;  3BRT B;  3WU2 H;  3U1A A;  1GL2 A;  1ZR4 A;  1LTJ C;  1LTS C;  4Y28 J;  3WMM 0;  1FE6 A;  2YKQ A;  3VCP A;  2KB7 P;  3I56 P;  4WY4 A;  4ZKP A;  3N4X A;  4U3F E;  2C9N Y;  1VL2 A;  1Q86 Q;  1RH5 B;  3CCR P;  1A02 J;  2WMM A;  1H8A A;  3OW2 O;  1JEK A;  1H88 A;  3AZC A;  1L0N E;  1G2C B;  4QUR A;  3AEG C;  1PPJ G;  3CC7 P;  3HUS A;  3BAS A;  5CCH C;  3NXS A;  1VQ4 P;  4LC1 A;  2NUM A;  5AW9 B;  2ZT9 C;  3FX0 A;  2ZVO B;  3PP5 A;  5AW4 B;  2QJY B;  3FWL A;  1KQG B;  2KNC A;  1CW5 A;  2IDB A;  4WWI A;  1NTK J;  2Y0E A;  4MN4 C;  3BCC D;  2QJK C;  2YFL A;  1L4A D;  3T97 A;  2HMN A;  2KZJ A;  2WSC H;  1GK6 A;  1FZC A;  1JCD A;  3V4W A;  2N9B A;  3CCE P;  4HM5 A;  3HD7 D;  1LP1 A;  4C7R A;  5CMZ A;  1KMI Z;  2E5Y A;  2Z5H A;  4NB9 D;  4YXD C;  2QJP C;  1EC5 A;  5APV A;  4AAY B;  2ZT9 B;  1SQQ D;  3M9B A;  3SSU A;  4RO0 A;  1FJP A;  3I55 P;  4XE5 B;  2BAS A;  1NTM E;  1JY2 N;  1DX7 A;  1VQ8 P;  1NJI Q;  3KZI H;  1PP9 G;  3RL0 C;  4M3L A;  1BGY E;  4H44 C;  1TU3 F;  1ZRT E;  5B5E E;  2QM8 A;  3V2N A;  2B1X A;  3HUS C;  1PGO A;  1WT6 A;  1YTZ T;  2YXQ B;  1KV4 A;  4YXW H;  1KQS O;  3A0H E;  5KLV G;  2HMM A;  2IPP A;  2DE5 D;  1N86 A;  4PJ0 H;  2FYU J;  3SFE C;  4D6T G;  2HMK A;  1N2D C;  5CXM A;  1SQB D;  1EZV I;  4HM7 A;  3II6 A;  4P1B H;  1IFM A;  4EYY Q;  1NAF A;  1KYO H;  5AW8 B;  2H7H A;  1P84 I;  1SQQ J;  3TGU D;  3GCE A;  1QL1 A;  2HLO A;  3M0A A;  3VCA A;  4L74 A;  4UB8 E;  2P2U A;  3IR9 A;  1VQ9 P;  1RF1 C;  2M3E A;  2K88 A;  1E5W A;  1MV8 A;  3L70 J;  4N6J A;  2HFE D;  1AJY A;  1QVG O;  1PGJ A;  1HJB A;  1VQ5 P;  1A02 F;  4N78 D;  1JTH B;  1SQB E;  1NO4 A;  4XFJ A;  3CLQ A;  4NBG D;  1DIP A;  3CMA P;  4QDF B;  2WSC J;  2Q7C A;  2FXM A;  2BEZ F;  2IBZ D;  4HKV A;  1EZV G;  1URQ D;  3ZDM A;  2KLU A;  1HWT C;  3G3Z A;  1AVO A;  1SS1 A;  3GOB A;  3EFG A;  2OYI B;  1T2K C;  3D70 A;  3C0D A;  1W2B O;  4HH2 A;  2QRX A;  2V4H A;  2N1T B;  3D6Z A;  3CCM P;  2A06 G;  1N73 B;  1SQB K;  3SWK A;  4LGD E;  3H1K E;  2NWF A;  5AVY B;  3Q2Y A;  5B66 H;  1VQN P;  3KPE A;  5H2F H;  4CPG A;  3SWY A;  1O7W A;  1DEB A;  1PFI A;  3FOU A;  4OGQ C;  2IFM A;  1LTT C;  3GF7 A;  1N73 A;  2ZVN B;  1SQQ K;  3QH9 A;  3PTZ A;  2POH A;  3I5C A;  2PGD A;  3PRJ A;  1H0T A;  3H1J E;  1Q7Y Q;  1MZ9 A;  3IAO A;  1PP9 J;  1M1J B;  3AE4 C;  1CI6 A;  4D6T J;  1W2E A;  1VQK P;  1VQO P;  4KT0 J;  2CKF A;  3VMI D;  1S9K E;  1HJ0 A;  1O7N A;  2DW3 A;  3RK3 B;  2N1T C;  1VQP P;  5APS A;  2OYH C;  2SPZ A;  2K37 A;  2BMR A;  3VP8 A;  1JB0 J;  2B87 A;  1SJG A;  1KYO I;  2KI7 B;  1L2P A;  1YTZ I;  1PPJ D;  2YIU B;  1VQ7 P;  1K8A Q;  3VP9 A;  3HE5 B;  1DH3 A;  1AFO A;  1LJ2 A;  4PJ0 E;  4HM4 A;  5KLI B;  2Q9I A;  4NPF X;  3AED C;  1EQ7 A;  1YJW P;  1NTK G;  3D6Y A;  1LTA C;  3EN1 A;  1JM0 A;  1J2J B;  3L70 G;  1KOR A;  2XV5 A;  3JSV C;  1BDC A;  4ZNC A;  1GL2 C;  4NBA D;  3PHL A;  2IBZ I;  2E42 A;  1L0N J;  2E43 A;  1AA0 A;  1EXJ A;  3E7K A;  4NB8 D;  4Y99 B;  3HRN A;  2OYH B;  1GU4 A;  3USS A;  4NBE D;  3H32 B;  1HTL C;  4RJT A;  4HKZ H;  1NYH A;  4ASV A;  4U3F D;  3L73 D;  3VTP C;  4QCK A;  4AIV A;  2HMJ A;  1KQL A;  2O01 H;  5KLV J;  4N3Y B;  2OYO A;  1XTC C;  1VQ6 P;  2W90 A;  1KFN A;  4WY4 C;  1WQL A;  2L91 A;  1USD A;  3PLN A;  3L71 D;  1PP9 E;  2OAR A;  5KLV K;  1Z56 A;  1FOS E;  1G8K B;  5BVZ A;  2Q3E A;  3P8C D;  3S1K A;  1JY3 O;  4EDF A;  1GW3 A;  1O7G A;  4OWF A;  1URQ A;  1SQB G;  3KXD A;  2JP3 A;  2H89 C;  4YPC A;  1L4A B;  1AQ5 A;  4GT1 A;  1L0L K;  3M9Q A;  5KAF E;  1ULI A;  5BU8 B;  2WT7 A;  4WY4 B;  2IZ0 A;  2NPS C;  1YBK A;  1KZU B;  1WMK A;  4HM6 A;  2K9J A;  1UUV A;  1J1E B;  3AEC C;  5TIS E;  2ZJS E;  2Z5I A;  2JEE A;  2WSF J;  2E74 C;  4B86 A;  1VPC A;  2XDJ A;  2WSE H;  3HUS B;  3JC2 2;  3H1L D;  1CZQ A;  3CPW O;  1JY3 P;  3GL2 A;  2NVG A;  2YVJ B;  2NVE A;  1EXI A;  2KS1 A;  2GBW A;  2E5T A;  3TGU J;  5BOK A;  2L5G B;  1RHZ B;  1RE3 A;  1VQL P;  3PH0 A;  1LTB C;  1NTZ E;  4NBH D;  2KK7 A;  3CX5 I;  4UB6 E;  5AVS B;  3MUD A;  3CME P;  1S9K D;  3BRV B;  1IC2 A;  1UUW A;  1RF0 C;  2I1J A;  3E1I A;  2ZT9 D;  3M91 A;  1LWU C;  3GHG C;  4R4M A;  3DQY A;  1S2E A;  2BCC E;  3MHV A;  5EFW B;  1RY3 A;  3B5N D;  2WIT A;  2DE7 D;  4OGQ B;  2B24 A;  2KUB A;  1BE3 E;  1SQV G;  2HOD A;  2YNY A;  1DD4 A;  2OTL P;  2LXC B;  4TLF A;  1RF1 A;  1QL2 A;  2HG5 D;  1KD1 Q;  1KIL B;  1SQQ E;  4QUP A;  1FQT A;  2BCC J;  2KS1 B;  1NTK E;  5CCG A;  1CI6 B;  1X9V A;  1LTG C;  4IFM A;  2XU6 A;  3GTE A;  2R44 A;  5H2F E;  2E74 D;  2WSS H;  3KHU A;  1FZB A;  1G1I A;  3CXH I;  4NBC D;  2W6J H;  1SQP D;  3VYI A;  2QM7 A;  2HYN A;  3L73 G;  2UWJ E;  2WPS A;  2N1T D;  3CCS P;  1YHQ P;  1BCC G;  2MJZ A;  2W27 A;  1BE3 G;  2Q1K A;  1JOC A;  1SQX J;  3H1K D;  2M8R A;  1ZLL A;  5CBN A;  1LT1 A;  2GA1 A;  2OQQ A;  1NTM D;  4DOJ A;  2FKW B;  2KP8 A;  1MFT A;  2YKO A;  1S4X A;  2ZYA A;  2Q6Q A;  3TGU G;  2NVF A;  1SQX K;  3CXH E;  3CCJ P;  3H1L G;  1FZF A;  3AE9 C;  1GDT A;  1LNQ A;  2QEX P;  3R4Y A;  5AEU A;  1QGK B;  1VDF A;  4IL6 X;  1NU1 E;  3WU2 E;  4ZMD A;  3TNU B;  4W7Y A;  2WSE J;  2V7Q J;  3CCQ P;  2E76 D;  3CL3 D;  2ZXX A;  3H1H J;  4C7N A;  3LID A;  1YYC A;  4H44 D;  1LTJ B;  4U7J A;  1JCC A;  4K3A A;  1Y47 A;  2FFD C;  4I1L A;  4NPD A;  3MP7 B;  4HYT B;  1BCC E;  2FYU K;  3CX5 E;  1GK4 A;  4D6T D;  1QEX A;  5KKZ C;  2G8Y A;  4GOD A;  3H1K J;  5CHX A;  3H6P A;  2WSF H;  4Z1M H;  3WUT A;  1K04 A;  3L75 J;  5AVX B;  1JTH A;  1Q82 Q;  2FBW C;  1SLQ A;  3N0Q A;  2IBZ G;  4A7P A;  3L4F A;  2YO3 A;  1LTI C;  3HE4 B;  3AEF C;  3MUD C;  1R5S A;  2E76 C;  1HGV A;  1PGQ A;  1OW6 A;  2A45 I;  3TF5 A;  1G2C A;  2YFI A;  4U3F J;  2Y0C A;  1BGY G;  2A06 D;  1AVY A;  2GUV A;  1GZL A;  5KJ7 D;  4PD4 I;  4KHX A;  4LLH A;  4RKU J;  4BWN A;  3SFD C;  2Q3W A;  2YFJ A;  1Q2N A;  4L73 A;  1L0L J;  2BCC D;  1SQX E;  1SQP K;  2PFX A;  1OVV A;  1Q90 D;  3ITK A;  2IFN A;  2I8D A;  4AQR D;  3AE6 C;  2Z4E A;  1JY3 N;  2OGU A;  2DE6 D;  3L73 E;  5AVT B;  3LW5 J;  1N8R Q;  1KB9 H;  4QDC A;  5CJ4 A;  1M1J A;  2FYN B;  1O7M A;  1EZV D;  3V4Q A;  1R5L A;  1LP1 B;  1N7S A;  1UIX A;  1LGH B;  3L75 D;  2XND H;  3GZY A;  1RE4 A;  2RMZ A;  1URQ C;  1NVO A;  3MTU E;  1NTM G;  2B89 A;  3O6Q B;  3TGU E;  1L4A C;  1IK9 A;  3H1L E;  4GDO A;  1ULJ A;  2JR8 A;  1NU1 G;  1NU1 J;  1FU1 A;  2O01 N;  1LT9 C;  3CCV P;  3SWF A;  2W6A A;  2YMK A;  4AUW A;  1RE3 C;  3L72 J;  4I7Z B;  1RIE A;  2QIW A;  4ASW A;  1NOH A;  3L72 D;  1IO4 A;  1WRG A;  2Q5U A;  3HE5 A;  3QWO C;  2OYI C;  1U7M A;  3Q1M A;  3GZX A;  1X8Y A;  1OVU A;  5M1B A;  1RF0 A;  2QVA A;  2GBX A;  5APQ A;  3RL0 g;  1OFC X;  2AXT H;  1NTZ J;  3AEA C;  3A0H H;  2R5D A;  2OYH A;  3NFQ A;  2IBZ E;  2V7Q H;  3CWB D;  4HM3 A;  1M56 D;  2XZR A;  5APX A;  1FDO A;  1RE4 C;  5GTI E;  4DZO A;  1JNM A;  1XTG B;  1SFC B;  4I7Z C;  3WUV A;  2NRG A;  1KQF B;  3LW5 H;  1N7S C;  5DJT B;  2P67 A;  3CC2 P;  3B8E B;  5KJ7 C;  1E79 H;  4NPE A;  1M1K Q;  1M1J C;  4DJG A;  3Q5S A;  3HD7 C;  1ZW0 A;  4WY4 D;  3AEB C;  5AW5 B;  1L4A A;  5APW A;  1LWU B;  3GHG B;  1EDI A;  3M0D C;  2E4Q A;  1NWQ A;  2FYZ A;  2N1T A;  3TDK A;  1U57 A;  1L0L D;  2P10 A;  1BCC D;  1UII A;  4UB8 H;  4DCK A;  5APT A;  4QUQ A;  3OA7 A;  1HH0 A;  1N7S B;  5C39 A;  1OWA A;  1VF5 B;  4H13 B;  3NTN A;  4WVZ A;  1FOS F;  2WPQ A;  1KB9 I;  1USE A;  2XRX A;  2M3B A;  5TJH A;  1RFS A;  3HD7 B;  3B4S A;  1SFC C;  3HTK A;  5AW3 B;  4PD4 D;  4W7Z A;  4DT0 A;  1PZQ A;  3TNU A;  1ZR2 A;  2B9B A;  1RQU A;  2QSI A;  1IFJ A;  1M7L A;  2WPR A;  2D2C D;  1GL2 B;  1NTK D;  2WWW A;  2P1J A;  3FWN A;  1FC2 C;  2O3J A;  4GKG A;  4PD4 H;  4C46 A;  1FDM A;  1PPJ E;  4JYB A;  2HMO A;  1AQT A;  4P1C H;  3GG2 A;  1BDD A;  1LTJ A;  3B5N B;  5KAI H;  2Y9Z A;  1X0T A;  2A45 G;  4H13 D;  2NPS A;  3UIA A;  3KZI E;  1NU1 D;  1MKM A;  2Y0D A;  2I1K A;  3V6I A;  1FZC B;  1X22 A;  1QVF O;  4NBD D;  2Y9Y A;  2XR8 A;  2HOD B;  3BAT A;  2E76 B;  3TSI A;  1GU5 A;  3L35 A;  1FZG A;  2G3A A;  4UB6 H;  4GIF A;  1SQV K;  3Q3D A;  3PJS K;  5CCG D;  2XSH A;  3W68 A;  4HM0 A;  4BRY A;  3A2A A;  4IOI H;  3B5N C;  2OTK E;  5KLI C;  1VF5 D;  2JO6 A;  2KYV A;  1N7S D;  2QA4 P;  2FXP A;  3CWB G;  3T97 B;  5B66 E;  2HPC B;  2FYU E;  3G9R A;  3L74 D;  4XA4 A;  2AEJ A;  2JJL A;  4OVN F;  3H32 A;  3B71 A;  3IF4 A;  2CPS A;  5TIS H;  3BCC J;  2FFD B;  2JDI H;  3MGN A;  2HML A;  3AE8 C;  2NPS B;  5CCG C;  1NKN A;  2D2C B;  1JM1 A;  3JCU E;  1KB9 E;  3P8C E;  2XKM A;  3V2Q A;  2FFD A;  4NBB D;  2E75 C;  2E74 B;  1FJK A;  4I6M C;  3L75 G;  4EIJ A;  2E4P A;  3EWK A;  1S5L X;  2CK3 H;  1P84 D;  1SQP G;  2H43 A;  1KFM A;  1YIJ P;  3L74 E;  1BSH A;  3H1I J;  3EQ2 A;  2N9Y B;  3VMZ A;  4IFD K;  4QDD A;  2IYP A;  2D2C C;  1ZOY C;  1Q81 Q;  3FGA D;  1HUC A;  1IZN B;  2HR3 A;  1K73 Q;  2KNC B;  1KYO D;  1P84 H;  3RL0 D;  3ABV C;  3AE3 C;  4YTP C;  1GMJ A;  3KDP B;  2RKL A;  3RK2 B;  1NU1 K;  3G4S P;  1S5L H;  4QDF A;  3M0D A;  1EDK A;  2K9Y A;  3O6Q A;  1SQX D;  1LWU A;  3GHG A;  2P7J A;  2XNX A;  2K1A A;  5DJU B;  2GM4 A;  5AW7 B;  2ITA A;  2LR2 A;  2E75 B;  1M57 D;  5KLV E;  3L72 E;  1JY2 P; 
#chains in the Genus database with same CATH homology
 1NTZ E;  4NBH D;  2CKF A;  4NBF D;  3VMI D;  2YFI A;  3EQQ A;  4NB9 D;  1O7N A;  2QPZ A;  2BMO A;  2QJP C;  1WQL A;  2HML A;  3D89 A;  3GZX A;  4AAY B;  4EMJ B;  1KYO E;  3VMH D;  1UUW A;  1SQB E;  2D2C D;  2GBX A;  3L75 E;  2BMR A;  2QJY C;  2ZYL A;  4NBG D;  1NTM E;  1JM1 A;  1SJG A;  2ZT9 D;  1PP9 E;  3L70 E;  2Q3W A;  2YFJ A;  1G8K B;  4QDF B;  1KB9 E;  1PPJ E;  3DQY A;  2BCC E;  1O7P A;  1VM9 A;  3VCP A;  2HMO A;  4P1C H;  3CWB E;  1SQX E;  1BGY E;  2IBZ E;  1O7G A;  4NBB D;  4HM3 A;  3BCC E;  4U3F E;  4HM1 A;  1ZRT E;  2NVF A;  3CXH E;  2DE7 D;  4HKV A;  2E4P A;  3VMG D;  2B24 A;  4HM4 A;  2B1X A;  2DE6 D;  3H1H E;  3L73 E;  1BE3 E;  1NYK A;  3GB4 A;  4H13 D;  2BMQ A;  3GOB A;  5AEU A;  3L74 E;  3C0D A;  4QDC A;  2NUK A;  4HM2 A;  3H1I E;  1NU1 E;  3AZC A;  4PD4 E;  1L0N E;  1ULI A;  3EN1 A;  2HMM A;  4NBD D;  5HL4 A;  4QUR A;  1O7M A;  2DE5 D;  4QDD A;  2XR8 A;  4PV1 D;  4HM6 A;  1EZV E;  2E76 D;  1NDO A;  1UUV A;  4NBA D;  2HMK A;  3H1K E;  2NWF A;  1SQQ E;  1O7H A;  4QUP A;  3GL0 A;  1FQT A;  5CXM A;  2A06 E;  4H44 D;  4HM7 A;  3GZY A;  2E4Q A;  1NTK E;  2JZA A;  4P1B H;  2NUM A;  2I7F A;  3L71 E;  1L0L E;  3GKE A;  4NB8 D;  2XSH A;  3GTE A;  1BCC E;  3CX5 E;  1O7W A;  4HM0 A;  1Q90 C;  5KKZ C;  4NBE D;  4D6T E;  3FOU A;  4H0L D;  4QDF A;  1SQV E;  3GTS A;  3TGU E;  5KLI C;  3H1L E;  2E74 D;  1VF5 D;  2JO6 A;  3GCE A;  4QUQ A;  3GL2 A;  1SQP E;  2QJK C;  3N0Q A;  3VCA A;  2YFL A;  2NVG A;  2YIU C;  1P84 E;  2YVJ B;  1VCK A;  4NBC D;  4QCK A;  1G8J B;  1ULJ A;  2HMN A;  4OGQ D;  5AEW A;  2FYN C;  2NVE A;  2XSO A;  4HJL A;  2HMJ A;  4AIV A;  2FYU E;  3H1J E;  5KLV E;  2XRX A;  3L72 E;  2GBW A;  4HM8 A;  1RFS A;  5BOK A;  4HM5 A;  2E75 D;  1RIE A;  1EG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...