4H0LD

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
161
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 26
structure length 161
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h0lD02
3GZXA 4HM4A 2NWFA 4NBBD 2Q3WA 2E74D 3CX5E 1SQVE 2JZAA 1PP9E 4QUQA 5KLIC 1L0NE 1BCCE 4QDFA 1O7HA 3GCEA 2YIUC 4HM2A 2NVEA 2B1XA 3C0DA 3L71E 4QUPA 4I7ZC 3CXHE 3N0QA 2NUKA 2YFIA 2E4QA 5HL4A 4HM8A 4HM5A 4QDDA 1RFSA 2QJYC 3VMGD 2ZT9C 4H0LC 1VM9A 2NVFA 4HKVA 4NBAD 2D2CD 4HM0A 4NBGD 4PD4E 2JO6A 2XR8A 2BMQA 1VCKA 2E76D 4HJLA 2E75D 2D2CC 2YVJB 4P1BH 3H1HE 1UUVA 3L74E 2ZYLA 4H44D 2HMKA 4HM6A 5CXMA 3L72E 2HMOA 2HMJA 4NBHD 1SQBE 2E4PA 4PV1C 2HMNA 1SQPE 4NBCD 4OGQD 2BMRA 4HM7A 3GL0A 2FYUE 1P84E 1O7NA 2HMMA 4NB9D 2CKFA 2XSOA 2NVGA 3H1JE 1Q90C 3GTSA 1KB9E 1FQTA 3BCCE 4P1CH 5AEUA 1PPJE 1SQXE 3GL2A 4AAYB 1VF5D 3H1KE 4U3FE 3GB4A 3GOBA 1NDOA 1G8KB 3L70E 1NU1E 3H1IE 1NYKA 2DE7D 2E75C 4OGQC 1NTKE 4NB8D 4EMJB 3D89A 2YFJA 3VCAA 2FYNC 4AIVA 4PV1D 3FOUA 2NUMA 3GZYA 1SQQE 1BE3E 1EG9A 2ZT9D 4H0LD 1G8JB 2DE5D 2YFLA 4NBFD 3VCPA 2E74C 5BOKA 4NBDD 2IBZE 3GKEA 3L73E 3VMID 3EN1A 1SJGA 2BCCE 1ZRTE 1O7MA 2QJKC 4QDFB 4H44C 4QCKA 2A06E 2QJPC 1UUWA 3EQQA 2GBWA 5KKZC 4HM1A 4NBED 2QPZA 4QURA 1EZVE 3DQYA 1KYOE 2I7FA 2GBXA 2XSHA 3VMHD 1ULJA 2B24A 2BMOA 2DE6D 2E76C 1JM1A 3L75E 1L0LE 1ULIA 2YMKA 3CWBE 2HMLA 1O7PA 1WQLA 5KLVE 1O7GA 3TGUE 3GTEA 4H13D 2XRXA 4QDCA 3AZCA 1VF5C 1RIEA 1NTME 1NTZE 4HM3A 4H13C 5AEWA 1O7WA 3H1LE
chains in the Genus database with same CATH superfamily
1KB9D 3CX5E 3A7OA 1YIJP 4QUQA 1VF5B 2YXRB 1O7HA 1VDFA 3GHGA 3L73G 1YTZI 1HJBA 5CCGC 2A45G 1GL2C 2BCCJ 1NU1K 5KLVG 2Q3EA 4PJ0E 3VMXA 1FZGA 2HMNA 3HD7B 1L0ND 1IFNA 4YXWH 3IAOA 3RK2C 4H44B 3L35A 1RF1C 2QM8A 3U1AA 2J5UA 2I1KA 1NU1E 2Y9YA 1SVFA 4WY4C 2N1TC 2E42A 1ZR4A 4DCKA 3CWBD 2B87A 2WT7A 1NO4A 4K35A 1URQC 1OVRA 2WVRA 5KLVJ 3KQGA 2QIWA 4A7PA 2N9YB 3L72J 3TYYA 1BDCA 3RL0D 4HB1A 1T3JA 2NPSC 1L4AD 1NAYA 1KILB 1GU5A 2CK3H 3L71G 2OYHB 2FXPA 2IZ1A 1GL2B 2QJYB 3EFGA 4TT3H 3GG2A 1YQ3C 1KV4A 3CCVP 4IOIH 1AQ5A 4QDCA 1KYOH 2HLOA 4HM3A 1PGOA 3BCCG 1BSHA 1O7WA 1SQQD 3IR9A 3KPEA 2C0XA 4IL6E 2AXTH 3GMAA 2E4QA 3VYIA 3AEGC 4PD4E 4IL6H 3B4SA 5CMZA 4AYCA 5CXMA 5KKZB 2HMJA 1NTKJ 1JO5A 1FZAA 4N3YB 4HM7A 2M5AA 3CC2P 2KNCB 4EOTA 1SP4A 2JR8A 2FXOA 2ITAA 5AVZB 3QH9A 3L74G 1RF1A 5H2FE 3AEEC 2JKVA 1NKZB 1W2BO 2FYNB 1YITP 2KLVA 3CX5I 5AVXB 1LT9B 2H8PD 1S9KE 2DE7D 3CCRP 3D70A 2WSEH 2GUVA 1RE4A 3ABVC 4N78D 1E79H 2RH0A 2C9NY 3BCCJ 3L73E 3GF3A 2AXCA 1O7MA 2FYUJ 3L75D 1GW3A 1FJKA 2KS1B 3RK3D 1VQ7P 2GBWA 2A06G 1KYOD 1J1DB 2E76C 1VQPP 5KAIE 5KLVE 1YJ9P 1WQLA 1FZFA 4JQ0D 3W68A 1KILE 1JMMA 1QEXA 3P32A 3SFDC 3H1HD 3JSVC 2ZYDA 1IFJA 2ZAEB 3SFEC 4Y99C 1IFIA 2NPSD 5E79E 2LXCB 5KAFH 2YIUC 3SWYA 4BRYA 3V6IA 2JWAA 4I7ZC 3V4QA 5KLVK 1RFSA 1OVUA 1BE3J 4N78E 2I8DA 2Y0CA 3U59A 1OW8A 2A06D 1S4XA 3USSA 1FU1A 2HMKA 1CZQA 4C46A 1JY2P 1NTMD 2K1AA 4NBHD 2E76B 3HUSB 1L0LJ 3F89A 2R44A 5AEUA 1VF5D 2PAJA 2FBWC 1KILD 5AW0B 2OYOA 3WU2H 4PV1D 5GTIH 4K3AA 2P2UA 1LT9C 1N7SB 2E75B 3A3YB 1ZRTE 1GK6A 3C1LA 1S5LH 3AE4C 3Q2YA 1U7JA 3V4WA 2JDIH 3A0HH 1NTKK 4YPCA 3AE6C 1U7MA 4H13D 1JTHB 2Q7CA 3RL0C 2Q1KA 3CCJP 1WT6A 1L4AA 2O1JA 1R5SA 3R2PA 3U1CA 5AVRB 2YO2A 2JEEA 2P10A 1HGVA 3TK1A 2NVEA 1KB9I 3HE5B 3AE1C 4QDDA 2AEJA 3Q1MA 2M0BA 1HH0A 1FZBA 2QSIA 3CXHI 3PHLA 2XR8A 2CPBA 1JY2O 5TISH 3NMDA 1JCDA 3TGUG 1SQBE 3GW6A 1ZV8A 1W5CE 3EWKA 3VMZA 1AA0A 1AVOA 1L0LK 5H2FH 3Q3DA 1LTAC 2GM4A 1RHZB 3TDKA 1MKMA 2Q6QA 2O01J 3VP8A 3L71J 2QJKB 2YXQB 4EIJA 4WWIA 4WY4B 3O6QA 1Q86Q 1NH4A 3RL0g 4NPDA 2E74C 1A02F 3EN1A 1HGZA 4Z1MH 3TNUA 3T97B 1JY3P 4H44C 2OARA 1AQTA 1ZOYC 1PP9D 1SQVK 1DD4A 2BCCG 1BCCG 3CWBE 2YMKA 2ZFCA 3L4FA 2E5YA 1SQBJ 1NTZE 1SQPJ 4BRYB 4PV1B 5C39A 3V2RA 2Q3IA 2Q3WA 3MZWB 3CCUP 1N73A 1Y8AA 1L0NE 1BCCE 1DEEG 3CI9A 2IDBA 3G3ZA 3L71E 5HL4A 2QE7H 3IF4A 2NVFA 4HKVA 5K5GB 3KHUA 1ZXGA 1UIIA 2WPRA 2E76D 1OZHA 1X8YA 2D2CC 1SFCC 1KORA 1SQBG 1UUVA 4HM6A 1E5WA 1LGHB 1IFPA 1S72P 1NYHA 3A0BH 2H88C 1J1EC 2YNYA 3GTSA 1KB9E 3BCCE 1YI2P 5AVUB 1SQXE 4C7NA 5AW9B 1WMKA 3AE3C 3L74D 5DJTB 3SWKA 1KTMA 1HVVA 1TU3F 1NTKG 1OXZA 2JWDA 4YXDC 1EG9A 4H0LD 4D6TD 3T97A 3B5ND 1JY3O 3TNUB 1OMIA 1M1JA 2XNXA 3W67A 3P8MC 3KZIH 2QJPC 5AVVB 1T6AA 5CJ0A 2NPSA 3OJAB 3FX0A 3PTZA 2KI7B 2LXBA 2HODB 3GF7A 2R5BA 5B66H 1MZ9A 1OW6A 3AZCA 2ZYGA 3HE4B 5EFWB 3GZXA 3NFQA 2E74D 2GA1A 3SSUA 2I1JA 3R4YA 3JCUH 3L73J 2GUSA 4IFMA 1JCCA 2RN0A 2KSEA 3M9HA 3TF5A 3CXHE 1KN7A 1GL2D 1URQA 2QJYC 2UWJE 3A0HE 5KAFE 2HODA 3EQ2A 3FWLA 1VPCA 2BMQA 2H7HA 2NPSB 4W80A 1BCCJ 2KP8A 1VQNP 5AVTB 1N86A 2MKVA 1VQ6P 1G1JA 2IPPA 4YTPC 1RE4C 2IFMA 1O7NA 1GK4A 1NWQA 1CI6A 1LJ2A 3O6QB 4DJGA 3PP5A 3AE5C 2ZJSE 3AE2C 2AEMA 1XTCC 3VTPC 2OGUA 3C9IA 3BCCD 1N2DC 3RK2B 2V7QH 3AE9C 3VCAA 2HFED 4JF7A 5CCHC 1HF9A 2NUMA 1KFMA 1AJYA 2YFLA 3ITKA 4IFFA 2C0WA 3AECC 3WMM0 2B9BA 1EZVG 2H43A 2A45I 3JCUE 5AW8B 1FOSE 1KYOE 2Z5IA 1IZNB 3SWFA 3VMHD 3HUSA 4I2LC 2IYPA 3HE5A 2YKOA 3AEDC 1QVGO 3M9QA 1R5LA 3L75G 1JY3N 1Q81Q 3B5NC 1N73B 2FFDB 3VMAA 2RKLA 3MUDC 3A2AA 2K88A 1LTTC 2B89A 1KQSO 2Y0DA 3VMGD 1FS0E 4HH2A 3AEFC 1MFTA 5APWA 1VCKA 2K9YA 4H44D 2ZYAA 3P7KA 4U3FD 2FYUG 5AVWB 1FZEA 4OGQD 2XDJA 2R3CA 3CD6P 3Q5PA 2OYHC 1PPJE 1KILC 1X9VA 1MFZA 2M8RA 4W7ZA 4NB8D 4PD4H 1Q7YQ 3E1IA 1EXJA 3FOUA 1SQVG 2ZXEB 1L2PA 3KXDA 2WITA 1G8JB 1NTZJ 3PJSK 2FXMA 4UB6H 2A45H 2BCCE 1NTZD 1CSBA 4QDFB 1T8ZA 5KTBA 2WPQA 2WSEJ 4D6TJ 3C8VA 1RQVA 3H1LG 3I55P 1FDIA 2KB7P 1RIEA 3HD7C 2G8YA 3M0AA 1SQVJ 4GIFA 4H13B 1AVYA 1J2JB 2HG5D 1H88A 5KLIC 2YO3A 1USDA 1QL2A 1P84H 1KD1Q 1NU1G 1WRGA 1T3UA 1SS1A 1GMJA 2KXPB 2CPSA 2KLUA 1NTZG 1LTJA 3G6EP 2WSSH 1SFCA 3A5TA 2E4PA 1SQPE 4JBZA 2BMRA 1MV8A 1SQXG 2N1TA 3V2QA 5CCGD 3L70J 4NB9D 4UB8H 5TJHA 1S3JA 1M1JC 1L0LG 5CJ4A 3MD0A 4U3FE 1NTMG 1NDOA 2XZRA 3TGUD 1IO4A 4ZMDA 4MN4C 4WVZA 2LKMA 1EQ7A 2W6JH 2FYNC 4R4MA 1H0TB 5GTIE 2ZVOB 3VN0A 1KQFB 4NBDD 2BASA 3S9OA 1IFDA 3P8CE 2BEZF 2A06E 3EQQA 4KT0J 4NBED 2KK7A 2W6AA 4QURA 1EZVE 3BRVB 2GBXA 2XSHA 1JM1A 3HE4A 3L37A 3OW2O 4GOEA 1H89A 1URQD 1NTMK 1SFCB 1YBKA 4C7RA 1JM0A 1M56D 1QX8A 2W83C 5APXA 1XTGB 2JZAA 1L0NJ 1GZLA 1P84D 1N7LA 3FWNA 3H32A 1QL1A 3RK3B 1NTZK 3B5NA 2L91A 2D2CD 3S4RA 1VQ4P 1FBMA 3WU2E 3CPWO 1X0TA 3AE8C 2IBZI 2HMOA 4WB4A 4C7NB 2WSCJ 1QVFO 2NVGA 2WSCH 3H1JD 3H1JE 5AW6B 3MTUE 1NGMB 2WTYA 1S9KD 1NKNA 3GL2A 1VQOP 1DEBA 3CXHD 3CX5H 1JY2N 1HBWA 4OGQC 4KHXA 3QWOC 1GW4A 4GODA 1OVVA 3F5HA 1RF1B 1BE3E 1K73Q 2L5GB 4O9BA 5BOKA 3LW5H 1AV1A 3H1KJ 4OH8B 5DJUB 5BU5A 4QCKA 2JO1A 5APTA 1IFMA 1HUCA 1T2KC 3D71A 1VQKP 1YQ4C 4L76A 2XV5A 2B24A 1Y9BA 2MJZA 3L75E 1L0LE 1W2EA 5CCGA 3L72G 1PGPA 1NTME 5E79H 5B5EH 3L73D 1JUNA 4D6TE 2KSJA 1EDJA 4NBBD 2K9JB 1KMIZ 3MGNA 5AW4B 1PGQA 4QDFA 1OIPA 2IFNA 1NJIQ 3M06A 1YTZT 2W27A 3LIEA 2V4HA 2V7QJ 2Q9IA 1M57D 1FZCB 1FJPA 3RGUA 1L4AB 1H0TA 3L74J 3RL0B 3B8EB 3B5NB 2QEXP 2OYHA 1EXIA 2M3BA 3CCQP 4BWNA 3L72E 1FE6A 3KYQA 3GLMA 3CC4P 1LTJC 1G2CB 3OAKA 5AW7B 1NOHA 1KFNA 1EZVI 5APUA 1RE3C 1RH5B 3H25A 4EYYQ 1SQBK 1BCCD 2WQYC 3HD7D 2Y0EA 4M3LA 1SQQE 3ZDMA 2DE5D 1BGYJ 2W90A 3G9RA 3VMID 1M1KQ 4Y28J 3CCMP 4ZKUA 2D2CB 1LTSC 3PRJA 1SLQA 2OQQA 3DQYA 3LW5J 1U57A 3CWBG 4JPZB 1RE3A 1X22A 4L74A 2WSFJ 4CPGA 3CL3D 2XRXA 1FC2C 1QLED 2ZXXA 1LTIC 1S5LE 3D6YA 3H1JG 3CX5D 4PD4D 1SQVE 2P1JA 4I7ZB 5GTHH 3GCEA 1SQPD 4EDFA 2P7JA 2B1XA 2BCCD 3C0DA 5AVSB 2HR3A 4ZKPA 5AVQB 1JB0J 4RJTA 2QA4P 4JYBA 1LWUB 4NPFX 3VOPA 3IFMA 1KYOI 2E74B 1KC8Q 4NBCD 2FYUE 2HMMA 2H89C 2VRSA 1GL2A 4JYCA 4XE5B 4AUWA 4UB8E 1PPJG 2FYZA 2FY8A 2PP6A 4AAYB 1OFCX 4IL6X 2JJLA 3N4XA 1NAFA 3L72D 3GHGC 1NTKE 1Z56A 3IN6A 1PP9J 5AW3B 4W7YA 3RBZA 1S1CX 4NBFD 2ZVNB 1NU1D 3WUUA 1NU1J 1N8RQ 2FFDA 4N6JA 3CXHH 1SFCD 2KOGA 2E43A 3VMYA 2JP3A 1VQ5P 1ULJA 3E7KA 2KNCA 5B66E 3NTNA 5KAIH 1O7PA 2ZT9B 1JEKA 4ASVA 3V2NA 4KJMA 5BVZA 1JNMA 2NWFA 2Q5UA 2WSFH 1RF0A 2FFDC 1RQUA 4R4LA 5L8RJ 1L0NK 1X79B 2KS1A 1SQPK 1HJ0A 1KQGB 1NTMJ 2WPSA 3BVHA 2YFIA 2KIKA 3KZIE 4HM5A 1M90Q 4TLFA 3HRNA 4H0LC 5APQA 1H8AA 4HM0A 2E75D 3CWBJ 4P1BH 3HTKB 1N7SC 3M0DA 1DIPA 3N7NA 3H1HG 5B5EE 3G4SP 4PV1C 1SQQK 1CI6B 1RY3A 4AQRD 2O3JA 1SQXK 4WBAA 3H1KE 2P67A 2WWWA 1G8KB 2C9LY 1M8OB 1FOSF 1ZP0C 4EMJB 1VQLP 4WY4A 1L0LD 4OGQB 2HPCA 1OWAA 5KJ7A 2QRXA 3K5BA 2ZT9D 1K9MQ 2IBZE 2DW3A 2KZJA 2QJKC 1LWUC 2AXTE 5KLVD 1JMBA 1K8AQ 2WZ7A 3H1LJ 3H1JJ 2R5DA 4D6TG 2BMOA 4LGDE 1BGYE 1EDIA 3RK3E 1YHQP 3PLNA 3H6PA 2NZ2A 4Y99B 3FXEA 3KDPB 4HM4A 1LTGC 1LP1B 3JC22 1G2CA 3L70G 4BXLA 2E5TA 3H1KD 2FYUK 2R3SA 2HYNA 3N0QA 2NUKA 1BE3G 1P84I 3UIAA 1VQ8P 2O01N 4NBGD 3CCLP 2YVJB 3H1HE 3L74E 2ZYLA 3M91A 3H32B 4LLHA 2XNDH 3GL0A 1P84E 4LC1A 2J58A 1FDMA 1LP1A 1Q90C 2KZIA 1NTKD 1FQTA 1YJWP 4P1CH 3L70D 2N9BA 3O8ZA 3PH0A 2E75C 1LTJB 2HPCB 2YFJA 4XFJA 2N1TD 1N7SD 2POHA 1PFIA 1J1EB 2M3EA 3G71P 3CLQA 5AW5B 3H1ID 1FDOA 3GHGB 3L71D 3CMEP 1M1JB 3H1IJ 2IZ0A 4HYTB 3E1RA 1VL2A 2IYOA 1HTLC 1L4AC 2QM7A 4ASWA 1CW5A 2I7FA 2WMMA 2DE6D 1ULIA 3AEBC 4GDOA 5BU8B 3TGUJ 1IK7A 3TGUE 4DOJA 2PFXA 1SQXD 3LIDA 2OTLP 3AEAC 1PP9E 1LNQA 1VQ9P 1JOCA 4OVNF 3H1KG 1S5LX 2FYUD 1K05A 3RK2D 4QUPA 3H1IG 1UIXA 2NRGA 1PZQA 2YIUB 1RF0C 4NBAD 1ZW0A 3V2PA 1G1IA 5AVYB 5APSA 5CBOA 1S2EA 1KB9H 4HJGH 4GT1A 2K37A 1EDLA 3Q5RA 3BASA 1SQVD 1M7LA 3EFFK 2J59M 1SQBD 3H1HJ 3GOBA 3AE7C 3L70E 1Q2NA 1PIXA 1NYKA 3MP7B 2G3AA 2OTJP 1GTWA 1AFOA 4NPEA 5CHXA 3GZYA 1R8EA 1GDTA 1GD2E 3VCPA 2P58A 2KYVA 3FXDA 2Y9ZA 2IBZG 1HWTC 3B71A 1UUWA 4HM1A 5KJ7C 3RK3C 3S1KA 4OWFA 1OW7A 2M5AB 2KUBA 3TSIA 4H0LB 2LR2A 3GTEA 3VP9A 1VF5C 1A02J 3OA7A 3H1LE 3M9BA 1PPJD 3A0BE 2XU6A 3V5BA 1QGKB 1EC5A 1NHLA 4L73A 4XA4A 3CCSP 2QVAA 1FZCC 2YKQA 1ZRTD 1N7SA 1GU4A 1N73C 4HM8A 3MUDA 2ZT9C 5APYA 2B88A 4IFDK 4HJLA 5AW1B 3CC7P 4EI2A 1USEA 1K04A 1LT9A 3L36A 4B86A 2BEQD 2IBZD 5CCHD 4WY4D 5CBNA 2CKFA 2XKMA 2XSOA 3NXSA 2Z4EA 3CMAP 3M0DC 4RESB 3I5CA 4U3FG 3II6A 1YJNP 4I1LA 3GB4A 1JTHA 5TISE 1ZLLA 3H1IE 2SPZA 1KQLA 3MIWA 2W8ZA 3FGAD 2B87B 2WT7B 3CCEP 2YKPA 1URQB 1Y47A 3Q5SA 4I6MC 1Q82Q 2N1TB 1BGYG 3HUSC 1IK9A 1IJDB 2O01H 2W6BA 2QPZA 1BGYD 1BE3D 2OTKE 1LWUA 1ZMEC 4UB6E 5AW2B 4ZNCA 3BRTB 3HD7A 4GKGA 1O7GA 4L75A 1FAVA 4DT0A 5APVA 5KLIB 2IX7C 4H13C 4RKUJ 1T2KD 1KILA 1VQMP 1LT1A 1PL5A 4HM2A 5KJ7D 3WUTA 4PD4I 2FKWB 1PV3A 1VM9A 2K9JA 2JO6A 1FZCA 1DH3A 2RMZA 1PP9G 1OX3A 1J1DC 3P8CD 1BSNA 2R32A 2PGDA 2K3RA 2QG4A 1L0NG 4PJ0H 2QJPB 1SQQG 3RBXA 3BATA 1SQQJ 2O1KA 1IC2A 4U3FJ 3D6ZA 2OYIB 1SQXJ 1MUUA 1DD3A 4GOFA 3D89A 1KZUB 4HKZH 4AIVA 1NVOA 3L75J 5M1BA 1D7MA 1EZVD 5GTHE 3H1LD 1ZN5A 3GKEA 2OYIA 2PRRA 1SJGA 1EDKA 1Q90D 2WPVB 1SQPG 1ZR2A 4RO0A 2OYIC 5KKZC 4U7JA 1LTBC 4QMAA 1YYCA 4DZOA 5CCHA 2HMLA 2Z5HA 2YMYA 3MHVA 1DX7A 1BDDA 2AEFA 3WUVA 3HTKA 5AEWA 1PGJA 3I56P
chains in the Genus database with same CATH topology
4HM4A 2Q3WA 3CX5E 2JZAA 4QUQA 1L0NE 1VF5B 1BCCE 1O7HA 2IDBA 3L71E 3N0QA 2NUKA 5HL4A 2NVFA 4HKVA 2D2CD 4NBGD 2E76D 2D2CC 2YVJB 1KORA 3H1HE 1UUVA 3L74E 2ZYLA 3AE8C 4HM6A 2HMOA 2HMNA 2WSCJ 3GL0A 1NYHA 1P84E 3IAOA 2H88C 2NVGA 3H1JE 4H44B 1Q90C 3GTSA 1NGMB 1KB9E 1FQTA 3BCCE 4P1CH 1SQXE 2J5UA 3GL2A 1WMKA 3AE3C 1NU1E 2E75C 4OGQC 1KTMA 1TU3F 2YFJA 4XFJA 4YXDC 1BE3E 1EG9A 4H0LD 2QIWA 5BOKA 1FDOA 1OMIA 4QCKA 2QJPC 2JO1A 1VL2A 3D71A 2FXPA 2I7FA 1YQ4C 4TT3H 2B24A 1Y9BA 2DE6D 3L75E 1L0LE 1ULIA 3GF7A 1YQ3C 3AEBC 4GDOA 1IK7A 1OW6A 3TGUE 4QDCA 3AZCA 1NTME 4HM3A 1O7WA 3GZXA 4NBBD 2E74D 1KMIZ 3AEAC 3R4YA 1PP9E 4QDFA 1S5LX 1K05A 4QUPA 3CXHE 3GMAA 2E4QA 1UIXA 2V7QJ 2QJYC 4NBAD 3AEGC 4PD4E 2BMQA 1EXIA 5CXMA 3L72E 2HMJA 2MKVA 4YTPC 4HM7A 1O7NA 3GLMA 3Q5RA 3AEEC 3AE5C 3H25A 3AE2C 3GOBA 3AE7C 3L70E 1PIXA 1NYKA 2DE7D 2G3AA 3D70A 2WQYC 3AE9C 3VCAA 3ABVC 1HF9A 2NUMA 3GZYA 1SQQE 1R8EA 1AJYA 2YFLA 2DE5D 3VCPA 3L73E 3G9RA 3VMID 3GF3A 4Y28J 1O7MA 2D2CB 3AECC 3B71A 1UUWA 2OQQA 2GBWA 4HM1A 3DQYA 1KYOE 3LW5J 1U57A 3VMHD 1OW7A 2E76C 5KLVE 1WQLA 2WSFJ 4H0LB 3GTEA 2XRXA 1VF5C 1KILE 3AEDC 3SFDC 3H1LE 3D6YA 3SFEC 1SQVE 4I7ZB 3GCEA 2YIUC 2B1XA 3C0DA 4I7ZC 4HM8A 1RFSA 3VMGD 2ZT9C 1JB0J 3AEFC 1VCKA 4HJLA 2K9YA 1OW8A 4H44D 2HMKA 1K04A 2E74B 4NBHD 2BEQD 2E76B 4NBCD 4OGQD 2FYUE 2HMMA 2H89C 2CKFA 2XSOA 3Q5PA 5AEUA 1PPJE 4AAYB 1VF5D 2FBWC 3GB4A 4IL6X 3H1IE 1NTKE 4NB8D 3IN6A 3FGAD 1EXJA 4PV1D 3FOUA 3Q5SA 1G8JB 1S1CX 4NBFD 2E75B 2BCCE 1ZRTE 4QDFB 3AE4C 3Q2YA 2WSEJ 2QPZA 3C8VA 1RQVA 1ZMEC 2JP3A 1ULJA 1O7PA 3AE6C 1O7GA 2ZT9B 4H13D 1FDIA 1RIEA 2G8YA 4H13C 2NWFA 4RKUJ 1RQUA 4R4LA 5L8RJ 4H13B 5KLIC 1HJ0A 1KQGB 1PL5A 2P10A 4HM2A 2NVEA 2YFIA 3AE1C 4HM5A 4QDDA 1PV3A 4H0LC 1VM9A 3Q1MA 4HM0A 1GMJA 2QSIA 2JO6A 2XR8A 2E75D 4P1BH 1DIPA 1SQBE 2E4PA 4PV1C 1SQPE 3EWKA 2BMRA 4NB9D 3Q3DA 1MKMA 3D6ZA 3H1KE 4U3FE 2O01J 1NDOA 1G8KB 1DD3A 1ZP0C 4EMJB 3D89A 4OGQB 2FYNC 3O6QA 4R4MA 4AIVA 5M1BA 3RL0g 2ZT9D 2E74C 1KQFB 4NBDD 2IBZE 3GKEA 3EN1A 1SJGA 3S9OA 4Z1MH 1Q90D 2WPVB 2QJKC 2BEZF 3T97B 4H44C 2A06E 5KKZC 3EQQA 4KT0J 4U7JA 4NBED 1ZOYC 4QURA 1EZVE 2GBXA 2XSHA 1DD4A 2BMOA 1JM1A 3CWBE 2YMKA 2HMLA 3RK3E 1NTZE 4PV1B 2NZ2A 5AEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZX A;  4HM4 A;  2NWF A;  4NBB D;  2Q3W A;  2E74 D;  3CX5 E;  1SQV E;  2JZA A;  1PP9 E;  4QUQ A;  5KLI C;  1L0N E;  1BCC E;  4QDF A;  1O7H A;  3GCE A;  2YIU C;  4HM2 A;  2NVE A;  2B1X A;  3C0D A;  3L71 E;  4QUP A;  4I7Z C;  3CXH E;  3N0Q A;  2NUK A;  2YFI A;  2E4Q A;  5HL4 A;  4HM8 A;  4HM5 A;  4QDD A;  1RFS A;  2QJY C;  3VMG D;  2ZT9 C;  4H0L C;  1VM9 A;  2NVF A;  4HKV A;  4NBA D;  2D2C D;  4HM0 A;  4NBG D;  4PD4 E;  2JO6 A;  2XR8 A;  2BMQ A;  1VCK A;  2E76 D;  4HJL A;  2E75 D;  2D2C C;  2YVJ B;  4P1B H;  3H1H E;  1UUV A;  3L74 E;  2ZYL A;  4H44 D;  2HMK A;  4HM6 A;  5CXM A;  3L72 E;  2HMO A;  2HMJ A;  4NBH D;  1SQB E;  2E4P A;  4PV1 C;  2HMN A;  1SQP E;  4NBC D;  4OGQ D;  2BMR A;  4HM7 A;  3GL0 A;  2FYU E;  1P84 E;  1O7N A;  2HMM A;  4NB9 D;  2CKF A;  2XSO A;  2NVG A;  3H1J E;  1Q90 C;  3GTS A;  1KB9 E;  1FQT A;  3BCC E;  4P1C H;  5AEU A;  1PPJ E;  1SQX E;  3GL2 A;  4AAY B;  1VF5 D;  3H1K E;  4U3F E;  3GB4 A;  3GOB A;  1NDO A;  1G8K B;  3L70 E;  1NU1 E;  3H1I E;  1NYK A;  2DE7 D;  2E75 C;  4OGQ C;  1NTK E;  4NB8 D;  4EMJ B;  3D89 A;  2YFJ A;  3VCA A;  2FYN C;  4AIV A;  4PV1 D;  3FOU A;  2NUM A;  3GZY A;  1SQQ E;  1BE3 E;  1EG9 A;  2ZT9 D;  4H0L D;  1G8J B;  2DE5 D;  2YFL A;  4NBF D;  3VCP A;  2E74 C;  5BOK A;  4NBD D;  2IBZ E;  3GKE A;  3L73 E;  3VMI D;  3EN1 A;  1SJG A;  2BCC E;  1ZRT E;  1O7M A;  2QJK C;  4QDF B;  4H44 C;  4QCK A;  2A06 E;  2QJP C;  1UUW A;  3EQQ A;  2GBW A;  5KKZ C;  4HM1 A;  4NBE D;  2QPZ A;  4QUR A;  1EZV E;  3DQY A;  1KYO E;  2I7F A;  2GBX A;  2XSH A;  3VMH D;  1ULJ A;  2B24 A;  2BMO A;  2DE6 D;  2E76 C;  1JM1 A;  3L75 E;  1L0L E;  1ULI A;  2YMK A;  3CWB E;  2HML A;  1O7P A;  1WQL A;  5KLV E;  1O7G A;  3TGU E;  3GTE A;  4H13 D;  2XRX A;  4QDC A;  3AZC A;  1VF5 C;  1RIE A;  1NTM E;  1NTZ E;  4HM3 A;  4H13 C;  5AEW A;  1O7W A;  3H1L E; 
#chains in the Genus database with same CATH topology
 1KB9 D;  3CX5 E;  3A7O A;  1YIJ P;  4QUQ A;  1VF5 B;  2YXR B;  1O7H A;  1VDF A;  3GHG A;  3L73 G;  1YTZ I;  1HJB A;  5CCG C;  2A45 G;  1GL2 C;  2BCC J;  1NU1 K;  5KLV G;  2Q3E A;  4PJ0 E;  3VMX A;  1FZG A;  2HMN A;  3HD7 B;  1L0N D;  1IFN A;  4YXW H;  3IAO A;  3RK2 C;  4H44 B;  3L35 A;  1RF1 C;  2QM8 A;  3U1A A;  2J5U A;  2I1K A;  1NU1 E;  2Y9Y A;  1SVF A;  4WY4 C;  2N1T C;  2E42 A;  1ZR4 A;  4DCK A;  3CWB D;  2B87 A;  2WT7 A;  1NO4 A;  4K35 A;  1URQ C;  1OVR A;  2WVR A;  5KLV J;  3KQG A;  2QIW A;  4A7P A;  2N9Y B;  3L72 J;  3TYY A;  1BDC A;  3RL0 D;  4HB1 A;  1T3J A;  2NPS C;  1L4A D;  1NAY A;  1KIL B;  1GU5 A;  2CK3 H;  3L71 G;  2OYH B;  2FXP A;  2IZ1 A;  1GL2 B;  2QJY B;  3EFG A;  4TT3 H;  3GG2 A;  1YQ3 C;  1KV4 A;  3CCV P;  4IOI H;  1AQ5 A;  4QDC A;  1KYO H;  2HLO A;  4HM3 A;  1PGO A;  3BCC G;  1BSH A;  1O7W A;  1SQQ D;  3IR9 A;  3KPE A;  2C0X A;  4IL6 E;  2AXT H;  3GMA A;  2E4Q A;  3VYI A;  3AEG C;  4PD4 E;  4IL6 H;  3B4S A;  5CMZ A;  4AYC A;  5CXM A;  5KKZ B;  2HMJ A;  1NTK J;  1JO5 A;  1FZA A;  4N3Y B;  4HM7 A;  2M5A A;  3CC2 P;  2KNC B;  4EOT A;  1SP4 A;  2JR8 A;  2FXO A;  2ITA A;  5AVZ B;  3QH9 A;  3L74 G;  1RF1 A;  5H2F E;  3AEE C;  2JKV A;  1NKZ B;  1W2B O;  2FYN B;  1YIT P;  2KLV A;  3CX5 I;  5AVX B;  1LT9 B;  2H8P D;  1S9K E;  2DE7 D;  3CCR P;  3D70 A;  2WSE H;  2GUV A;  1RE4 A;  3ABV C;  4N78 D;  1E79 H;  2RH0 A;  2C9N Y;  3BCC J;  3L73 E;  3GF3 A;  2AXC A;  1O7M A;  2FYU J;  3L75 D;  1GW3 A;  1FJK A;  2KS1 B;  3RK3 D;  1VQ7 P;  2GBW A;  2A06 G;  1KYO D;  1J1D B;  2E76 C;  1VQP P;  5KAI E;  5KLV E;  1YJ9 P;  1WQL A;  1FZF A;  4JQ0 D;  3W68 A;  1KIL E;  1JMM A;  1QEX A;  3P32 A;  3SFD C;  3H1H D;  3JSV C;  2ZYD A;  1IFJ A;  2ZAE B;  3SFE C;  4Y99 C;  1IFI A;  2NPS D;  5E79 E;  2LXC B;  5KAF H;  2YIU C;  3SWY A;  4BRY A;  3V6I A;  2JWA A;  4I7Z C;  3V4Q A;  5KLV K;  1RFS A;  1OVU A;  1BE3 J;  4N78 E;  2I8D A;  2Y0C A;  3U59 A;  1OW8 A;  2A06 D;  1S4X A;  3USS A;  1FU1 A;  2HMK A;  1CZQ A;  4C46 A;  1JY2 P;  1NTM D;  2K1A A;  4NBH D;  2E76 B;  3HUS B;  1L0L J;  3F89 A;  2R44 A;  5AEU A;  1VF5 D;  2PAJ A;  2FBW C;  1KIL D;  5AW0 B;  2OYO A;  3WU2 H;  4PV1 D;  5GTI H;  4K3A A;  2P2U A;  1LT9 C;  1N7S B;  2E75 B;  3A3Y B;  1ZRT E;  1GK6 A;  3C1L A;  1S5L H;  3AE4 C;  3Q2Y A;  1U7J A;  3V4W A;  2JDI H;  3A0H H;  1NTK K;  4YPC A;  3AE6 C;  1U7M A;  4H13 D;  1JTH B;  2Q7C A;  3RL0 C;  2Q1K A;  3CCJ P;  1WT6 A;  1L4A A;  2O1J A;  1R5S A;  3R2P A;  3U1C A;  5AVR B;  2YO2 A;  2JEE A;  2P10 A;  1HGV A;  3TK1 A;  2NVE A;  1KB9 I;  3HE5 B;  3AE1 C;  4QDD A;  2AEJ A;  3Q1M A;  2M0B A;  1HH0 A;  1FZB A;  2QSI A;  3CXH I;  3PHL A;  2XR8 A;  2CPB A;  1JY2 O;  5TIS H;  3NMD A;  1JCD A;  3TGU G;  1SQB E;  3GW6 A;  1ZV8 A;  1W5C E;  3EWK A;  3VMZ A;  1AA0 A;  1AVO A;  1L0L K;  5H2F H;  3Q3D A;  1LTA C;  2GM4 A;  1RHZ B;  3TDK A;  1MKM A;  2Q6Q A;  2O01 J;  3VP8 A;  3L71 J;  2QJK B;  2YXQ B;  4EIJ A;  4WWI A;  4WY4 B;  3O6Q A;  1Q86 Q;  1NH4 A;  3RL0 g;  4NPD A;  2E74 C;  1A02 F;  3EN1 A;  1HGZ A;  4Z1M H;  3TNU A;  3T97 B;  1JY3 P;  4H44 C;  2OAR A;  1AQT A;  1ZOY C;  1PP9 D;  1SQV K;  1DD4 A;  2BCC G;  1BCC G;  3CWB E;  2YMK A;  2ZFC A;  3L4F A;  2E5Y A;  1SQB J;  1NTZ E;  1SQP J;  4BRY B;  4PV1 B;  5C39 A;  3V2R A;  2Q3I A;  2Q3W A;  3MZW B;  3CCU P;  1N73 A;  1Y8A A;  1L0N E;  1BCC E;  1DEE G;  3CI9 A;  2IDB A;  3G3Z A;  3L71 E;  5HL4 A;  2QE7 H;  3IF4 A;  2NVF A;  4HKV A;  5K5G B;  3KHU A;  1ZXG A;  1UII A;  2WPR A;  2E76 D;  1OZH A;  1X8Y A;  2D2C C;  1SFC C;  1KOR A;  1SQB G;  1UUV A;  4HM6 A;  1E5W A;  1LGH B;  1IFP A;  1S72 P;  1NYH A;  3A0B H;  2H88 C;  1J1E C;  2YNY A;  3GTS A;  1KB9 E;  3BCC E;  1YI2 P;  5AVU B;  1SQX E;  4C7N A;  5AW9 B;  1WMK A;  3AE3 C;  3L74 D;  5DJT B;  3SWK A;  1KTM A;  1HVV A;  1TU3 F;  1NTK G;  1OXZ A;  2JWD A;  4YXD C;  1EG9 A;  4H0L D;  4D6T D;  3T97 A;  3B5N D;  1JY3 O;  3TNU B;  1OMI A;  1M1J A;  2XNX A;  3W67 A;  3P8M C;  3KZI H;  2QJP C;  5AVV B;  1T6A A;  5CJ0 A;  2NPS A;  3OJA B;  3FX0 A;  3PTZ A;  2KI7 B;  2LXB A;  2HOD B;  3GF7 A;  2R5B A;  5B66 H;  1MZ9 A;  1OW6 A;  3AZC A;  2ZYG A;  3HE4 B;  5EFW B;  3GZX A;  3NFQ A;  2E74 D;  2GA1 A;  3SSU A;  2I1J A;  3R4Y A;  3JCU H;  3L73 J;  2GUS A;  4IFM A;  1JCC A;  2RN0 A;  2KSE A;  3M9H A;  3TF5 A;  3CXH E;  1KN7 A;  1GL2 D;  1URQ A;  2QJY C;  2UWJ E;  3A0H E;  5KAF E;  2HOD A;  3EQ2 A;  3FWL A;  1VPC A;  2BMQ A;  2H7H A;  2NPS B;  4W80 A;  1BCC J;  2KP8 A;  1VQN P;  5AVT B;  1N86 A;  2MKV A;  1VQ6 P;  1G1J A;  2IPP A;  4YTP C;  1RE4 C;  2IFM A;  1O7N A;  1GK4 A;  1NWQ A;  1CI6 A;  1LJ2 A;  3O6Q B;  4DJG A;  3PP5 A;  3AE5 C;  2ZJS E;  3AE2 C;  2AEM A;  1XTC C;  3VTP C;  2OGU A;  3C9I A;  3BCC D;  1N2D C;  3RK2 B;  2V7Q H;  3AE9 C;  3VCA A;  2HFE D;  4JF7 A;  5CCH C;  1HF9 A;  2NUM A;  1KFM A;  1AJY A;  2YFL A;  3ITK A;  4IFF A;  2C0W A;  3AEC C;  3WMM 0;  2B9B A;  1EZV G;  2H43 A;  2A45 I;  3JCU E;  5AW8 B;  1FOS E;  1KYO E;  2Z5I A;  1IZN B;  3SWF A;  3VMH D;  3HUS A;  4I2L C;  2IYP A;  3HE5 A;  2YKO A;  3AED C;  1QVG O;  3M9Q A;  1R5L A;  3L75 G;  1JY3 N;  1Q81 Q;  3B5N C;  1N73 B;  2FFD B;  3VMA A;  2RKL A;  3MUD C;  3A2A A;  2K88 A;  1LTT C;  2B89 A;  1KQS O;  2Y0D A;  3VMG D;  1FS0 E;  4HH2 A;  3AEF C;  1MFT A;  5APW A;  1VCK A;  2K9Y A;  4H44 D;  2ZYA A;  3P7K A;  4U3F D;  2FYU G;  5AVW B;  1FZE A;  4OGQ D;  2XDJ A;  2R3C A;  3CD6 P;  3Q5P A;  2OYH C;  1PPJ E;  1KIL C;  1X9V A;  1MFZ A;  2M8R A;  4W7Z A;  4NB8 D;  4PD4 H;  1Q7Y Q;  3E1I A;  1EXJ A;  3FOU A;  1SQV G;  2ZXE B;  1L2P A;  3KXD A;  2WIT A;  1G8J B;  1NTZ J;  3PJS K;  2FXM A;  4UB6 H;  2A45 H;  2BCC E;  1NTZ D;  1CSB A;  4QDF B;  1T8Z A;  5KTB A;  2WPQ A;  2WSE J;  4D6T J;  3C8V A;  1RQV A;  3H1L G;  3I55 P;  1FDI A;  2KB7 P;  1RIE A;  3HD7 C;  2G8Y A;  3M0A A;  1SQV J;  4GIF A;  4H13 B;  1AVY A;  1J2J B;  2HG5 D;  1H88 A;  5KLI C;  2YO3 A;  1USD A;  1QL2 A;  1P84 H;  1KD1 Q;  1NU1 G;  1WRG A;  1T3U A;  1SS1 A;  1GMJ A;  2KXP B;  2CPS A;  2KLU A;  1NTZ G;  1LTJ A;  3G6E P;  2WSS H;  1SFC A;  3A5T A;  2E4P A;  1SQP E;  4JBZ A;  2BMR A;  1MV8 A;  1SQX G;  2N1T A;  3V2Q A;  5CCG D;  3L70 J;  4NB9 D;  4UB8 H;  5TJH A;  1S3J A;  1M1J C;  1L0L G;  5CJ4 A;  3MD0 A;  4U3F E;  1NTM G;  1NDO A;  2XZR A;  3TGU D;  1IO4 A;  4ZMD A;  4MN4 C;  4WVZ A;  2LKM A;  1EQ7 A;  2W6J H;  2FYN C;  4R4M A;  1H0T B;  5GTI E;  2ZVO B;  3VN0 A;  1KQF B;  4NBD D;  2BAS A;  3S9O A;  1IFD A;  3P8C E;  2BEZ F;  2A06 E;  3EQQ A;  4KT0 J;  4NBE D;  2KK7 A;  2W6A A;  4QUR A;  1EZV E;  3BRV B;  2GBX A;  2XSH A;  1JM1 A;  3HE4 A;  3L37 A;  3OW2 O;  4GOE A;  1H89 A;  1URQ D;  1NTM K;  1SFC B;  1YBK A;  4C7R A;  1JM0 A;  1M56 D;  1QX8 A;  2W83 C;  5APX A;  1XTG B;  2JZA A;  1L0N J;  1GZL A;  1P84 D;  1N7L A;  3FWN A;  3H32 A;  1QL1 A;  3RK3 B;  1NTZ K;  3B5N A;  2L91 A;  2D2C D;  3S4R A;  1VQ4 P;  1FBM A;  3WU2 E;  3CPW O;  1X0T A;  3AE8 C;  2IBZ I;  2HMO A;  4WB4 A;  4C7N B;  2WSC J;  1QVF O;  2NVG A;  2WSC H;  3H1J D;  3H1J E;  5AW6 B;  3MTU E;  1NGM B;  2WTY A;  1S9K D;  1NKN A;  3GL2 A;  1VQO P;  1DEB A;  3CXH D;  3CX5 H;  1JY2 N;  1HBW A;  4OGQ C;  4KHX A;  3QWO C;  1GW4 A;  4GOD A;  1OVV A;  3F5H A;  1RF1 B;  1BE3 E;  1K73 Q;  2L5G B;  4O9B A;  5BOK A;  3LW5 H;  1AV1 A;  3H1K J;  4OH8 B;  5DJU B;  5BU5 A;  4QCK A;  2JO1 A;  5APT A;  1IFM A;  1HUC A;  1T2K C;  3D71 A;  1VQK P;  1YQ4 C;  4L76 A;  2XV5 A;  2B24 A;  1Y9B A;  2MJZ A;  3L75 E;  1L0L E;  1W2E A;  5CCG A;  3L72 G;  1PGP A;  1NTM E;  5E79 H;  5B5E H;  3L73 D;  1JUN A;  4D6T E;  2KSJ A;  1EDJ A;  4NBB D;  2K9J B;  1KMI Z;  3MGN A;  5AW4 B;  1PGQ A;  4QDF A;  1OIP A;  2IFN A;  1NJI Q;  3M06 A;  1YTZ T;  2W27 A;  3LIE A;  2V4H A;  2V7Q J;  2Q9I A;  1M57 D;  1FZC B;  1FJP A;  3RGU A;  1L4A B;  1H0T A;  3L74 J;  3RL0 B;  3B8E B;  3B5N B;  2QEX P;  2OYH A;  1EXI A;  2M3B A;  3CCQ P;  4BWN A;  3L72 E;  1FE6 A;  3KYQ A;  3GLM A;  3CC4 P;  1LTJ C;  1G2C B;  3OAK A;  5AW7 B;  1NOH A;  1KFN A;  1EZV I;  5APU A;  1RE3 C;  1RH5 B;  3H25 A;  4EYY Q;  1SQB K;  1BCC D;  2WQY C;  3HD7 D;  2Y0E A;  4M3L A;  1SQQ E;  3ZDM A;  2DE5 D;  1BGY J;  2W90 A;  3G9R A;  3VMI D;  1M1K Q;  4Y28 J;  3CCM P;  4ZKU A;  2D2C B;  1LTS C;  3PRJ A;  1SLQ A;  2OQQ A;  3DQY A;  3LW5 J;  1U57 A;  3CWB G;  4JPZ B;  1RE3 A;  1X22 A;  4L74 A;  2WSF J;  4CPG A;  3CL3 D;  2XRX A;  1FC2 C;  1QLE D;  2ZXX A;  1LTI C;  1S5L E;  3D6Y A;  3H1J G;  3CX5 D;  4PD4 D;  1SQV E;  2P1J A;  4I7Z B;  5GTH H;  3GCE A;  1SQP D;  4EDF A;  2P7J A;  2B1X A;  2BCC D;  3C0D A;  5AVS B;  2HR3 A;  4ZKP A;  5AVQ B;  1JB0 J;  4RJT A;  2QA4 P;  4JYB A;  1LWU B;  4NPF X;  3VOP A;  3IFM A;  1KYO I;  2E74 B;  1KC8 Q;  4NBC D;  2FYU E;  2HMM A;  2H89 C;  2VRS A;  1GL2 A;  4JYC A;  4XE5 B;  4AUW A;  4UB8 E;  1PPJ G;  2FYZ A;  2FY8 A;  2PP6 A;  4AAY B;  1OFC X;  4IL6 X;  2JJL A;  3N4X A;  1NAF A;  3L72 D;  3GHG C;  1NTK E;  1Z56 A;  3IN6 A;  1PP9 J;  5AW3 B;  4W7Y A;  3RBZ A;  1S1C X;  4NBF D;  2ZVN B;  1NU1 D;  3WUU A;  1NU1 J;  1N8R Q;  2FFD A;  4N6J A;  3CXH H;  1SFC D;  2KOG A;  2E43 A;  3VMY A;  2JP3 A;  1VQ5 P;  1ULJ A;  3E7K A;  2KNC A;  5B66 E;  3NTN A;  5KAI H;  1O7P A;  2ZT9 B;  1JEK A;  4ASV A;  3V2N A;  4KJM A;  5BVZ A;  1JNM A;  2NWF A;  2Q5U A;  2WSF H;  1RF0 A;  2FFD C;  1RQU A;  4R4L A;  5L8R J;  1L0N K;  1X79 B;  2KS1 A;  1SQP K;  1HJ0 A;  1KQG B;  1NTM J;  2WPS A;  3BVH A;  2YFI A;  2KIK A;  3KZI E;  4HM5 A;  1M90 Q;  4TLF A;  3HRN A;  4H0L C;  5APQ A;  1H8A A;  4HM0 A;  2E75 D;  3CWB J;  4P1B H;  3HTK B;  1N7S C;  3M0D A;  1DIP A;  3N7N A;  3H1H G;  5B5E E;  3G4S P;  4PV1 C;  1SQQ K;  1CI6 B;  1RY3 A;  4AQR D;  2O3J A;  1SQX K;  4WBA A;  3H1K E;  2P67 A;  2WWW A;  1G8K B;  2C9L Y;  1M8O B;  1FOS F;  1ZP0 C;  4EMJ B;  1VQL P;  4WY4 A;  1L0L D;  4OGQ B;  2HPC A;  1OWA A;  5KJ7 A;  2QRX A;  3K5B A;  2ZT9 D;  1K9M Q;  2IBZ E;  2DW3 A;  2KZJ A;  2QJK C;  1LWU C;  2AXT E;  5KLV D;  1JMB A;  1K8A Q;  2WZ7 A;  3H1L J;  3H1J J;  2R5D A;  4D6T G;  2BMO A;  4LGD E;  1BGY E;  1EDI A;  3RK3 E;  1YHQ P;  3PLN A;  3H6P A;  2NZ2 A;  4Y99 B;  3FXE A;  3KDP B;  4HM4 A;  1LTG C;  1LP1 B;  3JC2 2;  1G2C A;  3L70 G;  4BXL A;  2E5T A;  3H1K D;  2FYU K;  2R3S A;  2HYN A;  3N0Q A;  2NUK A;  1BE3 G;  1P84 I;  3UIA A;  1VQ8 P;  2O01 N;  4NBG D;  3CCL P;  2YVJ B;  3H1H E;  3L74 E;  2ZYL A;  3M91 A;  3H32 B;  4LLH A;  2XND H;  3GL0 A;  1P84 E;  4LC1 A;  2J58 A;  1FDM A;  1LP1 A;  1Q90 C;  2KZI A;  1NTK D;  1FQT A;  1YJW P;  4P1C H;  3L70 D;  2N9B A;  3O8Z A;  3PH0 A;  2E75 C;  1LTJ B;  2HPC B;  2YFJ A;  4XFJ A;  2N1T D;  1N7S D;  2POH A;  1PFI A;  1J1E B;  2M3E A;  3G71 P;  3CLQ A;  5AW5 B;  3H1I D;  1FDO A;  3GHG B;  3L71 D;  3CME P;  1M1J B;  3H1I J;  2IZ0 A;  4HYT B;  3E1R A;  1VL2 A;  2IYO A;  1HTL C;  1L4A C;  2QM7 A;  4ASW A;  1CW5 A;  2I7F A;  2WMM A;  2DE6 D;  1ULI A;  3AEB C;  4GDO A;  5BU8 B;  3TGU J;  1IK7 A;  3TGU E;  4DOJ A;  2PFX A;  1SQX D;  3LID A;  2OTL P;  3AEA C;  1PP9 E;  1LNQ A;  1VQ9 P;  1JOC A;  4OVN F;  3H1K G;  1S5L X;  2FYU D;  1K05 A;  3RK2 D;  4QUP A;  3H1I G;  1UIX A;  2NRG A;  1PZQ A;  2YIU B;  1RF0 C;  4NBA D;  1ZW0 A;  3V2P A;  1G1I A;  5AVY B;  5APS A;  5CBO A;  1S2E A;  1KB9 H;  4HJG H;  4GT1 A;  2K37 A;  1EDL A;  3Q5R A;  3BAS A;  1SQV D;  1M7L A;  3EFF K;  2J59 M;  1SQB D;  3H1H J;  3GOB A;  3AE7 C;  3L70 E;  1Q2N A;  1PIX A;  1NYK A;  3MP7 B;  2G3A A;  2OTJ P;  1GTW A;  1AFO A;  4NPE A;  5CHX A;  3GZY A;  1R8E A;  1GDT A;  1GD2 E;  3VCP A;  2P58 A;  2KYV A;  3FXD A;  2Y9Z A;  2IBZ G;  1HWT C;  3B71 A;  1UUW A;  4HM1 A;  5KJ7 C;  3RK3 C;  3S1K A;  4OWF A;  1OW7 A;  2M5A B;  2KUB A;  3TSI A;  4H0L B;  2LR2 A;  3GTE A;  3VP9 A;  1VF5 C;  1A02 J;  3OA7 A;  3H1L E;  3M9B A;  1PPJ D;  3A0B E;  2XU6 A;  3V5B A;  1QGK B;  1EC5 A;  1NHL A;  4L73 A;  4XA4 A;  3CCS P;  2QVA A;  1FZC C;  2YKQ A;  1ZRT D;  1N7S A;  1GU4 A;  1N73 C;  4HM8 A;  3MUD A;  2ZT9 C;  5APY A;  2B88 A;  4IFD K;  4HJL A;  5AW1 B;  3CC7 P;  4EI2 A;  1USE A;  1K04 A;  1LT9 A;  3L36 A;  4B86 A;  2BEQ D;  2IBZ D;  5CCH D;  4WY4 D;  5CBN A;  2CKF A;  2XKM A;  2XSO A;  3NXS A;  2Z4E A;  3CMA P;  3M0D C;  4RES B;  3I5C A;  4U3F G;  3II6 A;  1YJN P;  4I1L A;  3GB4 A;  1JTH A;  5TIS E;  1ZLL A;  3H1I E;  2SPZ A;  1KQL A;  3MIW A;  2W8Z A;  3FGA D;  2B87 B;  2WT7 B;  3CCE P;  2YKP A;  1URQ B;  1Y47 A;  3Q5S A;  4I6M C;  1Q82 Q;  2N1T B;  1BGY G;  3HUS C;  1IK9 A;  1IJD B;  2O01 H;  2W6B A;  2QPZ A;  1BGY D;  1BE3 D;  2OTK E;  1LWU A;  1ZME C;  4UB6 E;  5AW2 B;  4ZNC A;  3BRT B;  3HD7 A;  4GKG A;  1O7G A;  4L75 A;  1FAV A;  4DT0 A;  5APV A;  5KLI B;  2IX7 C;  4H13 C;  4RKU J;  1T2K D;  1KIL A;  1VQM P;  1LT1 A;  1PL5 A;  4HM2 A;  5KJ7 D;  3WUT A;  4PD4 I;  2FKW B;  1PV3 A;  1VM9 A;  2K9J A;  2JO6 A;  1FZC A;  1DH3 A;  2RMZ A;  1PP9 G;  1OX3 A;  1J1D C;  3P8C D;  1BSN A;  2R32 A;  2PGD A;  2K3R A;  2QG4 A;  1L0N G;  4PJ0 H;  2QJP B;  1SQQ G;  3RBX A;  3BAT A;  1SQQ J;  2O1K A;  1IC2 A;  4U3F J;  3D6Z A;  2OYI B;  1SQX J;  1MUU A;  1DD3 A;  4GOF A;  3D89 A;  1KZU B;  4HKZ H;  4AIV A;  1NVO A;  3L75 J;  5M1B A;  1D7M A;  1EZV D;  5GTH E;  3H1L D;  1ZN5 A;  3GKE A;  2OYI A;  2PRR A;  1SJG A;  1EDK A;  1Q90 D;  2WPV B;  1SQP G;  1ZR2 A;  4RO0 A;  2OYI C;  5KKZ C;  4U7J A;  1LTB C;  4QMA A;  1YYC A;  4DZO A;  5CCH A;  2HML A;  2Z5H A;  2YMY A;  3MHV A;  1DX7 A;  1BDD A;  2AEF A;  3WUV A;  3HTK A;  5AEW A;  1PGJ A;  3I56 P; 
#chains in the Genus database with same CATH homology
 4HM4 A;  2Q3W A;  3CX5 E;  2JZA A;  4QUQ A;  1L0N E;  1VF5 B;  1BCC E;  1O7H A;  2IDB A;  3L71 E;  3N0Q A;  2NUK A;  5HL4 A;  2NVF A;  4HKV A;  2D2C D;  4NBG D;  2E76 D;  2D2C C;  2YVJ B;  1KOR A;  3H1H E;  1UUV A;  3L74 E;  2ZYL A;  3AE8 C;  4HM6 A;  2HMO A;  2HMN A;  2WSC J;  3GL0 A;  1NYH A;  1P84 E;  3IAO A;  2H88 C;  2NVG A;  3H1J E;  4H44 B;  1Q90 C;  3GTS A;  1NGM B;  1KB9 E;  1FQT A;  3BCC E;  4P1C H;  1SQX E;  2J5U A;  3GL2 A;  1WMK A;  3AE3 C;  1NU1 E;  2E75 C;  4OGQ C;  1KTM A;  1TU3 F;  2YFJ A;  4XFJ A;  4YXD C;  1BE3 E;  1EG9 A;  4H0L D;  2QIW A;  5BOK A;  1FDO A;  1OMI A;  4QCK A;  2QJP C;  2JO1 A;  1VL2 A;  3D71 A;  2FXP A;  2I7F A;  1YQ4 C;  4TT3 H;  2B24 A;  1Y9B A;  2DE6 D;  3L75 E;  1L0L E;  1ULI A;  3GF7 A;  1YQ3 C;  3AEB C;  4GDO A;  1IK7 A;  1OW6 A;  3TGU E;  4QDC A;  3AZC A;  1NTM E;  4HM3 A;  1O7W A;  3GZX A;  4NBB D;  2E74 D;  1KMI Z;  3AEA C;  3R4Y A;  1PP9 E;  4QDF A;  1S5L X;  1K05 A;  4QUP A;  3CXH E;  3GMA A;  2E4Q A;  1UIX A;  2V7Q J;  2QJY C;  4NBA D;  3AEG C;  4PD4 E;  2BMQ A;  1EXI A;  5CXM A;  3L72 E;  2HMJ A;  2MKV A;  4YTP C;  4HM7 A;  1O7N A;  3GLM A;  3Q5R A;  3AEE C;  3AE5 C;  3H25 A;  3AE2 C;  3GOB A;  3AE7 C;  3L70 E;  1PIX A;  1NYK A;  2DE7 D;  2G3A A;  3D70 A;  2WQY C;  3AE9 C;  3VCA A;  3ABV C;  1HF9 A;  2NUM A;  3GZY A;  1SQQ E;  1R8E A;  1AJY A;  2YFL A;  2DE5 D;  3VCP A;  3L73 E;  3G9R A;  3VMI D;  3GF3 A;  4Y28 J;  1O7M A;  2D2C B;  3AEC C;  3B71 A;  1UUW A;  2OQQ A;  2GBW A;  4HM1 A;  3DQY A;  1KYO E;  3LW5 J;  1U57 A;  3VMH D;  1OW7 A;  2E76 C;  5KLV E;  1WQL A;  2WSF J;  4H0L B;  3GTE A;  2XRX A;  1VF5 C;  1KIL E;  3AED C;  3SFD C;  3H1L E;  3D6Y A;  3SFE C;  1SQV E;  4I7Z B;  3GCE A;  2YIU C;  2B1X A;  3C0D A;  4I7Z C;  4HM8 A;  1RFS A;  3VMG D;  2ZT9 C;  1JB0 J;  3AEF C;  1VCK A;  4HJL A;  2K9Y A;  1OW8 A;  4H44 D;  2HMK A;  1K04 A;  2E74 B;  4NBH D;  2BEQ D;  2E76 B;  4NBC D;  4OGQ D;  2FYU E;  2HMM A;  2H89 C;  2CKF A;  2XSO A;  3Q5P A;  5AEU A;  1PPJ E;  4AAY B;  1VF5 D;  2FBW C;  3GB4 A;  4IL6 X;  3H1I E;  1NTK E;  4NB8 D;  3IN6 A;  3FGA D;  1EXJ A;  4PV1 D;  3FOU A;  3Q5S A;  1G8J B;  1S1C X;  4NBF D;  2E75 B;  2BCC E;  1ZRT E;  4QDF B;  3AE4 C;  3Q2Y A;  2WSE J;  2QPZ A;  3C8V A;  1RQV A;  1ZME C;  2JP3 A;  1ULJ A;  1O7P A;  3AE6 C;  1O7G A;  2ZT9 B;  4H13 D;  1FDI A;  1RIE A;  2G8Y A;  4H13 C;  2NWF A;  4RKU J;  1RQU A;  4R4L A;  5L8R J;  4H13 B;  5KLI C;  1HJ0 A;  1KQG B;  1PL5 A;  2P10 A;  4HM2 A;  2NVE A;  2YFI A;  3AE1 C;  4HM5 A;  4QDD A;  1PV3 A;  4H0L C;  1VM9 A;  3Q1M A;  4HM0 A;  1GMJ A;  2QSI A;  2JO6 A;  2XR8 A;  2E75 D;  4P1B H;  1DIP A;  1SQB E;  2E4P A;  4PV1 C;  1SQP E;  3EWK A;  2BMR A;  4NB9 D;  3Q3D A;  1MKM A;  3D6Z A;  3H1K E;  4U3F E;  2O01 J;  1NDO A;  1G8K B;  1DD3 A;  1ZP0 C;  4EMJ B;  3D89 A;  4OGQ B;  2FYN C;  3O6Q A;  4R4M A;  4AIV A;  5M1B A;  3RL0 g;  2ZT9 D;  2E74 C;  1KQF B;  4NBD D;  2IBZ E;  3GKE A;  3EN1 A;  1SJG A;  3S9O A;  4Z1M H;  1Q90 D;  2WPV B;  2QJK C;  2BEZ F;  3T97 B;  4H44 C;  2A06 E;  5KKZ C;  3EQQ A;  4KT0 J;  4U7J A;  4NBE D;  1ZOY C;  4QUR A;  1EZV E;  2GBX A;  2XSH A;  1DD4 A;  2BMO A;  1JM1 A;  3CWB E;  2YMK A;  2HML A;  3RK3 E;  1NTZ E;  4PV1 B;  2NZ2 A;  5AEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...