4H0LD

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
161
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 26
structure length 161
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h0lD02
1SQQE 4NB8D 1BE3E 1NU1E 2QJKC 4NBHD 4NB9D 1NYKA 3GL2A 1SJGA 5KLIC 1G8KB 2QJPC 2E76C 1VCKA 4NBED 4QDFB 2JZAA 2DE6D 2YFLA 4H0LC 3L75E 2ZT9D 3H1KE 1O7WA 3L72E 4QUPA 1KYOE 1NTME 2GBXA 2NVGA 2QJYC 3GZYA 4PV1D 3L71E 1UUVA 2I7FA 2HMOA 3VMGD 2E75D 4NBAD 4HM0A 1KB9E 3GTEA 2QPZA 4P1CH 4QCKA 2HMMA 5AEUA 1PPJE 1WQLA 1O7HA 1RFSA 1NTKE 4I7ZC 1BCCE 2HMKA 2NVFA 3CX5E 4QUQA 1EZVE 1JM1A 3C0DA 4AAYB 1SQVE 2Q3WA 1L0LE 4H0LD 2BMQA 3DQYA 4EMJB 4NBFD 5AEWA 2B24A 5KKZC 2NVEA 1RIEA 3GTSA 3VMID 2XSOA 5HL4A 4OGQC 1ULIA 2NUKA 4NBDD 4HM6A 2YVJB 4P1BH 3EN1A 3L73E 4HJLA 3H1LE 4QDFA 3N0QA 2E4QA 4QDDA 1G8JB 3BCCE 4QDCA 4NBGD 3FOUA 3CWBE 1SQXE 4H13C 2E4PA 2FYUE 1O7NA 2BMRA 3VCPA 4OGQD 3TGUE 5BOKA 1L0NE 4PD4E 3EQQA 2DE5D 2XR8A 3VMHD 2HMLA 4NBBD 5CXMA 1FQTA 3AZCA 3GZXA 1UUWA 5KLVE 1O7GA 3GOBA 3H1IE 4QURA 3GCEA 2YFJA 2YIUC 4HM7A 4H13D 4HM8A 4NBCD 1ZRTE 2JO6A 3L74E 2NWFA 3GL0A 4AIVA 2A06E 2E74C 1VM9A 3H1HE 2DE7D 2D2CC 2HMNA 2YMKA 4H44C 3H1JE 1O7MA 1EG9A 4U3FE 1SQBE 4HM5A 1ULJA 2GBWA 2IBZE 4HKVA 2XSHA 4HM1A 3D89A 2CKFA 4HM2A 1PP9E 1SQPE 2YFIA 1VF5D 1Q90C 4HM3A 2BMOA 1O7PA 2HMJA 3GKEA 2B1XA 2ZT9C 4HM4A 1P84E 2FYNC 2XRXA 3CXHE 3GB4A 2E74D 1NTZE 2NUMA 3L70E 1VF5C 4PV1C 2D2CD 3VCAA 4H44D 2BCCE 2ZYLA 2E75C 1NDOA 2E76D
chains in the Genus database with same CATH superfamily
5KLVK 1KORA 1JY2P 5APUA 2BEZF 2OYHB 4K3AA 2AXTH 2R5DA 1SQBD 1KYOE 2D2CB 1JOCA 3VMGD 4NBAD 2XDJA 1K8AQ 2WPQA 1GMJA 2QPZA 1PPJE 1G2CA 1XTGB 3G6EP 1VQPP 2OTLP 1NTKE 2OYIB 1EZVE 1UIIA 1GL2A 2IYOA 3CL3D 3H1HG 1BGYJ 4UB8H 4YXWH 1MV8A 5L8RJ 4C46A 2O01J 1QVGO 3L73E 4UB6H 1SLQA 3PH0A 2KOGA 5GTHE 3SSUA 3L72J 5EFWB 3VCPA 1SQXD 2HFED 3A3YB 3SFEC 2HMLA 1FQTA 1M90Q 5KLVE 1NTMG 1N73A 1Q81Q 1L4AD 2OYHC 1AQTA 1X79B 3AE7C 1ZRTE 4O9BA 4GODA 1N8RQ 3GL0A 2OQQA 2D2CC 1FJKA 1N86A 1OFCX 3TGUD 5TJHA 3AE2C 2CKFA 2YFIA 2OYIC 3H1JJ 3OA7A 3VCAA 3FXEA 1JY3N 2GUSA 1JTHA 4NB8D 3WUVA 1LTTC 1RE4C 2A06D 2N1TB 5CMZA 2J58A 1BSNA 5APXA 5KAIE 1CSBA 3CMAP 1PGPA 4H44B 2I7FA 1J1DB 4KHXA 4EIJA 2HMOA 1VL2A 2A45H 3CCRP 1BGYE 3HTKA 2FBWC 2FFDA 1KB9I 2P67A 2QG4A 2BCCD 3GHGA 4HH2A 3TYYA 1VF5B 2NVEA 1BE3D 2JR8A 3OW2O 1M1JA 1M7LA 1ULIA 1FE6A 2WSCJ 3EN1A 3IN6A 3RK3D 1JEKA 3Q1MA 1FDIA 1EXIA 1URQB 1CZQA 1NU1G 3IFMA 4JQ0D 3V2QA 2XKMA 3PLNA 3C9IA 4GOFA 2N1TC 2RKLA 3N7NA 4H13D 1KFMA 1HF9A 4H44C 1J1DC 3H1JE 4I1LA 2B87B 3B5NB 2IBZE 4HM1A 1DH3A 3SWFA 3D89A 2FKWB 1BSHA 1OW6A 1JM0A 1YI2P 5E79E 2V7QH 1WRGA 3M06A 1VF5C 2Q5UA 1AA0A 5BU8B 4ZNCA 3CXHH 4LC1A 3GF3A 4DCKA 5CCGA 1T3UA 2Q3EA 2I8DA 1GK4A 1N7SD 1URQC 4W80A 5KJ7D 2XU6A 2R3SA 4A7PA 3IR9A 3CX5E 1NTZD 2E5TA 2K88A 2MJZA 2ZT9B 2Q3IA 3RK2D 3E1IA 2RN0A 1NKNA 2G8YA 1X8YA 2FY8A 4HM6A 3MZWB 1S9KE 4JPZB 3B5NC 2Y0EA 1OMIA 4QDCA 1PFIA 1SP4A 1YTZT 1GD2E 2BMRA 3CX5I 4C7NA 1RH5B 3T97A 3HE4B 3LW5H 4GT1A 1VQNP 3L71G 2WPSA 5KKZB 3KXDA 1MFTA 1KQGB 1R8EA 2JWDA 2JJLA 2ZYGA 1D7MA 1KILA 1JY2O 1FDOA 1QLED 1VQ9P 5B5EE 3L74J 5KAFE 4HM3A 3KPEA 3V4WA 4IL6H 5CBOA 5KAIH 2ZT9C 4U3FJ 3HE4A 1W2EA 5H2FH 2M0BA 5APVA 1SQXG 1FU1A 2WZ7A 3H1HD 1KC8Q 2KK7A 2O01H 1L0NG 1LT9A 3L75E 2E74B 4NPEA 1SQQJ 1XTCC 2E75D 1QVFO 2K9JB 2KS1B 1O7HA 1NGMB 3CXHD 2HMKA 3H1KJ 3KDPB 3VP8A 1K04A 3TNUA 4WB4A 2WPVB 5KKZC 4PV1B 1A02J 3AE6C 1DIPA 2XSOA 4WBAA 1YTZI 3OAKA 1SQQK 1UIXA 1GK6A 2ZXXA 1NTMD 4KJMA 4H0LB 4OGQD 4PD4E 1YQ4C 1OIPA 1SFCB 2DE5D 2FYZA 1FJPA 3AEEC 2CPBA 1YITP 3HUSB 3BRTB 5CCHC 5KLVD 5B66E 1LTJA 3JCUH 3L74E 5AW7B 2BCCG 1BCCG 2E74C 3NFQA 3ITKA 5AW1B 1RQUA 1EG9A 2FYUD 4U3FE 3P7KA 1S2EA 4R4MA 2LKMA 3E7KA 2IFNA 3AEAC 3CCJP 3H1LG 1AQ5A 1FZCA 4PV1C 1SQPJ 1SQQE 3AE8C 2AXCA 2UWJE 3Q2YA 2Y0DA 2WSCH 2WSEH 3TDKA 3CCLP 1JB0J 4H0LC 3H1KE 2H8PD 4QUPA 2GBXA 3P32A 1USEA 3R2PA 3H1IG 1Q82Q 1G1IA 1SFCC 3A0HH 3Q5SA 3M0DA 3HUSC 4WY4B 1LWUA 2H7HA 2M5AB 3DQYA 1TU3F 3CCSP 1NU1D 2WVRA 5DJUB 1IFPA 1FZGA 1EDLA 2WWWA 4NBDD 2M3EA 2B9BA 2YXRB 1EDJA 1YIJP 1U7JA 3L72D 1U57A 2CK3H 3CMEP 2BEQD 1GL2D 2W6JH 1GU4A 1YQ3C 3V2RA 2WT7B 4HJGH 1PL5A 2E5YA 3U59A 3BASA 3GOBA 4L75A 2QM8A 1ZXGA 2HYNA 1Y47A 1Y9BA 4ZKUA 3D70A 2KUBA 1H89A 2YXQB 1K05A 3H1JD 4GKGA 1VQMP 1KTMA 4EOTA 1CI6B 1IJDB 1SQPE 1OWAA 2FXOA 5APTA 2XNDH 1RE3A 2WT7A 4WY4C 3GKEA 1HJ0A 2ZXEB 3O6QA 1P84E 2XRXA 3D6YA 1T2KD 2O1JA 1EDIA 2C9LY 5AW6B 1NDOA 1VQKP 3AE9C 2ZYAA 3VP9A 3RL0B 1JY3O 1VPCA 1G8KB 3K5BA 4BXLA 1IZNB 1O7WA 5AVSB 2NVGA 2A45I 2ZVNB 2P2UA 2NPSB 3FWNA 3L4FA 4D6TG 1P84I 3C0DA 2BASA 1HJBA 2IZ1A 1NKZB 5AVTB 1M1KQ 4AYCA 4LLHA 5CHXA 4PD4H 1SQVJ 1NAFA 1H0TA 2QJKB 3L71D 3RBXA 1S9KD 1OVRA 3BRVB 2QE7H 1S72P 1U7MA 2P7JA 3F89A 4IOIH 5AW5B 1GU5A 1YYCA 4JF7A 1SQVK 2OYHA 1AVOA 3RL0C 1USDA 3F5HA 1H88A 2Q1KA 2CPSA 3AE4C 3CPWO 3B4SA 1NTKG 1OVVA 1VM9A 1EZVG 1HUCA 3CI9A 2POHA 2NPSC 4HKVA 2OYIA 1L0ND 1VF5D 1IK7A 2MKVA 3WU2H 2IZ0A 5GTIE 2FXPA 3L73G 2O3JA 3CXHI 4MN4C 3A0BH 1RE4A 2QJKC 4NB9D 4QDFB 2B89A 2C0WA 4I6MC 2Y9YA 5KLVG 1KV4A 3QWOC 3S9OA 1KB9E 4P1CH 2HG5D 5CCGD 4ASVA 4PJ0E 1SQVE 2Q3WA 2FYUG 1GDTA 2R3CA 2FYNB 2Y0CA 2XV5A 1L0LJ 3A5TA 4QDFA 4NPDA 1K73Q 1RF0C 3WUTA 1YJ9P 1BCCD 3CCVP 2IFMA 1HTLC 3SWKA 3KQGA 3BCCJ 4NBBD 2H89C 3CLQA 4PD4D 5CXMA 3AZCA 1UUWA 1S1CX 1R5LA 3CWBJ 1L0LK 1AV1A 2N1TA 2P58A 3H1LD 1BGYG 3L74D 2KLVA 2XNXA 3WMM0 3C1LA 4DJGA 3U1CA 1LP1B 2M3BA 4U3FD 1L4AB 2LR2A 3GMAA 2IPPA 2KZJA 3L72G 4I2LC 3CCMP 3W68A 4YPCA 4XE5B 2FYNC 3H1ID 1SQBJ 2OTJP 1RY3A 3PTZA 2ZYLA 5CJ4A 1KILD 4L73A 2O1KA 4AUWA 4NBHD 1NYKA 1SJGA 1NH4A 2PP6A 4IFMA 2JZAA 4XFJA 1URQA 1PGJA 1S4XA 1SQBK 3P8CD 1KYOH 1WQLA 1OX3A 1JM1A 1L0LE 3PJSK 3H1JG 4NBFD 2JDIH 2IBZG 2NUKA 4AQRD 4P1BH 2Q7CA 2B87A 3B5NA 3N0QA 3BCCE 1L4AC 3FGAD 3CWBE 3L75J 2WPRA 1JY3P 3OJAB 3AE5C 2NZ2A 5GTHH 3FWLA 2WSFJ 1RF1B 3RK3B 1SQXK 1MKMA 1VQLP 2YFJA 3TGUJ 2K1AA 4HM7A 4HM8A 2ZYDA 4B86A 1KQSO 2DE7D 2GA1A 1SQBE 5BVZA 2SPZA 3UIAA 2GUVA 4H13B 1SQPD 1VQOP 3G71P 1JO5A 5C39A 4N78D 2HODB 1PP9J 4D6TD 1X0TA 3D71A 1WT6A 3L70J 3ABVC 2DE6D 1Q7YQ 2J59M 1HH0A 1VDFA 3GZYA 3VOPA 1SS1A 1BE3J 3HRNA 2QRXA 2PGDA 1RF1C 2YKQA 3RK3C 1PGOA 2LXBA 4AAYB 1FZFA 1N7SB 3GLMA 4K35A 5AEWA 1EC5A 4U7JA 2XZRA 1DEBA 1FZAA 3LIDA 1KYOD 3MTUE 2OGUA 2IYPA 2E76B 4N3YB 3PRJA 2KNCB 1PPJD 4H13C 3RK2B 2E4PA 1VQ4P 1NTKD 1J1EB 3JC22 3TGUE 3Q5PA 2HPCB 1EZVD 3H32B 4I7ZB 1KQLA 3W67A 4GIFA 5CCHA 3P8MC 3GCEA 4BRYB 3V4QA 3L73D 2I1JA 1NHLA 3C8VA 3N4XA 2A06E 2KIKA 1YJNP 3HD7B 2YMKA 2QA4P 3VMYA 2K9JA 2KS1A 2QM7A 3MD0A 2GBWA 1E79H 1PP9E 3D6ZA 2HPCA 4OWFA 1EDKA 2JKVA 1N7SC 2L91A 3L70E 3AEBC 2BCCE 5KJ7C 2AXTE 1E5WA 5E79H 1FC2C 3S4RA 4XA4A 1ZRTD 1S5LE 4EI2A 4BRYA 1BE3E 2YIUB 1Q90D 2E76C 1NTZJ 1LTIC 5AVQB 3HD7A 3RK3E 3IAOA 3RK2C 5AVZB 2WMMA 1J1EC 4HM0A 1LT1A 3GG2A 2C0XA 3GTEA 1BDCA 3E1RA 1SFCA 4I7ZC 4RESB 3FXDA 3L74G 1M56D 1VQ7P 1JMBA 1GZLA 3HUSA 1ZOYC 4UB8E 3CX5H 1NTZK 4U3FG 3H6PA 2E75B 1VQ6P 4UB6E 1NAYA 3HD7C 3CD6P 3NTNA 4HJLA 2W27A 1PZQA 1VQ5P 4W7ZA 1JY2N 1G8JB 1JUNA 1BGYD 2ZFCA 5AVYB 1OVUA 1SQQG 2WTYA 1FDMA 2JO1A 4OH8B 3VMHD 1X9VA 3H1KG 5AVRB 2YIUC 3WUUA 1OXZA 4OGQB 1QEXA 1ZLLA 1X22A 3AEGC 4DOJA 4NPFX 2IX7C 2XSHA 3AE1C 3MIWA 4WY4A 3I5CA 3VN0A 3H1HJ 2M5AA 5B5EH 2YKOA 1ZR4A 1ZW0A 1NTZE 2YMYA 5KAFH 3AEDC 2D2CD 1S3JA 2E75C 4GDOA 1Y8AA 2V4HA 4WWIA 1GTWA 1K9MQ 5AW0B 1YHQP 3RBZA 2IBZD 1NJIQ 4IFDK 5AEUA 2P1JA 2FXMA 1ZMEC 2KB7P 1LTBC 2K3RA 1JMMA 1NTMJ 4W7YA 1WMKA 2B24A 2WQYC 3VMID 4OGQC 1J2JB 1SQPG 3EFFK 1JCDA 3L35A 4Y99B 5APYA 1BDDA 3R4YA 2KSEA 3G3ZA 2OARA 2N9BA 3GW6A 1EQ7A 1CI6A 3V2NA 2K37A 3BCCD 1NTMK 3CX5D 3CC7P 1QL2A 4ZKPA 2KZIA 1DX7A 1KQFB 3U1AA 3A2AA 3KHUA 3KYQA 1KFNA 4YTPC 1YBKA 4N6JA 5AW3B 1DD3A 4L74A 3TSIA 5B66H 4AIVA 3AE3C 3H1HE 3BVHA 2NPSA 3MP7B 1S5LH 2N1TD 2FYUK 3O8ZA 1NVOA 1FOSE 2GM4A 2B1XA 3GF7A 3CXHE 4H44D 1PPJG 4Z1MH 3VMZA 2LXCB 1N73B 4Y99C 3GL2A 2HR3A 4JBZA 2YFLA 1IK9A 2W90A 2JEEA 1NTME 3RGUA 1KYOI 1NU1J 4QCKA 1NWQA 1RFSA 4ZMDA 1ZN5A 3G9RA 1QGKB 1GL2C 1EZVI 1HGVA 3VMXA 2KP8A 1URQD 1RIEA 3GTSA 5HL4A 1PIXA 5APSA 1FOSF 1AFOA 1JTHB 1NU1K 3L75D 3KZIE 5AVVB 3V5BA 2OTKE 2E4QA 2KSJA 3FOUA 1RF0A 4R4LA 2FYUE 3L37A 2HLOA 3CC2P 3HTKB 2FFDB 3EQQA 3Q3DA 3MGNA 3B5ND 3I56P 1O7GA 5AVXB 3GHGB 3B71A 4QURA 1N73C 2W6AA 5AVUB 4RJTA 4WVZA 1YJWP 1VQ8P 1L2PA 1M1JB 4C7RA 1T2KC 1SQVG 1Z56A 5BU5A 1N2DC 4HM5A 2W6BA 4IL6E 1IFDA 1IC2A 4HM2A 2Q6QA 4JYCA 1G1JA 3PHLA 3M0AA 1PP9D 2BMOA 5H2FE 1FBMA 1IO4A 4HM4A 3L70D 1HVVA 1P84H 1LTGC 1NU1E 1DD4A 4HB1A 2ZT9D 2QSIA 3L72E 2WSEJ 3TF5A 1NOHA 2K9YA 1QX8A 2FFDC 3VYIA 2P10A 1AJYA 4KT0J 1DEEG 2O01N 3L71J 3GHGC 1HWTC 3RL0g 1SQQD 4EMJB 4JYBA 2E43A 1IFIA 1M1JC 5AW9B 3M91A 2Z5HA 3QH9A 1LNQA 3H1KD 3CCEP 5KLIB 2B88A 1LP1A 1L4AA 2QJYB 5KTBA 1OZHA 1T8ZA 3MUDA 2ZAEB 2XR8A 3USSA 1SQXJ 1CW5A 3JCUE 2G3AA 1L0NJ 3JSVC 2M8RA 1L0LG 1OW7A 3LIEA 2C9NY 3MUDC 5CCHD 2QIWA 4TLFA 2KI7B 2IBZI 2H88C 4C7NB 1GW4A 1L0NK 2E74D 3GB4A 3T97B 2PFXA 5TISE 3BCCG 4IFFA 2NRGA 5GTIH 2E76D 3PP5A 3CWBG 5KLIC 5CCGC 3II6A 4YXDC 3EQ2A 2OYOA 2QJYC 3L71E 1ZP0C 4PV1D 3A0HE 1W5CE 1KILB 1S5LX 2Z5IA 1RF1A 3KZIH 1P84D 1KB9H 1IFMA 1SVFA 4H0LD 2BMQA 4EYYQ 3HD7D 1JNMA 1SQBG 4PJ0H 2BCCJ 1BCCJ 2PRRA 3EWKA 2KLUA 1M8OB 3EFGA 1SFCD 5APQA 4RO0A 2QJPB 2L5GB 4L76A 4QDDA 3AECC 2Z4EA 1LT9B 2QVAA 2R44A 2YKPA 1HBWA 1SQXE 2WSSH 5BOKA 3H1LJ 3H25A 1L0NE 3VTPC 2YO3A 2HODA 4DZOA 5DJTB 2E42A 2R32A 3TNUB 3ZDMA 2N9YB 4DT0A 1LTAC 4M3LA 1NYHA 1FS0E 3H1IJ 1MZ9A 4CPGA 1LJ2A 1KILC 4Y28J 3L75G 2HMJA 1N7SA 1MUUA 3FX0A 5KJ7A 3Q5RA 3VMAA 3L36A 3TGUG 2QJPC 1LTJB 2KNCA 4WY4D 2RMZA 1IFJA 4EDFA 5AW2B 1LT9C 3CCUP 3I55P 1GW3A 2YO2A 4OVNF 5APWA 2I1KA 2HMMA 5CJ0A 3H32A 2ITAA 4QMAA 1BCCE 2NVFA 4QUQA 2A06G 3A7OA 1EXJA 1FZCB 5M1BA 4HYTB 1JCCA 1PP9G 2YVJB 1PGQA 3H1LE 3L70G 1KB9D 1MFZA 4NBGD 5K5GB 5CBNA 2ZVOB 1BE3G 1SQVD 3M9HA 2PAJA 4PD4I 1NO4A 3H1IE 2WITA 3IF4A 1LWUB 1Q2NA 1IFNA 1KILE 1LTJC 3G4SP 2KXPB 2NWFA 3NXSA 5TISH 1KZUB 3SWYA 5AVWB 1FZBA 3WU2E 3MHVA 4D6TJ 2W83C 2AEJA 2H43A 3RL0D 3HE5B 3P8CE 1O7PA 2Y9ZA 4TT3H 3A0BE 3V2PA 1FZCC 3BATA 1SQPK 3CC4P 2DW3A 2NPSD 1AVYA 4GOEA 3CCQP 1M57D 2VRSA 3TK1A 1VCKA 4NBED 2JWAA 1KD1Q 5AW4B 3M9QA 1T6AA 2QEXP 1UUVA 1OW8A 1RQVA 2IDBA 1RHZB 1LGHB 1QL1A 2V7QJ 3HE5A 1LTSC 3M0DC 4HKZH 1LWUC 3O6QB 5AW8B 2AEMA 1NTKJ 3V6IA 1T3JA 2YNYA 3AEFC 4BWNA 1A02F 3B8EB 1PV3A 1KN7A 1Q86Q 1NTZG 1HGZA 2W8ZA 1O7NA 2WSFH 2RH0A 1KMIZ 1ZV8A 3S1KA 3L73J 1FAVA 1L0LD 1NTKK 2Q9IA 2A45G 3GZXA 1W2BO 2JP3A 1R5SA 4N78E 4ASWA 3SFDC 2ZJSE 4D6TE 4NBCD 4LGDE 2JO6A 2AEFA 2J5UA 2KYVA 4RKUJ 5KLVJ 2HMNA 1H0TB 1O7MA 3CWBD 1ZR2A 2R5BA 1ULJA 1H8AA 1G2CB 1Q90C 1N7LA 1RE3C 2FYUJ 1GL2B 3NMDA 2NUMA 3LW5J 4IL6X 3M9BA 1FZEA
chains in the Genus database with same CATH topology
1KORA 1SQQE 3AE8C 3D71A 2BEZF 1NU1E 3Q2YA 3ABVC 2DE6D 1DD4A 1JB0J 4H0LC 2ZT9D 2QSIA 3H1KE 3L72E 4QUPA 1KYOE 2GBXA 2WSEJ 3GZYA 2D2CB 3VMGD 4NBAD 1GMJA 2QPZA 2K9YA 1PPJE 2P10A 1NTKE 1AJYA 3Q5SA 4KT0J 1EZVE 4AAYB 3RL0g 3DQYA 1TU3F 3GLMA 4EMJB 5AEWA 4U7JA 5L8RJ 4NBDD 2O01J 3L73E 1U57A 2E76B 2BEQD 4H13C 2E4PA 3VCPA 1YQ3C 3TGUE 1PL5A 3Q5PA 2XR8A 4I7ZB 3SFEC 2HMLA 1FQTA 5KLVE 3GOBA 3GCEA 3AE7C 2G3AA 1ZRTE 1Y9BA 3C8VA 3D70A 3GL0A 2A06E 2OQQA 2D2CC 2YMKA 1OW7A 1K05A 2GBWA 1KTMA 3AE2C 2CKFA 2QIWA 1PP9E 3D6ZA 1SQPE 2YFIA 2H88C 3GKEA 1HJ0A 3O6QA 1P84E 2XRXA 3GB4A 3L70E 2E74D 3AEBC 3D6YA 3T97B 3VCAA 2BCCE 1NDOA 2E76D 4NB8D 3AE9C 1BE3E 5KLIC 1Q90D 1G8KB 2E76C 4YXDC 1O7WA 3RK3E 3IAOA 2QJYC 3L71E 1ZP0C 2NVGA 4PV1D 4H44B 2I7FA 2HMOA 4HM0A 1VL2A 1S5LX 3GTEA 2FBWC 4I7ZC 1ZOYC 3C0DA 4H0LD 2BMQA 1VF5B 2NVEA 2E75B 1ULIA 3EWKA 2WSCJ 3EN1A 3IN6A 4HJLA 3Q1MA 4QDDA 1FDIA 3AECC 1G8JB 1EXIA 1SQXE 5BOKA 3H25A 2JO1A 1L0NE 3VMHD 2YIUC 4H13D 4OGQB 3AE4C 1NYHA 1HF9A 1VM9A 3AEGC 4H44C 3H1JE 4Y28J 2IBZE 4HKVA 4HM1A 2XSHA 3D89A 3AE1C 1VF5D 1IK7A 1OW6A 2HMJA 2MKVA 2FXPA 1NTZE 1VF5C 3AEDC 2D2CD 2E75C 4GDOA 3Q5RA 3GF3A 2QJKC 4NB9D 2QJPC 4QDFB 3S9OA 1KB9E 4P1CH 2HMMA 5AEUA 1ZMEC 1BCCE 2NVFA 3CX5E 4QUQA 1SQVE 2Q3WA 1WMKA 2ZT9B 2B24A 1EXJA 2WQYC 3VMID 4OGQC 5M1BA 2G8YA 4HM6A 2YVJB 3H1LE 4QDFA 1OMIA 3R4YA 4QDCA 4NBGD 2BMRA 1KQFB 4NBBD 2H89C 5CXMA 3AZCA 1UUWA 1S1CX 3H1IE 4YTPC 1KILE 1DD3A 2NWFA 4AIVA 3AE3C 1KQGB 3H1HE 1R8EA 1FDOA 3GMAA 4HM3A 1O7PA 4TT3H 2ZT9C 2B1XA 3GF7A 3CXHE 2FYNC 4H44D 2ZYLA 4Z1MH 4NBHD 1NYKA 3GL2A 1SJGA 1VCKA 4NBED 2JZAA 2YFLA 4XFJA 3L75E 2E74B 1NTME 1UUVA 2E75D 4QCKA 1OW8A 1WQLA 1RQVA 1O7HA 2IDBA 1RFSA 1NGMB 2HMKA 2V7QJ 3G9RA 1JM1A 1K04A 1L0LE 2WPVB 4NBFD 5KKZC 4PV1B 1RIEA 3AE6C 3GTSA 1DIPA 2XSOA 5HL4A 1PIXA 2NUKA 3AEFC 1UIXA 4P1BH 1PV3A 3N0QA 2E4QA 3BCCE 4H0LB 3FGAD 3FOUA 4R4LA 3CWBE 2FYUE 1O7NA 1KMIZ 4OGQD 3AE5C 2NZ2A 2WSFJ 4PD4E 1YQ4C 3EQQA 2DE5D 3Q3DA 1MKMA 3GZXA 3AEEC 1O7GA 2JP3A 3B71A 4QURA 2YFJA 4HM7A 3SFDC 4HM8A 4NBCD 2JO6A 3L74E 2J5UA 2E74C 4RKUJ 2DE7D 2HMNA 1RQUA 1O7MA 1EG9A 4U3FE 1SQBE 4HM5A 1ULJA 4HM2A 4H13B 1Q90C 2BMOA 4R4MA 4HM4A 3AEAC 2NUMA 3LW5J 4PV1C 4IL6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ E;  4NB8 D;  1BE3 E;  1NU1 E;  2QJK C;  4NBH D;  4NB9 D;  1NYK A;  3GL2 A;  1SJG A;  5KLI C;  1G8K B;  2QJP C;  2E76 C;  1VCK A;  4NBE D;  4QDF B;  2JZA A;  2DE6 D;  2YFL A;  4H0L C;  3L75 E;  2ZT9 D;  3H1K E;  1O7W A;  3L72 E;  4QUP A;  1KYO E;  1NTM E;  2GBX A;  2NVG A;  2QJY C;  3GZY A;  4PV1 D;  3L71 E;  1UUV A;  2I7F A;  2HMO A;  3VMG D;  2E75 D;  4NBA D;  4HM0 A;  1KB9 E;  3GTE A;  2QPZ A;  4P1C H;  4QCK A;  2HMM A;  5AEU A;  1PPJ E;  1WQL A;  1O7H A;  1RFS A;  1NTK E;  4I7Z C;  1BCC E;  2HMK A;  2NVF A;  3CX5 E;  4QUQ A;  1EZV E;  1JM1 A;  3C0D A;  4AAY B;  1SQV E;  2Q3W A;  1L0L E;  4H0L D;  2BMQ A;  3DQY A;  4EMJ B;  4NBF D;  5AEW A;  2B24 A;  5KKZ C;  2NVE A;  1RIE A;  3GTS A;  3VMI D;  2XSO A;  5HL4 A;  4OGQ C;  1ULI A;  2NUK A;  4NBD D;  4HM6 A;  2YVJ B;  4P1B H;  3EN1 A;  3L73 E;  4HJL A;  3H1L E;  4QDF A;  3N0Q A;  2E4Q A;  4QDD A;  1G8J B;  3BCC E;  4QDC A;  4NBG D;  3FOU A;  3CWB E;  1SQX E;  4H13 C;  2E4P A;  2FYU E;  1O7N A;  2BMR A;  3VCP A;  4OGQ D;  3TGU E;  5BOK A;  1L0N E;  4PD4 E;  3EQQ A;  2DE5 D;  2XR8 A;  3VMH D;  2HML A;  4NBB D;  5CXM A;  1FQT A;  3AZC A;  3GZX A;  1UUW A;  5KLV E;  1O7G A;  3GOB A;  3H1I E;  4QUR A;  3GCE A;  2YFJ A;  2YIU C;  4HM7 A;  4H13 D;  4HM8 A;  4NBC D;  1ZRT E;  2JO6 A;  3L74 E;  2NWF A;  3GL0 A;  4AIV A;  2A06 E;  2E74 C;  1VM9 A;  3H1H E;  2DE7 D;  2D2C C;  2HMN A;  2YMK A;  4H44 C;  3H1J E;  1O7M A;  1EG9 A;  4U3F E;  1SQB E;  4HM5 A;  1ULJ A;  2GBW A;  2IBZ E;  4HKV A;  2XSH A;  4HM1 A;  3D89 A;  2CKF A;  4HM2 A;  1PP9 E;  1SQP E;  2YFI A;  1VF5 D;  1Q90 C;  4HM3 A;  2BMO A;  1O7P A;  2HMJ A;  3GKE A;  2B1X A;  2ZT9 C;  4HM4 A;  1P84 E;  2FYN C;  2XRX A;  3CXH E;  3GB4 A;  2E74 D;  1NTZ E;  2NUM A;  3L70 E;  1VF5 C;  4PV1 C;  2D2C D;  3VCA A;  4H44 D;  2BCC E;  2ZYL A;  2E75 C;  1NDO A;  2E76 D; 
#chains in the Genus database with same CATH topology
 5KLV K;  1KOR A;  1JY2 P;  5APU A;  2BEZ F;  2OYH B;  4K3A A;  2AXT H;  2R5D A;  1SQB D;  1KYO E;  2D2C B;  1JOC A;  3VMG D;  4NBA D;  2XDJ A;  1K8A Q;  2WPQ A;  1GMJ A;  2QPZ A;  1PPJ E;  1G2C A;  1XTG B;  3G6E P;  1VQP P;  2OTL P;  1NTK E;  2OYI B;  1EZV E;  1UII A;  1GL2 A;  2IYO A;  3CL3 D;  3H1H G;  1BGY J;  4UB8 H;  4YXW H;  1MV8 A;  5L8R J;  4C46 A;  2O01 J;  1QVG O;  3L73 E;  4UB6 H;  1SLQ A;  3PH0 A;  2KOG A;  5GTH E;  3SSU A;  3L72 J;  5EFW B;  3VCP A;  1SQX D;  2HFE D;  3A3Y B;  3SFE C;  2HML A;  1FQT A;  1M90 Q;  5KLV E;  1NTM G;  1N73 A;  1Q81 Q;  1L4A D;  2OYH C;  1AQT A;  1X79 B;  3AE7 C;  1ZRT E;  4O9B A;  4GOD A;  1N8R Q;  3GL0 A;  2OQQ A;  2D2C C;  1FJK A;  1N86 A;  1OFC X;  3TGU D;  5TJH A;  3AE2 C;  2CKF A;  2YFI A;  2OYI C;  3H1J J;  3OA7 A;  3VCA A;  3FXE A;  1JY3 N;  2GUS A;  1JTH A;  4NB8 D;  3WUV A;  1LTT C;  1RE4 C;  2A06 D;  2N1T B;  5CMZ A;  2J58 A;  1BSN A;  5APX A;  5KAI E;  1CSB A;  3CMA P;  1PGP A;  4H44 B;  2I7F A;  1J1D B;  4KHX A;  4EIJ A;  2HMO A;  1VL2 A;  2A45 H;  3CCR P;  1BGY E;  3HTK A;  2FBW C;  2FFD A;  1KB9 I;  2P67 A;  2QG4 A;  2BCC D;  3GHG A;  4HH2 A;  3TYY A;  1VF5 B;  2NVE A;  1BE3 D;  2JR8 A;  3OW2 O;  1M1J A;  1M7L A;  1ULI A;  1FE6 A;  2WSC J;  3EN1 A;  3IN6 A;  3RK3 D;  1JEK A;  3Q1M A;  1FDI A;  1EXI A;  1URQ B;  1CZQ A;  1NU1 G;  3IFM A;  4JQ0 D;  3V2Q A;  2XKM A;  3PLN A;  3C9I A;  4GOF A;  2N1T C;  2RKL A;  3N7N A;  4H13 D;  1KFM A;  1HF9 A;  4H44 C;  1J1D C;  3H1J E;  4I1L A;  2B87 B;  3B5N B;  2IBZ E;  4HM1 A;  1DH3 A;  3SWF A;  3D89 A;  2FKW B;  1BSH A;  1OW6 A;  1JM0 A;  1YI2 P;  5E79 E;  2V7Q H;  1WRG A;  3M06 A;  1VF5 C;  2Q5U A;  1AA0 A;  5BU8 B;  4ZNC A;  3CXH H;  4LC1 A;  3GF3 A;  4DCK A;  5CCG A;  1T3U A;  2Q3E A;  2I8D A;  1GK4 A;  1N7S D;  1URQ C;  4W80 A;  5KJ7 D;  2XU6 A;  2R3S A;  4A7P A;  3IR9 A;  3CX5 E;  1NTZ D;  2E5T A;  2K88 A;  2MJZ A;  2ZT9 B;  2Q3I A;  3RK2 D;  3E1I A;  2RN0 A;  1NKN A;  2G8Y A;  1X8Y A;  2FY8 A;  4HM6 A;  3MZW B;  1S9K E;  4JPZ B;  3B5N C;  2Y0E A;  1OMI A;  4QDC A;  1PFI A;  1SP4 A;  1YTZ T;  1GD2 E;  2BMR A;  3CX5 I;  4C7N A;  1RH5 B;  3T97 A;  3HE4 B;  3LW5 H;  4GT1 A;  1VQN P;  3L71 G;  2WPS A;  5KKZ B;  3KXD A;  1MFT A;  1KQG B;  1R8E A;  2JWD A;  2JJL A;  2ZYG A;  1D7M A;  1KIL A;  1JY2 O;  1FDO A;  1QLE D;  1VQ9 P;  5B5E E;  3L74 J;  5KAF E;  4HM3 A;  3KPE A;  3V4W A;  4IL6 H;  5CBO A;  5KAI H;  2ZT9 C;  4U3F J;  3HE4 A;  1W2E A;  5H2F H;  2M0B A;  5APV A;  1SQX G;  1FU1 A;  2WZ7 A;  3H1H D;  1KC8 Q;  2KK7 A;  2O01 H;  1L0N G;  1LT9 A;  3L75 E;  2E74 B;  4NPE A;  1SQQ J;  1XTC C;  2E75 D;  1QVF O;  2K9J B;  2KS1 B;  1O7H A;  1NGM B;  3CXH D;  2HMK A;  3H1K J;  3KDP B;  3VP8 A;  1K04 A;  3TNU A;  4WB4 A;  2WPV B;  5KKZ C;  4PV1 B;  1A02 J;  3AE6 C;  1DIP A;  2XSO A;  4WBA A;  1YTZ I;  3OAK A;  1SQQ K;  1UIX A;  1GK6 A;  2ZXX A;  1NTM D;  4KJM A;  4H0L B;  4OGQ D;  4PD4 E;  1YQ4 C;  1OIP A;  1SFC B;  2DE5 D;  2FYZ A;  1FJP A;  3AEE C;  2CPB A;  1YIT P;  3HUS B;  3BRT B;  5CCH C;  5KLV D;  5B66 E;  1LTJ A;  3JCU H;  3L74 E;  5AW7 B;  2BCC G;  1BCC G;  2E74 C;  3NFQ A;  3ITK A;  5AW1 B;  1RQU A;  1EG9 A;  2FYU D;  4U3F E;  3P7K A;  1S2E A;  4R4M A;  2LKM A;  3E7K A;  2IFN A;  3AEA C;  3CCJ P;  3H1L G;  1AQ5 A;  1FZC A;  4PV1 C;  1SQP J;  1SQQ E;  3AE8 C;  2AXC A;  2UWJ E;  3Q2Y A;  2Y0D A;  2WSC H;  2WSE H;  3TDK A;  3CCL P;  1JB0 J;  4H0L C;  3H1K E;  2H8P D;  4QUP A;  2GBX A;  3P32 A;  1USE A;  3R2P A;  3H1I G;  1Q82 Q;  1G1I A;  1SFC C;  3A0H H;  3Q5S A;  3M0D A;  3HUS C;  4WY4 B;  1LWU A;  2H7H A;  2M5A B;  3DQY A;  1TU3 F;  3CCS P;  1NU1 D;  2WVR A;  5DJU B;  1IFP A;  1FZG A;  1EDL A;  2WWW A;  4NBD D;  2M3E A;  2B9B A;  2YXR B;  1EDJ A;  1YIJ P;  1U7J A;  3L72 D;  1U57 A;  2CK3 H;  3CME P;  2BEQ D;  1GL2 D;  2W6J H;  1GU4 A;  1YQ3 C;  3V2R A;  2WT7 B;  4HJG H;  1PL5 A;  2E5Y A;  3U59 A;  3BAS A;  3GOB A;  4L75 A;  2QM8 A;  1ZXG A;  2HYN A;  1Y47 A;  1Y9B A;  4ZKU A;  3D70 A;  2KUB A;  1H89 A;  2YXQ B;  1K05 A;  3H1J D;  4GKG A;  1VQM P;  1KTM A;  4EOT A;  1CI6 B;  1IJD B;  1SQP E;  1OWA A;  2FXO A;  5APT A;  2XND H;  1RE3 A;  2WT7 A;  4WY4 C;  3GKE A;  1HJ0 A;  2ZXE B;  3O6Q A;  1P84 E;  2XRX A;  3D6Y A;  1T2K D;  2O1J A;  1EDI A;  2C9L Y;  5AW6 B;  1NDO A;  1VQK P;  3AE9 C;  2ZYA A;  3VP9 A;  3RL0 B;  1JY3 O;  1VPC A;  1G8K B;  3K5B A;  4BXL A;  1IZN B;  1O7W A;  5AVS B;  2NVG A;  2A45 I;  2ZVN B;  2P2U A;  2NPS B;  3FWN A;  3L4F A;  4D6T G;  1P84 I;  3C0D A;  2BAS A;  1HJB A;  2IZ1 A;  1NKZ B;  5AVT B;  1M1K Q;  4AYC A;  4LLH A;  5CHX A;  4PD4 H;  1SQV J;  1NAF A;  1H0T A;  2QJK B;  3L71 D;  3RBX A;  1S9K D;  1OVR A;  3BRV B;  2QE7 H;  1S72 P;  1U7M A;  2P7J A;  3F89 A;  4IOI H;  5AW5 B;  1GU5 A;  1YYC A;  4JF7 A;  1SQV K;  2OYH A;  1AVO A;  3RL0 C;  1USD A;  3F5H A;  1H88 A;  2Q1K A;  2CPS A;  3AE4 C;  3CPW O;  3B4S A;  1NTK G;  1OVV A;  1VM9 A;  1EZV G;  1HUC A;  3CI9 A;  2POH A;  2NPS C;  4HKV A;  2OYI A;  1L0N D;  1VF5 D;  1IK7 A;  2MKV A;  3WU2 H;  2IZ0 A;  5GTI E;  2FXP A;  3L73 G;  2O3J A;  3CXH I;  4MN4 C;  3A0B H;  1RE4 A;  2QJK C;  4NB9 D;  4QDF B;  2B89 A;  2C0W A;  4I6M C;  2Y9Y A;  5KLV G;  1KV4 A;  3QWO C;  3S9O A;  1KB9 E;  4P1C H;  2HG5 D;  5CCG D;  4ASV A;  4PJ0 E;  1SQV E;  2Q3W A;  2FYU G;  1GDT A;  2R3C A;  2FYN B;  2Y0C A;  2XV5 A;  1L0L J;  3A5T A;  4QDF A;  4NPD A;  1K73 Q;  1RF0 C;  3WUT A;  1YJ9 P;  1BCC D;  3CCV P;  2IFM A;  1HTL C;  3SWK A;  3KQG A;  3BCC J;  4NBB D;  2H89 C;  3CLQ A;  4PD4 D;  5CXM A;  3AZC A;  1UUW A;  1S1C X;  1R5L A;  3CWB J;  1L0L K;  1AV1 A;  2N1T A;  2P58 A;  3H1L D;  1BGY G;  3L74 D;  2KLV A;  2XNX A;  3WMM 0;  3C1L A;  4DJG A;  3U1C A;  1LP1 B;  2M3B A;  4U3F D;  1L4A B;  2LR2 A;  3GMA A;  2IPP A;  2KZJ A;  3L72 G;  4I2L C;  3CCM P;  3W68 A;  4YPC A;  4XE5 B;  2FYN C;  3H1I D;  1SQB J;  2OTJ P;  1RY3 A;  3PTZ A;  2ZYL A;  5CJ4 A;  1KIL D;  4L73 A;  2O1K A;  4AUW A;  4NBH D;  1NYK A;  1SJG A;  1NH4 A;  2PP6 A;  4IFM A;  2JZA A;  4XFJ A;  1URQ A;  1PGJ A;  1S4X A;  1SQB K;  3P8C D;  1KYO H;  1WQL A;  1OX3 A;  1JM1 A;  1L0L E;  3PJS K;  3H1J G;  4NBF D;  2JDI H;  2IBZ G;  2NUK A;  4AQR D;  4P1B H;  2Q7C A;  2B87 A;  3B5N A;  3N0Q A;  3BCC E;  1L4A C;  3FGA D;  3CWB E;  3L75 J;  2WPR A;  1JY3 P;  3OJA B;  3AE5 C;  2NZ2 A;  5GTH H;  3FWL A;  2WSF J;  1RF1 B;  3RK3 B;  1SQX K;  1MKM A;  1VQL P;  2YFJ A;  3TGU J;  2K1A A;  4HM7 A;  4HM8 A;  2ZYD A;  4B86 A;  1KQS O;  2DE7 D;  2GA1 A;  1SQB E;  5BVZ A;  2SPZ A;  3UIA A;  2GUV A;  4H13 B;  1SQP D;  1VQO P;  3G71 P;  1JO5 A;  5C39 A;  4N78 D;  2HOD B;  1PP9 J;  4D6T D;  1X0T A;  3D71 A;  1WT6 A;  3L70 J;  3ABV C;  2DE6 D;  1Q7Y Q;  2J59 M;  1HH0 A;  1VDF A;  3GZY A;  3VOP A;  1SS1 A;  1BE3 J;  3HRN A;  2QRX A;  2PGD A;  1RF1 C;  2YKQ A;  3RK3 C;  1PGO A;  2LXB A;  4AAY B;  1FZF A;  1N7S B;  3GLM A;  4K35 A;  5AEW A;  1EC5 A;  4U7J A;  2XZR A;  1DEB A;  1FZA A;  3LID A;  1KYO D;  3MTU E;  2OGU A;  2IYP A;  2E76 B;  4N3Y B;  3PRJ A;  2KNC B;  1PPJ D;  4H13 C;  3RK2 B;  2E4P A;  1VQ4 P;  1NTK D;  1J1E B;  3JC2 2;  3TGU E;  3Q5P A;  2HPC B;  1EZV D;  3H32 B;  4I7Z B;  1KQL A;  3W67 A;  4GIF A;  5CCH A;  3P8M C;  3GCE A;  4BRY B;  3V4Q A;  3L73 D;  2I1J A;  1NHL A;  3C8V A;  3N4X A;  2A06 E;  2KIK A;  1YJN P;  3HD7 B;  2YMK A;  2QA4 P;  3VMY A;  2K9J A;  2KS1 A;  2QM7 A;  3MD0 A;  2GBW A;  1E79 H;  1PP9 E;  3D6Z A;  2HPC A;  4OWF A;  1EDK A;  2JKV A;  1N7S C;  2L91 A;  3L70 E;  3AEB C;  2BCC E;  5KJ7 C;  2AXT E;  1E5W A;  5E79 H;  1FC2 C;  3S4R A;  4XA4 A;  1ZRT D;  1S5L E;  4EI2 A;  4BRY A;  1BE3 E;  2YIU B;  1Q90 D;  2E76 C;  1NTZ J;  1LTI C;  5AVQ B;  3HD7 A;  3RK3 E;  3IAO A;  3RK2 C;  5AVZ B;  2WMM A;  1J1E C;  4HM0 A;  1LT1 A;  3GG2 A;  2C0X A;  3GTE A;  1BDC A;  3E1R A;  1SFC A;  4I7Z C;  4RES B;  3FXD A;  3L74 G;  1M56 D;  1VQ7 P;  1JMB A;  1GZL A;  3HUS A;  1ZOY C;  4UB8 E;  3CX5 H;  1NTZ K;  4U3F G;  3H6P A;  2E75 B;  1VQ6 P;  4UB6 E;  1NAY A;  3HD7 C;  3CD6 P;  3NTN A;  4HJL A;  2W27 A;  1PZQ A;  1VQ5 P;  4W7Z A;  1JY2 N;  1G8J B;  1JUN A;  1BGY D;  2ZFC A;  5AVY B;  1OVU A;  1SQQ G;  2WTY A;  1FDM A;  2JO1 A;  4OH8 B;  3VMH D;  1X9V A;  3H1K G;  5AVR B;  2YIU C;  3WUU A;  1OXZ A;  4OGQ B;  1QEX A;  1ZLL A;  1X22 A;  3AEG C;  4DOJ A;  4NPF X;  2IX7 C;  2XSH A;  3AE1 C;  3MIW A;  4WY4 A;  3I5C A;  3VN0 A;  3H1H J;  2M5A A;  5B5E H;  2YKO A;  1ZR4 A;  1ZW0 A;  1NTZ E;  2YMY A;  5KAF H;  3AED C;  2D2C D;  1S3J A;  2E75 C;  4GDO A;  1Y8A A;  2V4H A;  4WWI A;  1GTW A;  1K9M Q;  5AW0 B;  1YHQ P;  3RBZ A;  2IBZ D;  1NJI Q;  4IFD K;  5AEU A;  2P1J A;  2FXM A;  1ZME C;  2KB7 P;  1LTB C;  2K3R A;  1JMM A;  1NTM J;  4W7Y A;  1WMK A;  2B24 A;  2WQY C;  3VMI D;  4OGQ C;  1J2J B;  1SQP G;  3EFF K;  1JCD A;  3L35 A;  4Y99 B;  5APY A;  1BDD A;  3R4Y A;  2KSE A;  3G3Z A;  2OAR A;  2N9B A;  3GW6 A;  1EQ7 A;  1CI6 A;  3V2N A;  2K37 A;  3BCC D;  1NTM K;  3CX5 D;  3CC7 P;  1QL2 A;  4ZKP A;  2KZI A;  1DX7 A;  1KQF B;  3U1A A;  3A2A A;  3KHU A;  3KYQ A;  1KFN A;  4YTP C;  1YBK A;  4N6J A;  5AW3 B;  1DD3 A;  4L74 A;  3TSI A;  5B66 H;  4AIV A;  3AE3 C;  3H1H E;  3BVH A;  2NPS A;  3MP7 B;  1S5L H;  2N1T D;  2FYU K;  3O8Z A;  1NVO A;  1FOS E;  2GM4 A;  2B1X A;  3GF7 A;  3CXH E;  4H44 D;  1PPJ G;  4Z1M H;  3VMZ A;  2LXC B;  1N73 B;  4Y99 C;  3GL2 A;  2HR3 A;  4JBZ A;  2YFL A;  1IK9 A;  2W90 A;  2JEE A;  1NTM E;  3RGU A;  1KYO I;  1NU1 J;  4QCK A;  1NWQ A;  1RFS A;  4ZMD A;  1ZN5 A;  3G9R A;  1QGK B;  1GL2 C;  1EZV I;  1HGV A;  3VMX A;  2KP8 A;  1URQ D;  1RIE A;  3GTS A;  5HL4 A;  1PIX A;  5APS A;  1FOS F;  1AFO A;  1JTH B;  1NU1 K;  3L75 D;  3KZI E;  5AVV B;  3V5B A;  2OTK E;  2E4Q A;  2KSJ A;  3FOU A;  1RF0 A;  4R4L A;  2FYU E;  3L37 A;  2HLO A;  3CC2 P;  3HTK B;  2FFD B;  3EQQ A;  3Q3D A;  3MGN A;  3B5N D;  3I56 P;  1O7G A;  5AVX B;  3GHG B;  3B71 A;  4QUR A;  1N73 C;  2W6A A;  5AVU B;  4RJT A;  4WVZ A;  1YJW P;  1VQ8 P;  1L2P A;  1M1J B;  4C7R A;  1T2K C;  1SQV G;  1Z56 A;  5BU5 A;  1N2D C;  4HM5 A;  2W6B A;  4IL6 E;  1IFD A;  1IC2 A;  4HM2 A;  2Q6Q A;  4JYC A;  1G1J A;  3PHL A;  3M0A A;  1PP9 D;  2BMO A;  5H2F E;  1FBM A;  1IO4 A;  4HM4 A;  3L70 D;  1HVV A;  1P84 H;  1LTG C;  1NU1 E;  1DD4 A;  4HB1 A;  2ZT9 D;  2QSI A;  3L72 E;  2WSE J;  3TF5 A;  1NOH A;  2K9Y A;  1QX8 A;  2FFD C;  3VYI A;  2P10 A;  1AJY A;  4KT0 J;  1DEE G;  2O01 N;  3L71 J;  3GHG C;  1HWT C;  3RL0 g;  1SQQ D;  4EMJ B;  4JYB A;  2E43 A;  1IFI A;  1M1J C;  5AW9 B;  3M91 A;  2Z5H A;  3QH9 A;  1LNQ A;  3H1K D;  3CCE P;  5KLI B;  2B88 A;  1LP1 A;  1L4A A;  2QJY B;  5KTB A;  1OZH A;  1T8Z A;  3MUD A;  2ZAE B;  2XR8 A;  3USS A;  1SQX J;  1CW5 A;  3JCU E;  2G3A A;  1L0N J;  3JSV C;  2M8R A;  1L0L G;  1OW7 A;  3LIE A;  2C9N Y;  3MUD C;  5CCH D;  2QIW A;  4TLF A;  2KI7 B;  2IBZ I;  2H88 C;  4C7N B;  1GW4 A;  1L0N K;  2E74 D;  3GB4 A;  3T97 B;  2PFX A;  5TIS E;  3BCC G;  4IFF A;  2NRG A;  5GTI H;  2E76 D;  3PP5 A;  3CWB G;  5KLI C;  5CCG C;  3II6 A;  4YXD C;  3EQ2 A;  2OYO A;  2QJY C;  3L71 E;  1ZP0 C;  4PV1 D;  3A0H E;  1W5C E;  1KIL B;  1S5L X;  2Z5I A;  1RF1 A;  3KZI H;  1P84 D;  1KB9 H;  1IFM A;  1SVF A;  4H0L D;  2BMQ A;  4EYY Q;  3HD7 D;  1JNM A;  1SQB G;  4PJ0 H;  2BCC J;  1BCC J;  2PRR A;  3EWK A;  2KLU A;  1M8O B;  3EFG A;  1SFC D;  5APQ A;  4RO0 A;  2QJP B;  2L5G B;  4L76 A;  4QDD A;  3AEC C;  2Z4E A;  1LT9 B;  2QVA A;  2R44 A;  2YKP A;  1HBW A;  1SQX E;  2WSS H;  5BOK A;  3H1L J;  3H25 A;  1L0N E;  3VTP C;  2YO3 A;  2HOD A;  4DZO A;  5DJT B;  2E42 A;  2R32 A;  3TNU B;  3ZDM A;  2N9Y B;  4DT0 A;  1LTA C;  4M3L A;  1NYH A;  1FS0 E;  3H1I J;  1MZ9 A;  4CPG A;  1LJ2 A;  1KIL C;  4Y28 J;  3L75 G;  2HMJ A;  1N7S A;  1MUU A;  3FX0 A;  5KJ7 A;  3Q5R A;  3VMA A;  3L36 A;  3TGU G;  2QJP C;  1LTJ B;  2KNC A;  4WY4 D;  2RMZ A;  1IFJ A;  4EDF A;  5AW2 B;  1LT9 C;  3CCU P;  3I55 P;  1GW3 A;  2YO2 A;  4OVN F;  5APW A;  2I1K A;  2HMM A;  5CJ0 A;  3H32 A;  2ITA A;  4QMA A;  1BCC E;  2NVF A;  4QUQ A;  2A06 G;  3A7O A;  1EXJ A;  1FZC B;  5M1B A;  4HYT B;  1JCC A;  1PP9 G;  2YVJ B;  1PGQ A;  3H1L E;  3L70 G;  1KB9 D;  1MFZ A;  4NBG D;  5K5G B;  5CBN A;  2ZVO B;  1BE3 G;  1SQV D;  3M9H A;  2PAJ A;  4PD4 I;  1NO4 A;  3H1I E;  2WIT A;  3IF4 A;  1LWU B;  1Q2N A;  1IFN A;  1KIL E;  1LTJ C;  3G4S P;  2KXP B;  2NWF A;  3NXS A;  5TIS H;  1KZU B;  3SWY A;  5AVW B;  1FZB A;  3WU2 E;  3MHV A;  4D6T J;  2W83 C;  2AEJ A;  2H43 A;  3RL0 D;  3HE5 B;  3P8C E;  1O7P A;  2Y9Z A;  4TT3 H;  3A0B E;  3V2P A;  1FZC C;  3BAT A;  1SQP K;  3CC4 P;  2DW3 A;  2NPS D;  1AVY A;  4GOE A;  3CCQ P;  1M57 D;  2VRS A;  3TK1 A;  1VCK A;  4NBE D;  2JWA A;  1KD1 Q;  5AW4 B;  3M9Q A;  1T6A A;  2QEX P;  1UUV A;  1OW8 A;  1RQV A;  2IDB A;  1RHZ B;  1LGH B;  1QL1 A;  2V7Q J;  3HE5 A;  1LTS C;  3M0D C;  4HKZ H;  1LWU C;  3O6Q B;  5AW8 B;  2AEM A;  1NTK J;  3V6I A;  1T3J A;  2YNY A;  3AEF C;  4BWN A;  1A02 F;  3B8E B;  1PV3 A;  1KN7 A;  1Q86 Q;  1NTZ G;  1HGZ A;  2W8Z A;  1O7N A;  2WSF H;  2RH0 A;  1KMI Z;  1ZV8 A;  3S1K A;  3L73 J;  1FAV A;  1L0L D;  1NTK K;  2Q9I A;  2A45 G;  3GZX A;  1W2B O;  2JP3 A;  1R5S A;  4N78 E;  4ASW A;  3SFD C;  2ZJS E;  4D6T E;  4NBC D;  4LGD E;  2JO6 A;  2AEF A;  2J5U A;  2KYV A;  4RKU J;  5KLV J;  2HMN A;  1H0T B;  1O7M A;  3CWB D;  1ZR2 A;  2R5B A;  1ULJ A;  1H8A A;  1G2C B;  1Q90 C;  1N7L A;  1RE3 C;  2FYU J;  1GL2 B;  3NMD A;  2NUM A;  3LW5 J;  4IL6 X;  3M9B A;  1FZE A; 
#chains in the Genus database with same CATH homology
 1KOR A;  1SQQ E;  3AE8 C;  3D71 A;  2BEZ F;  1NU1 E;  3Q2Y A;  3ABV C;  2DE6 D;  1DD4 A;  1JB0 J;  4H0L C;  2ZT9 D;  2QSI A;  3H1K E;  3L72 E;  4QUP A;  1KYO E;  2GBX A;  2WSE J;  3GZY A;  2D2C B;  3VMG D;  4NBA D;  1GMJ A;  2QPZ A;  2K9Y A;  1PPJ E;  2P10 A;  1NTK E;  1AJY A;  3Q5S A;  4KT0 J;  1EZV E;  4AAY B;  3RL0 g;  3DQY A;  1TU3 F;  3GLM A;  4EMJ B;  5AEW A;  4U7J A;  5L8R J;  4NBD D;  2O01 J;  3L73 E;  1U57 A;  2E76 B;  2BEQ D;  4H13 C;  2E4P A;  3VCP A;  1YQ3 C;  3TGU E;  1PL5 A;  3Q5P A;  2XR8 A;  4I7Z B;  3SFE C;  2HML A;  1FQT A;  5KLV E;  3GOB A;  3GCE A;  3AE7 C;  2G3A A;  1ZRT E;  1Y9B A;  3C8V A;  3D70 A;  3GL0 A;  2A06 E;  2OQQ A;  2D2C C;  2YMK A;  1OW7 A;  1K05 A;  2GBW A;  1KTM A;  3AE2 C;  2CKF A;  2QIW A;  1PP9 E;  3D6Z A;  1SQP E;  2YFI A;  2H88 C;  3GKE A;  1HJ0 A;  3O6Q A;  1P84 E;  2XRX A;  3GB4 A;  3L70 E;  2E74 D;  3AEB C;  3D6Y A;  3T97 B;  3VCA A;  2BCC E;  1NDO A;  2E76 D;  4NB8 D;  3AE9 C;  1BE3 E;  5KLI C;  1Q90 D;  1G8K B;  2E76 C;  4YXD C;  1O7W A;  3RK3 E;  3IAO A;  2QJY C;  3L71 E;  1ZP0 C;  2NVG A;  4PV1 D;  4H44 B;  2I7F A;  2HMO A;  4HM0 A;  1VL2 A;  1S5L X;  3GTE A;  2FBW C;  4I7Z C;  1ZOY C;  3C0D A;  4H0L D;  2BMQ A;  1VF5 B;  2NVE A;  2E75 B;  1ULI A;  3EWK A;  2WSC J;  3EN1 A;  3IN6 A;  4HJL A;  3Q1M A;  4QDD A;  1FDI A;  3AEC C;  1G8J B;  1EXI A;  1SQX E;  5BOK A;  3H25 A;  2JO1 A;  1L0N E;  3VMH D;  2YIU C;  4H13 D;  4OGQ B;  3AE4 C;  1NYH A;  1HF9 A;  1VM9 A;  3AEG C;  4H44 C;  3H1J E;  4Y28 J;  2IBZ E;  4HKV A;  4HM1 A;  2XSH A;  3D89 A;  3AE1 C;  1VF5 D;  1IK7 A;  1OW6 A;  2HMJ A;  2MKV A;  2FXP A;  1NTZ E;  1VF5 C;  3AED C;  2D2C D;  2E75 C;  4GDO A;  3Q5R A;  3GF3 A;  2QJK C;  4NB9 D;  2QJP C;  4QDF B;  3S9O A;  1KB9 E;  4P1C H;  2HMM A;  5AEU A;  1ZME C;  1BCC E;  2NVF A;  3CX5 E;  4QUQ A;  1SQV E;  2Q3W A;  1WMK A;  2ZT9 B;  2B24 A;  1EXJ A;  2WQY C;  3VMI D;  4OGQ C;  5M1B A;  2G8Y A;  4HM6 A;  2YVJ B;  3H1L E;  4QDF A;  1OMI A;  3R4Y A;  4QDC A;  4NBG D;  2BMR A;  1KQF B;  4NBB D;  2H89 C;  5CXM A;  3AZC A;  1UUW A;  1S1C X;  3H1I E;  4YTP C;  1KIL E;  1DD3 A;  2NWF A;  4AIV A;  3AE3 C;  1KQG B;  3H1H E;  1R8E A;  1FDO A;  3GMA A;  4HM3 A;  1O7P A;  4TT3 H;  2ZT9 C;  2B1X A;  3GF7 A;  3CXH E;  2FYN C;  4H44 D;  2ZYL A;  4Z1M H;  4NBH D;  1NYK A;  3GL2 A;  1SJG A;  1VCK A;  4NBE D;  2JZA A;  2YFL A;  4XFJ A;  3L75 E;  2E74 B;  1NTM E;  1UUV A;  2E75 D;  4QCK A;  1OW8 A;  1WQL A;  1RQV A;  1O7H A;  2IDB A;  1RFS A;  1NGM B;  2HMK A;  2V7Q J;  3G9R A;  1JM1 A;  1K04 A;  1L0L E;  2WPV B;  4NBF D;  5KKZ C;  4PV1 B;  1RIE A;  3AE6 C;  3GTS A;  1DIP A;  2XSO A;  5HL4 A;  1PIX A;  2NUK A;  3AEF C;  1UIX A;  4P1B H;  1PV3 A;  3N0Q A;  2E4Q A;  3BCC E;  4H0L B;  3FGA D;  3FOU A;  4R4L A;  3CWB E;  2FYU E;  1O7N A;  1KMI Z;  4OGQ D;  3AE5 C;  2NZ2 A;  2WSF J;  4PD4 E;  1YQ4 C;  3EQQ A;  2DE5 D;  3Q3D A;  1MKM A;  3GZX A;  3AEE C;  1O7G A;  2JP3 A;  3B71 A;  4QUR A;  2YFJ A;  4HM7 A;  3SFD C;  4HM8 A;  4NBC D;  2JO6 A;  3L74 E;  2J5U A;  2E74 C;  4RKU J;  2DE7 D;  2HMN A;  1RQU A;  1O7M A;  1EG9 A;  4U3F E;  1SQB E;  4HM5 A;  1ULJ A;  4HM2 A;  4H13 B;  1Q90 C;  2BMO A;  4R4M A;  4HM4 A;  3AEA C;  2NUM A;  3LW5 J;  4PV1 C;  4IL6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...