4H0LD

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
161
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 26
structure length 161
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h0lD02
1VCKA 2ZYLA 3CX5E 4HKVA 4QURA 5KLVE 1L0LE 3EQQA 1NYKA 2HMMA 4AAYB 5KLIC 1SJGA 1JM1A 2E76C 1P84E 2YVJB 2ZT9C 3GOBA 1KYOE 1NTME 3H1IE 2JO6A 1O7NA 2YFIA 4HM0A 3GTSA 1Q90C 2NVFA 1SQVE 3GCEA 3H1LE 3L72E 1SQQE 2GBWA 1O7WA 2D2CC 1PPJE 2QJKC 2YMKA 1VM9A 2GBXA 1RFSA 2E75C 1NDOA 1EZVE 2ZT9D 3H1JE 4HM7A 4H44C 4PV1C 1SQPE 2HMNA 1EG9A 2NUKA 2HMLA 2HMKA 1O7GA 1SQXE 3H1HE 1O7PA 1VF5C 1NU1E 2BMQA 4HM5A 2XSHA 5HL4A 4HM6A 4H44D 5BOKA 4PV1D 1SQBE 1ULIA 3BCCE 4AIVA 2QPZA 3VMGD 3L71E 4NB9D 2BMOA 1VF5D 3GZXA 4QUQA 2HMOA 1KB9E 4HM1A 3VMHD 2XRXA 2YIUC 4QDCA 2E76D 4OGQC 1RIEA 2FYNC 2E74C 1UUVA 1UUWA 1L0NE 1WQLA 4HM4A 2Q3WA 3GZYA 4HM3A 2CKFA 2NVGA 4U3FE 2E4QA 4NB8D 3DQYA 1ULJA 2D2CD 2DE5D 2HMJA 3GKEA 4OGQD 2E75D 4P1CH 2FYUE 3VMID 5AEUA 1G8JB 4H13C 2NVEA 3D89A 2BCCE 4HM8A 1O7MA 4QCKA 1ZRTE 4P1BH 2I7FA 1BCCE 3L73E 3GB4A 4QDFA 1PP9E 3C0DA 3N0QA 3GTEA 2XSOA 4EMJB 4H13D 3TGUE 2B1XA 4QUPA 1O7HA 1G8KB 2JZAA 2IBZE 3FOUA 5CXMA 2NUMA 2B24A 1BE3E 2DE7D 2YFJA 3EN1A 3GL2A 3L74E 2A06E 2NWFA 4NBGD 4NBDD 4I7ZC 4H0LC 2YFLA 4NBAD 2E74D 5KKZC 3AZCA 4NBFD 4PD4E 4NBHD 5AEWA 3VCAA 4QDDA 2QJYC 3L75E 4QDFB 2QJPC 4NBBD 3L70E 2XR8A 4NBCD 2DE6D 1NTKE 1NTZE 3CWBE 4H0LD 2E4PA 4NBED 4HJLA 3VCPA 3GL0A 3H1KE 3CXHE 2BMRA 1FQTA 4HM2A
chains in the Genus database with same CATH superfamily
5KLIB 1VCKA 3JCUH 3H1HG 1JY2N 1NYKA 2HMMA 5KLIC 1OFCX 3HTKA 1FZCA 1L4AB 1M1KQ 1EDJA 1L4AC 1BCCJ 2A06D 1HJBA 1NTKJ 3H32B 4H44B 4U7JA 1JMBA 4H44C 1RE3A 1RY3A 4BWNA 2E76B 3USSA 1JY3P 4RESB 2OTLP 1PGJA 4N78D 1KYOD 2CPBA 1HGZA 2OTKE 2BMOA 3GZXA 1JY2O 4UB8H 1BCCG 2J5UA 1MUUA 1DEBA 2E74C 3GLMA 2H43A 4PD4H 2ZJSE 1N73B 3P8CD 3UIAA 3RGUA 1N73C 4KJMA 5TISH 1J1EB 3H1HD 1GL2B 1J1EC 1YTZT 2FBWC 4HM8A 5BU8B 1AVOA 4QCKA 1JNMA 3HE5B 4P1BH 3K5BA 5APVA 3QWOC 3IN6A 3AECC 5CBOA 4QUPA 1E79H 1O7HA 4LLHA 2JZAA 2OYIA 3AEBC 3L74E 3EN1A 3L72G 4PD4E 2N1TD 1GW4A 2VRSA 3GL0A 3H1KE 1P84I 4C7NA 5KLVE 3WU2E 1T2KC 2R44A 1HGVA 2YVJB 1ZMEC 3MUDA 1LTTC 2BCCJ 2M5AA 2QJKB 1URQD 3VYIA 1EZVI 2QJKC 2K3RA 2YKOA 2UWJE 3WUVA 1L0NG 1ZW0A 2HMNA 5AW2B 1ZLLA 1CI6B 1BE3J 1O7PA 1NTMK 1ZR2A 4BXLA 2KK7A 3A0BE 3B4SA 1FZEA 3OJAB 3I5CA 4PJ0H 3GF7A 3OW2O 2BCCG 2YKPA 3L72D 4HM1A 4QDCA 2W6AA 4NPDA 1LTAC 1NOHA 3GW6A 2E4QA 4IL6E 1BE3G 1MV8A 4OGQD 1LJ2A 1KTMA 3AE1C 1RF0C 4I1LA 1NTZG 1ZR4A 1VQ8P 3GTEA 5CHXA 4PJ0E 3TGUE 4H13D 1NU1K 1L0ND 1JMMA 2P2UA 1SQBK 4DZOA 3H1IG 4R4LA 2I1KA 2JDIH 3B71A 4RJTA 3VMYA 1RE4A 2IDBA 1D7MA 4OH8B 1LT9B 2NRGA 3M0DA 4H0LD 3VCPA 2XZRA 3L73D 2BMRA 1GTWA 4ZKUA 1JM1A 2V7QH 1IJDB 1BE3D 3KZIH 3CWBJ 1VQMP 3CD6P 3SWFA 3Q5PA 4U3FG 4AQRD 3OA7A 1NTZD 1H0TB 4D6TE 2WVRA 1JM0A 4AIVA 1YQ4C 3H1ID 3VMGD 1NVOA 3RK2C 2E43A 2O1KA 1N7LA 4LGDE 1OIPA 3LIEA 3FGAD 5APXA 2KI7B 2NVGA 4C46A 1FZCB 2HMJA 3A0HH 3E1RA 4L74A 4ASVA 2WT7A 4AYCA 4XA4A 1VQ6P 1SQPJ 3E1IA 2ZAEB 2JR8A 3V4WA 1R8EA 4HYTB 4XFJA 2NPSD 2E5YA 3AE9C 1L0LG 3FXDA 3GG2A 3SWYA 2N1TC 1ZXGA 4U3FD 1XTCC 2WMMA 4LC1A 3TK1A 1L4AA 4NBBD 3C1LA 2XR8A 1K73Q 3V5BA 3H32A 1URQB 3V6IA 1SQPG 2AXTE 1VQ5P 1URQC 3CXHE 3D6YA 1FQTA 3L74J 4YPCA 2KSJA 3NFQA 1FAVA 5B66H 1UIXA 4IL6X 3H1KJ 4WY4D 4HM7A 2IPPA 5KLVJ 1FDIA 1SVFA 2O1JA 2YXRB 1JCCA 2K37A 1N73A 1L0LD 4HKZH 5BOKA 3L75J 1S5LH 2A45I 2GUVA 4OGQB 2YKQA 1FJPA 4OGQC 1X22A 3HE5A 3W68A 1UUWA 2CK3H 4NB8D 1VF5B 2GUSA 1S9KD 3V4QA 1SQPD 1GZLA 3TNUB 5CBNA 3CCSP 5AEUA 4H13B 3NTNA 2SPZA 4H13C 1GU5A 4JYBA 2OARA 2RMZA 3L75G 1P84H 2QRXA 5AVYB 2YNYA 2FFDC 1G1JA 2NUMA 4H0LB 1RQUA 1NTMG 3CCMP 4H0LC 2E74D 5AEWA 3CX5H 1AQ5A 1KV4A 5AVXB 1PL5A 4O9BA 1VQ9P 4QDFB 1GMJA 2HFED 4N3YB 5H2FH 4L75A 1L0NK 1IFMA 3CC7P 4Y99B 1P84E 1CI6A 3PRJA 2W6JH 3CCQP 2QM8A 3C9IA 1U7JA 2O01H 3KDPB 2HG5D 1IFIA 1EZVE 4CPGA 2Q9IA 2O01N 2C0WA 1IFJA 3VN0A 1KB9H 1QEXA 3NMDA 1ULIA 1S1CX 1NTMD 2YIUB 1DIPA 2YIUC 1RF0A 2ZYAA 1U57A 3CCLP 4GDOA 2FKWB 2JP3A 1HJ0A 2NPSB 3D6ZA 1G8JB 3CCUP 2NPSC 2V7QJ 2C9NY 5AVSB 3L70G 1M56D 3HE4B 2JWAA 3AEFC 1PP9E 1SQXJ 1LT9A 2PAJA 3AEDC 3V2NA 1M8OB 5AVZB 2DE7D 3RBZA 1Q7YQ 4NBGD 3AE8C 3S1KA 3C8VA 2LXBA 1SP4A 3TDKA 3RL0C 3TF5A 1VQKP 2KP8A 3CL3D 2ZYLA 4QURA 1SQXG 1BGYD 4AAYB 4WY4C 3GOBA 3BATA 3L35A 2BEQD 5DJTB 3TYYA 1AV1A 1LWUB 3G4SP 3EWKA 3NXSA 1LWUC 1OMIA 2WZ7A 3L70D 2NUKA 1X8YA 2WWWA 3GF3A 1Y8AA 3AE7C 5KJ7D 1VQOP 5APTA 3ZDMA 2OYOA 2WSEH 2FYUG 1M7LA 1S5LX 3BCCE 2R5DA 4KHXA 2POHA 1KILD 1L0LK 2K88A 4RO0A 2Y0CA 3H1LJ 4A7PA 2N1TA 1KFNA 1IO4A 2Q5UA 2QM7A 1YYCA 3I55P 2E74B 1SQPK 2FXOA 1NTKG 4WBAA 1T3UA 1URQA 3ITKA 3RK2D 1HH0A 1OVVA 2Z5HA 1SS1A 2JO1A 5KKZB 1K8AQ 5KKZC 3AZCA 3H1LG 1NGMB 1AVYA 2FYUD 3WU2H 1M1JB 1SFCD 1FBMA 1M1JC 4NPEA 1PIXA 2N9YB 4DCKA 1NKNA 4HJLA 5AW9B 4HB1A 1Z56A 2G3AA 2ITAA 2OQQA 3FWNA 3EFFK 3CMAP 4DJGA 1JOCA 1SQQE 1OW8A 1NHLA 1RFSA 1JB0J 3H1JE 5C39A 3A0BH 2C0XA 2V4HA 2YO2A 3L4FA 1VQPP 4JF7A 1BCCD 2HMKA 5AW3B 1Q81Q 1NTKD 1M90Q 4XE5B 2FXMA 1M57D 2K1AA 2PGDA 1N8RQ 3TNUA 4BRYB 3HUSC 5AVQB 4IL6H 5KAFH 2WPRA 1L2PA 1HWTC 2YO3A 2Y0EA 1H88A 1A02J 2FFDA 2B87A 4JQ0D 2IBZG 3G71P 1SQVJ 1JTHB 2KLVA 1JY3N 1VQ4P 5BU5A 2KUBA 1YHQP 5TJHA 2CPSA 4QDFA 1YBKA 1EXIA 4EYYQ 2W90A 3FWLA 5GTHH 2O01J 1S3JA 1DD4A 3MZWB 3PJSK 3MGNA 3PP5A 5KAFE 5CJ0A 2M3BA 2YFLA 1LTIC 3A7OA 1LT1A 3MHVA 5AVTB 1SQVG 1DH3A 3VCAA 1J2JB 3D71A 5APQA 3RK3D 3VP9A 1GDTA 2I1JA 4I6MC 4DOJA 1JY3O 3VP8A 4HM2A 3M06A 1DEEG 2WITA 1YIJP 1K04A 1Q86Q 2IBZD 5GTHE 1PPJE 5KJ7C 1X79B 3E7KA 1HVVA 1AFOA 3Q1MA 2BCCD 1EG9A 3II6A 5CCGD 1PV3A 3BRVB 1XTGB 3VOPA 1NU1E 5K5GB 1LTGC 2J59M 3CX5D 2L91A 1SQBE 5L8RJ 1KILC 3MTUE 3PLNA 1NJIQ 2NPSA 4IOIH 3L71E 1SQVD 1T3JA 2Q7CA 3HE4A 3U1AA 1BSHA 2YMYA 2GA1A 3BCCJ 3AE5C 3U59A 3VMXA 3O8ZA 1GU4A 3AE2C 3RK2B 1IZNB 1R5LA 1KYOH 3KYQA 3CWBG 4IFDK 2B9BA 3GMAA 1KB9D 1SQXK 2XSOA 5GTIE 1N2DC 1SFCB 5CCHD 3FOUA 1SFCC 1GD2E 3GL2A 4WY4A 2A06E 1KQGB 4NBDD 3R4YA 2AXTH 3BCCG 2K9JB 3CXHH 4Z1MH 2KNCA 1HF9A 3V2RA 2WSEJ 1PGPA 2QJPC 3R2PA 2OTJP 1LWUA 4W7ZA 4IFFA 2XNXA 5AW5B 5B5EE 1ZRTD 3EFGA 3GHGB 1W2BO 3GHGC 4N78E 2FYUK 2N1TB 1KYOE 2JO6A 2YFIA 2JJLA 4QMAA 1JEKA 3GTSA 3V2QA 2WQYC 2WSSH 1X0TA 2D2CC 2HR3A 1KQSO 2B88A 3G3ZA 3P8CE 2QEXP 2ZXEB 5DJUB 3H1HE 3W67A 3CWBD 1YQ3C 3M9HA 3CCEP 4GKGA 1SQQJ 3RL0D 1FC2C 2E5TA 2JEEA 3HD7D 2IYOA 3OAKA 1W2EA 3KQGA 1NTKK 1FU1A 4OVNF 4HM3A 3AE6C 3CC2P 2QSIA 1IFNA 2DE5D 2L5GB 3WUUA 1GK6A 4EI2A 3GKEA 3L74G 3VMID 1N7SC 1LTJB 2Y0DA 1LTJC 1USEA 2NVEA 2KXPB 1LTBC 1OVRA 1BCCE 1EDLA 1EC5A 1M1JA 1N86A 3N0QA 3AEAC 2KB7P 3H1KG 5KLVG 3RK3B 2WTYA 2P58A 3RK3C 1OVUA 4JYCA 2IFMA 1FDMA 3B8EB 1K9MQ 4Y28J 2DW3A 2DE6D 2M3EA 3D70A 2KS1A 2FFDB 2B87B 3A2AA 2HMLA 2XNDH 2KZJA 1FZGA 2P7JA 3S9OA 2KOGA 3L72E 2KYVA 2NVFA 4AUWA 5CCGC 3L74D 1HTLC 1ZOYC 1O7WA 3HUSA 2YMKA 4BRYA 3Q3DA 2E75C 4PD4D 4YXWH 3TGUJ 1EDIA 4K3AA 2OGUA 2Y9ZA 5AW0B 3H1KD 4HM5A 3CPWO 2J58A 1MZ9A 5KLVD 1JCDA 3JSVC 3T97B 4EOTA 2M0BA 2OYHB 1JTHA 3F89A 1LTSC 2OYHC 3VMHD 2FYNC 1YJ9P 3L75D 3VTPC 1L0NE 2Q1KA 3GZYA 3TGUG 1RQVA 2G8YA 1ULJA 1SQBJ 3VMZA 1FOSE 3Q5RA 4P1CH 1SQVK 2XU6A 1T8ZA 1QVGO 1HBWA 3L71J 3H6PA 2ZYGA 2KSEA 1PPJG 2BCCE 1CSBA 1O7MA 5CCHC 2QG4A 3L73E 3GB4A 3C0DA 1JY2P 4D6TJ 3MD0A 1KZUB 1KMIZ 3IR9A 5CXMA 2HPCB 3JC22 1BE3E 1KC8Q 4NBAD 1J1DB 1J1DC 5KJ7A 5KTBA 1NTZE 5AVRB 1NKZB 1T6AA 4GIFA 2P1JA 1KFMA 3EQQA 3BVHA 4D6TG 3TGUD 3G9RA 3H1IE 3O6QA 3GCEA 1KILA 2LKMA 1Y47A 1IC2A 2P10A 1QVFO 3RL0B 2ZFCA 3HD7C 2ZVOB 4YTPC 1MKMA 5CMZA 3WMM0 4WY4B 2HYNA 3QH9A 2A06G 2XSHA 5M1BA 2PP6A 2KNCB 3CC4P 1RHZB 1OW6A 3B5ND 1KD1Q 3P32A 2QVAA 4NB9D 3H1HJ 1UUVA 2WSCH 4B86A 1WQLA 4HM4A 4TLFA 4U3FE 5AW7B 1JO5A 1SFCA 2FXPA 4UB6E 1W5CE 2IX7C 4D6TD 1AJYA 2K9YA 2K9JA 2MKVA 1RF1B 3IF4A 1RF1C 2FYZA 3P7KA 4NPFX 4L76A 1VPCA 2BEZF 3GHGA 3P8MC 4I7ZB 4I7ZC 1SQXD 2LXCB 2QJYB 1GK4A 4L73A 3L37A 2QJYC 4R4MA 2RKLA 5E79H 1U7MA 1DD3A 3ABVC 1L0LE 2ZYDA 5AW1B 2E76C 5AW8B 1Y9BA 1IK7A 1X9VA 2JWDA 2RN0A 2PRRA 1OX3A 1QX8A 3JCUE 4M3LA 3SFEC 2KIKA 1VQ7P 1S9KE 1SQPE 1Q90D 1FDOA 4ZMDA 1O7GA 2W83C 1G1IA 2A45H 3L72J 3CXHD 1S2EA 4GODA 1SQQK 3KHUA 1N7SA 3M0AA 1GL2C 5E79E 1LTJA 1LNQA 2HMOA 2KS1B 2LR2A 1K05A 5KLVK 2Q3WA 3F5HA 2CKFA 5EFWB 4C7RA 2D2CD 2H89C 4UB8E 1CW5A 1LGHB 1YITP 3HUSB 2QE7H 2HODB 3D89A 1L0NJ 1FS0E 2I7FA 3H1LD 5TISE 1Q2NA 2XDJA 2Z4EA 2IBZI 1HUCA 2R5BA 1NAYA 1OXZA 4IFMA 2P67A 5AW6B 3L73J 2QIWA 5CCGA 3L75E 3VMAA 1NAFA 1EZVG 1KN7A 3CX5I 2E4PA 2M8RA 1N7SD 3HRNA 1NTME 2AEJA 2WSFJ 1G2CB 3FX0A 3MIWA 3T97A 1NTZJ 1PP9J 3L73G 2OYHA 2GBXA 1NDOA 2ZT9D 1BDDA 2GM4A 3AEEC 3B5NB 3B5NC 3H1IJ 1TU3F 2BMQA 2KLUA 2XKMA 1P84D 1KB9I 2N9BA 3CI9A 3PTZA 1VF5D 4HJGH 3G6EP 5CCHA 1JUNA 2IYPA 1PP9G 4ZNCA 1EZVD 4I2LC 3LW5J 1FZAA 2H88C 4ZKPA 2E75D 3O6QB 1H89A 1RH5B 1KQLA 1KILB 2HPCA 2H8PD 5AVWB 3SWKA 1PGOA 2I8DA 4WWIA 5GTIH 1PGQA 1LP1A 3BRTB 3PHLA 5APSA 4U3FJ 1LT9C 3Q2YA 1BGYE 2W8ZA 1G8KB 3IAOA 5B5EH 3L70E 1MFZA 2R32A 3CMEP 4NBED 3HD7A 1Q82Q 2BASA 1PP9D 1EDKA 1WMKA 2WSCJ 1YJWP 1VQNP 1Q90C 4ASWA 2HLOA 2QJPB 1BSNA 1YTZI 1VM9A 1KILE 4MN4C 3CCVP 4TT3H 1L0LJ 5AVVB 1IK9A 1SQXE 3HTKB 3KZIE 3M91A 1DX7A 1FZCC 1FZBA 4PV1D 2D2CB 2XRXA 1RE3C 1RIEA 1FE6A 1RF1A 3MP7B 2W6BA 1OZHA 1A02F 1FOSF 4DT0A 1QL1A 2FYUE 2W27A 3H1JJ 2XV5A 4GOEA 2AEFA 4EIJA 3I56P 2R3CA 3BCCD 1S4XA 3A0HE 2Q3IA 5CJ4A 2ZXXA 2YXQB 4EMJB 3EQ2A 4JPZB 2B1XA 1OW7A 1GW3A 5KAIH 1N7SB 4PD4I 2YFJA 1IFDA 2NWFA 4NBFD 3KXDA 3U1CA 1BDCA 1SQQG 4QDDA 1EQ7A 2Q6QA 1QGKB 3H1JG 2ZVNB 1NTKE 3BASA 1NWQA 4JBZA 3V2PA 1SLQA 2OYIB 4HKVA 2ZT9B 1NH4A 2OYIC 2ZT9C 3M9QA 2FY8A 4HM0A 2RH0A 3H1LE 1PZQA 1GL2A 3N7NA 2IFNA 3CCJP 2A45G 2QA4P 5KAIE 4C7NB 3CLQA 1L4AD 4GOFA 4W7YA 1NTMJ 2MJZA 1VF5C 5B66E 1VDFA 2M5AB 5HL4A 4HM6A 3MUDC 4H44D 2JKVA 3L36A 3SFDC 1PFIA 2E75B 1SQQD 2HODA 2E76D 2Q3EA 5APUA 3AE3C 3S4RA 1E5WA 4OWFA 1S5LE 3H1JD 3AE4C 2PFXA 3A5TA 1R5SA 3RK3E 2FYNB 4WB4A 1AQTA 5APWA 1NU1J 1GL2D 5BVZA 1KQFB 2WSFH 4Y99C 3Q5SA 2IBZE 2AEMA 2B24A 4KT0J 1YI2P 2Y9YA 2E42A 1WRGA 1G2CA 1NO4A 3SSUA 1BGYJ 4RKUJ 4NBCD 1KORA 2WPSA 2Z5IA 3B5NA 3WUTA 2WPVB 4WVZA 3CX5E 1QLED 1SJGA 1NU1G 2NZ2A 1H8AA 5H2FE 3RL0g 1O7NA 1SQBG 3L70J 1SQVE 1RE4C 1IFPA 2GBWA 1LP1B 1USDA 3L71G 4EDFA 1T2KD 1NTZK 1S72P 4YXDC 3M0DC 4PV1B 3M9BA 1OWAA 3LW5H 1BGYG 4PV1C 3AEGC 2WPQA 3A3YB 2B89A 3TSIA 2H7HA 3LIDA 4K35A 1YJNP 2KZIA 1FZFA 2QPZA 3RBXA 3CCRP 5AVUB 4QUQA 1KB9E 3IFMA 3HD7B 4UB6H 1PPJD 1CZQA 3H25A 1NYHA 1MFTA 3DQYA 1VQLP 2C9LY 1NU1D 2IZ0A 1FJKA 1ZN5A 1SQBD 2O3JA 1ZRTE 4HH2A 4GT1A 3L71D 2R3SA 4N6JA 3N4XA 4W80A 3KPEA 1ZV8A 1KYOI 1WT6A 2FYUJ 3PH0A 1UIIA 1H0TA 5AW4B 2AXCA 1EXJA 2WT7B 5APYA 2IZ1A 4NBHD 1QL2A 1AA0A 3CXHI 1ZP0C 3CWBE 3FXEA 1VL2A
chains in the Genus database with same CATH topology
1VCKA 1NYKA 2HMMA 5KLIC 1P84E 1KYOE 1NTME 2JO6A 2YFIA 2WSFJ 3GTSA 2WQYC 2D2CC 4H44B 4U7JA 2GBXA 1NDOA 1EZVE 2ZT9D 4H44C 3AEEC 3H1HE 1YQ3C 2E76B 1TU3F 2BMQA 1ULIA 1S1CX 1DIPA 2BMOA 1VF5D 3GZXA 2YIUC 2J5UA 2E74C 3GLMA 1U57A 4GDOA 4HM3A 3AE6C 3LW5J 2QSIA 2DE5D 2H88C 3GKEA 2JP3A 2E75D 1HJ0A 3VMID 3D6ZA 1G8JB 2FBWC 2NVEA 2V7QJ 4HM8A 4QCKA 4P1BH 1BCCE 3AEFC 1PP9E 3Q2YA 3IN6A 3N0QA 3AEAC 3AECC 4QUPA 3AEDC 1O7HA 1G8KB 3IAOA 2JZAA 2DE7D 3L74E 3EN1A 3AEBC 4NBGD 3AE8C 4PD4E 3C8VA 3L70E 4Y28J 2DE6D 4NBED 3D70A 3GL0A 3H1KE 2HMLA 2ZYLA 5KLVE 4QURA 4AAYB 1WMKA 2YVJB 2WSCJ 1ZMEC 3GOBA 3S9OA 2BEQD 3L72E 1Q90C 2NVFA 1ZOYC 1O7WA 2QJKC 2YMKA 1VM9A 3EWKA 1KILE 2E75C 3Q3DA 4TT3H 1OMIA 2HMNA 2NUKA 1SQXE 1O7PA 3GF3A 3AE7C 4HM5A 3T97B 4PV1D 1S5LX 3BCCE 3GF7A 2D2CB 3VMHD 4HM1A 2XRXA 4QDCA 1RIEA 2FYNC 1L0NE 3GZYA 1RQVA 2E4QA 2G8YA 1ULJA 3Q5RA 4OGQD 4P1CH 2FYUE 1KTMA 2BCCE 1O7MA 3AE1C 3L73E 3GB4A 2E74B 3C0DA 3GTEA 4EMJB 4H13D 3TGUE 2B1XA 1OW7A 1KMIZ 5CXMA 2JO1A 1BE3E 2YFJA 2NWFA 4R4LA 4NBAD 5KKZC 3AZCA 4NBFD 1NGMB 3B71A 4QDDA 2IDBA 1NTKE 1NTZE 1PIXA 4H0LD 4HJLA 3VCPA 2BMRA 2G3AA 4HKVA 2OQQA 3EQQA 2ZT9B 1JM1A 2ZT9C 3G9RA 3H1IE 4HM0A 3O6QA 3GCEA 3H1LE 1SQQE 1OW8A 2P10A 1RFSA 1JB0J 3H1JE 3Q5PA 4YTPC 2HMKA 1MKMA 1VF5C 2XSHA 5HL4A 4HM6A 4H44D 5M1BA 1OW6A 4AIVA 1YQ4C 3VMGD 4NB9D 3SFDC 2E75B 2E76D 3AE3C 1UUVA 3FGAD 1WQLA 4HM4A 3AE4C 2NVGA 4U3FE 2HMJA 2FXPA 1AJYA 3RK3E 2K9YA 2MKVA 4QDFA 1EXIA 2O01J 4XFJA 1R8EA 1KQFB 3AE9C 3Q5SA 2IBZE 1DD4A 2BEZF 4I7ZB 2B24A 4KT0J 4I7ZC 2YFLA 3VCAA 2QJYC 4NBBD 4R4MA 3D71A 2XR8A 4RKUJ 4NBCD 1KORA 3CXHE 3D6YA 1FQTA 4HM2A 2WPVB 1DD3A 3ABVC 3CX5E 1L0LE 1SJGA 2NZ2A 2E76C 1Y9BA 1IK7A 3RL0g 1O7NA 1K04A 1SQVE 2GBWA 1PPJE 1UIXA 3SFEC 4IL6X 4YXDC 4PV1B 4HM7A 4PV1C 3AEGC 3Q1MA 1FDIA 1SQPE 1EG9A 1Q90D 1FDOA 1PV3A 1O7GA 1NU1E 5BOKA 1SQBE 5L8RJ 2QPZA 3L71E 4OGQB 4QUQA 2HMOA 1KB9E 4OGQC 1UUWA 1K05A 2Q3WA 3H25A 2CKFA 1NYHA 4NB8D 1VF5B 3DQYA 2D2CD 2H89C 3AE5C 5AEUA 4H13B 4H13C 3AE2C 3D89A 1ZRTE 2I7FA 3GMAA 2XSOA 3FOUA 2NUMA 4H0LB 3GL2A 1RQUA 2A06E 1KQGB 4NBDD 4H0LC 1EXJA 3R4YA 2E74D 4Z1MH 4NBHD 5AEWA 1HF9A 2QIWA 3L75E 1PL5A 2WSEJ 4QDFB 2QJPC 1GMJA 1ZP0C 3CWBE 2E4PA 1VL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCK A;  2ZYL A;  3CX5 E;  4HKV A;  4QUR A;  5KLV E;  1L0L E;  3EQQ A;  1NYK A;  2HMM A;  4AAY B;  5KLI C;  1SJG A;  1JM1 A;  2E76 C;  1P84 E;  2YVJ B;  2ZT9 C;  3GOB A;  1KYO E;  1NTM E;  3H1I E;  2JO6 A;  1O7N A;  2YFI A;  4HM0 A;  3GTS A;  1Q90 C;  2NVF A;  1SQV E;  3GCE A;  3H1L E;  3L72 E;  1SQQ E;  2GBW A;  1O7W A;  2D2C C;  1PPJ E;  2QJK C;  2YMK A;  1VM9 A;  2GBX A;  1RFS A;  2E75 C;  1NDO A;  1EZV E;  2ZT9 D;  3H1J E;  4HM7 A;  4H44 C;  4PV1 C;  1SQP E;  2HMN A;  1EG9 A;  2NUK A;  2HML A;  2HMK A;  1O7G A;  1SQX E;  3H1H E;  1O7P A;  1VF5 C;  1NU1 E;  2BMQ A;  4HM5 A;  2XSH A;  5HL4 A;  4HM6 A;  4H44 D;  5BOK A;  4PV1 D;  1SQB E;  1ULI A;  3BCC E;  4AIV A;  2QPZ A;  3VMG D;  3L71 E;  4NB9 D;  2BMO A;  1VF5 D;  3GZX A;  4QUQ A;  2HMO A;  1KB9 E;  4HM1 A;  3VMH D;  2XRX A;  2YIU C;  4QDC A;  2E76 D;  4OGQ C;  1RIE A;  2FYN C;  2E74 C;  1UUV A;  1UUW A;  1L0N E;  1WQL A;  4HM4 A;  2Q3W A;  3GZY A;  4HM3 A;  2CKF A;  2NVG A;  4U3F E;  2E4Q A;  4NB8 D;  3DQY A;  1ULJ A;  2D2C D;  2DE5 D;  2HMJ A;  3GKE A;  4OGQ D;  2E75 D;  4P1C H;  2FYU E;  3VMI D;  5AEU A;  1G8J B;  4H13 C;  2NVE A;  3D89 A;  2BCC E;  4HM8 A;  1O7M A;  4QCK A;  1ZRT E;  4P1B H;  2I7F A;  1BCC E;  3L73 E;  3GB4 A;  4QDF A;  1PP9 E;  3C0D A;  3N0Q A;  3GTE A;  2XSO A;  4EMJ B;  4H13 D;  3TGU E;  2B1X A;  4QUP A;  1O7H A;  1G8K B;  2JZA A;  2IBZ E;  3FOU A;  5CXM A;  2NUM A;  2B24 A;  1BE3 E;  2DE7 D;  2YFJ A;  3EN1 A;  3GL2 A;  3L74 E;  2A06 E;  2NWF A;  4NBG D;  4NBD D;  4I7Z C;  4H0L C;  2YFL A;  4NBA D;  2E74 D;  5KKZ C;  3AZC A;  4NBF D;  4PD4 E;  4NBH D;  5AEW A;  3VCA A;  4QDD A;  2QJY C;  3L75 E;  4QDF B;  2QJP C;  4NBB D;  3L70 E;  2XR8 A;  4NBC D;  2DE6 D;  1NTK E;  1NTZ E;  3CWB E;  4H0L D;  2E4P A;  4NBE D;  4HJL A;  3VCP A;  3GL0 A;  3H1K E;  3CXH E;  2BMR A;  1FQT A;  4HM2 A; 
#chains in the Genus database with same CATH topology
 5KLI B;  1VCK A;  3JCU H;  3H1H G;  1JY2 N;  1NYK A;  2HMM A;  5KLI C;  1OFC X;  3HTK A;  1FZC A;  1L4A B;  1M1K Q;  1EDJ A;  1L4A C;  1BCC J;  2A06 D;  1HJB A;  1NTK J;  3H32 B;  4H44 B;  4U7J A;  1JMB A;  4H44 C;  1RE3 A;  1RY3 A;  4BWN A;  2E76 B;  3USS A;  1JY3 P;  4RES B;  2OTL P;  1PGJ A;  4N78 D;  1KYO D;  2CPB A;  1HGZ A;  2OTK E;  2BMO A;  3GZX A;  1JY2 O;  4UB8 H;  1BCC G;  2J5U A;  1MUU A;  1DEB A;  2E74 C;  3GLM A;  2H43 A;  4PD4 H;  2ZJS E;  1N73 B;  3P8C D;  3UIA A;  3RGU A;  1N73 C;  4KJM A;  5TIS H;  1J1E B;  3H1H D;  1GL2 B;  1J1E C;  1YTZ T;  2FBW C;  4HM8 A;  5BU8 B;  1AVO A;  4QCK A;  1JNM A;  3HE5 B;  4P1B H;  3K5B A;  5APV A;  3QWO C;  3IN6 A;  3AEC C;  5CBO A;  4QUP A;  1E79 H;  1O7H A;  4LLH A;  2JZA A;  2OYI A;  3AEB C;  3L74 E;  3EN1 A;  3L72 G;  4PD4 E;  2N1T D;  1GW4 A;  2VRS A;  3GL0 A;  3H1K E;  1P84 I;  4C7N A;  5KLV E;  3WU2 E;  1T2K C;  2R44 A;  1HGV A;  2YVJ B;  1ZME C;  3MUD A;  1LTT C;  2BCC J;  2M5A A;  2QJK B;  1URQ D;  3VYI A;  1EZV I;  2QJK C;  2K3R A;  2YKO A;  2UWJ E;  3WUV A;  1L0N G;  1ZW0 A;  2HMN A;  5AW2 B;  1ZLL A;  1CI6 B;  1BE3 J;  1O7P A;  1NTM K;  1ZR2 A;  4BXL A;  2KK7 A;  3A0B E;  3B4S A;  1FZE A;  3OJA B;  3I5C A;  4PJ0 H;  3GF7 A;  3OW2 O;  2BCC G;  2YKP A;  3L72 D;  4HM1 A;  4QDC A;  2W6A A;  4NPD A;  1LTA C;  1NOH A;  3GW6 A;  2E4Q A;  4IL6 E;  1BE3 G;  1MV8 A;  4OGQ D;  1LJ2 A;  1KTM A;  3AE1 C;  1RF0 C;  4I1L A;  1NTZ G;  1ZR4 A;  1VQ8 P;  3GTE A;  5CHX A;  4PJ0 E;  3TGU E;  4H13 D;  1NU1 K;  1L0N D;  1JMM A;  2P2U A;  1SQB K;  4DZO A;  3H1I G;  4R4L A;  2I1K A;  2JDI H;  3B71 A;  4RJT A;  3VMY A;  1RE4 A;  2IDB A;  1D7M A;  4OH8 B;  1LT9 B;  2NRG A;  3M0D A;  4H0L D;  3VCP A;  2XZR A;  3L73 D;  2BMR A;  1GTW A;  4ZKU A;  1JM1 A;  2V7Q H;  1IJD B;  1BE3 D;  3KZI H;  3CWB J;  1VQM P;  3CD6 P;  3SWF A;  3Q5P A;  4U3F G;  4AQR D;  3OA7 A;  1NTZ D;  1H0T B;  4D6T E;  2WVR A;  1JM0 A;  4AIV A;  1YQ4 C;  3H1I D;  3VMG D;  1NVO A;  3RK2 C;  2E43 A;  2O1K A;  1N7L A;  4LGD E;  1OIP A;  3LIE A;  3FGA D;  5APX A;  2KI7 B;  2NVG A;  4C46 A;  1FZC B;  2HMJ A;  3A0H H;  3E1R A;  4L74 A;  4ASV A;  2WT7 A;  4AYC A;  4XA4 A;  1VQ6 P;  1SQP J;  3E1I A;  2ZAE B;  2JR8 A;  3V4W A;  1R8E A;  4HYT B;  4XFJ A;  2NPS D;  2E5Y A;  3AE9 C;  1L0L G;  3FXD A;  3GG2 A;  3SWY A;  2N1T C;  1ZXG A;  4U3F D;  1XTC C;  2WMM A;  4LC1 A;  3TK1 A;  1L4A A;  4NBB D;  3C1L A;  2XR8 A;  1K73 Q;  3V5B A;  3H32 A;  1URQ B;  3V6I A;  1SQP G;  2AXT E;  1VQ5 P;  1URQ C;  3CXH E;  3D6Y A;  1FQT A;  3L74 J;  4YPC A;  2KSJ A;  3NFQ A;  1FAV A;  5B66 H;  1UIX A;  4IL6 X;  3H1K J;  4WY4 D;  4HM7 A;  2IPP A;  5KLV J;  1FDI A;  1SVF A;  2O1J A;  2YXR B;  1JCC A;  2K37 A;  1N73 A;  1L0L D;  4HKZ H;  5BOK A;  3L75 J;  1S5L H;  2A45 I;  2GUV A;  4OGQ B;  2YKQ A;  1FJP A;  4OGQ C;  1X22 A;  3HE5 A;  3W68 A;  1UUW A;  2CK3 H;  4NB8 D;  1VF5 B;  2GUS A;  1S9K D;  3V4Q A;  1SQP D;  1GZL A;  3TNU B;  5CBN A;  3CCS P;  5AEU A;  4H13 B;  3NTN A;  2SPZ A;  4H13 C;  1GU5 A;  4JYB A;  2OAR A;  2RMZ A;  3L75 G;  1P84 H;  2QRX A;  5AVY B;  2YNY A;  2FFD C;  1G1J A;  2NUM A;  4H0L B;  1RQU A;  1NTM G;  3CCM P;  4H0L C;  2E74 D;  5AEW A;  3CX5 H;  1AQ5 A;  1KV4 A;  5AVX B;  1PL5 A;  4O9B A;  1VQ9 P;  4QDF B;  1GMJ A;  2HFE D;  4N3Y B;  5H2F H;  4L75 A;  1L0N K;  1IFM A;  3CC7 P;  4Y99 B;  1P84 E;  1CI6 A;  3PRJ A;  2W6J H;  3CCQ P;  2QM8 A;  3C9I A;  1U7J A;  2O01 H;  3KDP B;  2HG5 D;  1IFI A;  1EZV E;  4CPG A;  2Q9I A;  2O01 N;  2C0W A;  1IFJ A;  3VN0 A;  1KB9 H;  1QEX A;  3NMD A;  1ULI A;  1S1C X;  1NTM D;  2YIU B;  1DIP A;  2YIU C;  1RF0 A;  2ZYA A;  1U57 A;  3CCL P;  4GDO A;  2FKW B;  2JP3 A;  1HJ0 A;  2NPS B;  3D6Z A;  1G8J B;  3CCU P;  2NPS C;  2V7Q J;  2C9N Y;  5AVS B;  3L70 G;  1M56 D;  3HE4 B;  2JWA A;  3AEF C;  1PP9 E;  1SQX J;  1LT9 A;  2PAJ A;  3AED C;  3V2N A;  1M8O B;  5AVZ B;  2DE7 D;  3RBZ A;  1Q7Y Q;  4NBG D;  3AE8 C;  3S1K A;  3C8V A;  2LXB A;  1SP4 A;  3TDK A;  3RL0 C;  3TF5 A;  1VQK P;  2KP8 A;  3CL3 D;  2ZYL A;  4QUR A;  1SQX G;  1BGY D;  4AAY B;  4WY4 C;  3GOB A;  3BAT A;  3L35 A;  2BEQ D;  5DJT B;  3TYY A;  1AV1 A;  1LWU B;  3G4S P;  3EWK A;  3NXS A;  1LWU C;  1OMI A;  2WZ7 A;  3L70 D;  2NUK A;  1X8Y A;  2WWW A;  3GF3 A;  1Y8A A;  3AE7 C;  5KJ7 D;  1VQO P;  5APT A;  3ZDM A;  2OYO A;  2WSE H;  2FYU G;  1M7L A;  1S5L X;  3BCC E;  2R5D A;  4KHX A;  2POH A;  1KIL D;  1L0L K;  2K88 A;  4RO0 A;  2Y0C A;  3H1L J;  4A7P A;  2N1T A;  1KFN A;  1IO4 A;  2Q5U A;  2QM7 A;  1YYC A;  3I55 P;  2E74 B;  1SQP K;  2FXO A;  1NTK G;  4WBA A;  1T3U A;  1URQ A;  3ITK A;  3RK2 D;  1HH0 A;  1OVV A;  2Z5H A;  1SS1 A;  2JO1 A;  5KKZ B;  1K8A Q;  5KKZ C;  3AZC A;  3H1L G;  1NGM B;  1AVY A;  2FYU D;  3WU2 H;  1M1J B;  1SFC D;  1FBM A;  1M1J C;  4NPE A;  1PIX A;  2N9Y B;  4DCK A;  1NKN A;  4HJL A;  5AW9 B;  4HB1 A;  1Z56 A;  2G3A A;  2ITA A;  2OQQ A;  3FWN A;  3EFF K;  3CMA P;  4DJG A;  1JOC A;  1SQQ E;  1OW8 A;  1NHL A;  1RFS A;  1JB0 J;  3H1J E;  5C39 A;  3A0B H;  2C0X A;  2V4H A;  2YO2 A;  3L4F A;  1VQP P;  4JF7 A;  1BCC D;  2HMK A;  5AW3 B;  1Q81 Q;  1NTK D;  1M90 Q;  4XE5 B;  2FXM A;  1M57 D;  2K1A A;  2PGD A;  1N8R Q;  3TNU A;  4BRY B;  3HUS C;  5AVQ B;  4IL6 H;  5KAF H;  2WPR A;  1L2P A;  1HWT C;  2YO3 A;  2Y0E A;  1H88 A;  1A02 J;  2FFD A;  2B87 A;  4JQ0 D;  2IBZ G;  3G71 P;  1SQV J;  1JTH B;  2KLV A;  1JY3 N;  1VQ4 P;  5BU5 A;  2KUB A;  1YHQ P;  5TJH A;  2CPS A;  4QDF A;  1YBK A;  1EXI A;  4EYY Q;  2W90 A;  3FWL A;  5GTH H;  2O01 J;  1S3J A;  1DD4 A;  3MZW B;  3PJS K;  3MGN A;  3PP5 A;  5KAF E;  5CJ0 A;  2M3B A;  2YFL A;  1LTI C;  3A7O A;  1LT1 A;  3MHV A;  5AVT B;  1SQV G;  1DH3 A;  3VCA A;  1J2J B;  3D71 A;  5APQ A;  3RK3 D;  3VP9 A;  1GDT A;  2I1J A;  4I6M C;  4DOJ A;  1JY3 O;  3VP8 A;  4HM2 A;  3M06 A;  1DEE G;  2WIT A;  1YIJ P;  1K04 A;  1Q86 Q;  2IBZ D;  5GTH E;  1PPJ E;  5KJ7 C;  1X79 B;  3E7K A;  1HVV A;  1AFO A;  3Q1M A;  2BCC D;  1EG9 A;  3II6 A;  5CCG D;  1PV3 A;  3BRV B;  1XTG B;  3VOP A;  1NU1 E;  5K5G B;  1LTG C;  2J59 M;  3CX5 D;  2L91 A;  1SQB E;  5L8R J;  1KIL C;  3MTU E;  3PLN A;  1NJI Q;  2NPS A;  4IOI H;  3L71 E;  1SQV D;  1T3J A;  2Q7C A;  3HE4 A;  3U1A A;  1BSH A;  2YMY A;  2GA1 A;  3BCC J;  3AE5 C;  3U59 A;  3VMX A;  3O8Z A;  1GU4 A;  3AE2 C;  3RK2 B;  1IZN B;  1R5L A;  1KYO H;  3KYQ A;  3CWB G;  4IFD K;  2B9B A;  3GMA A;  1KB9 D;  1SQX K;  2XSO A;  5GTI E;  1N2D C;  1SFC B;  5CCH D;  3FOU A;  1SFC C;  1GD2 E;  3GL2 A;  4WY4 A;  2A06 E;  1KQG B;  4NBD D;  3R4Y A;  2AXT H;  3BCC G;  2K9J B;  3CXH H;  4Z1M H;  2KNC A;  1HF9 A;  3V2R A;  2WSE J;  1PGP A;  2QJP C;  3R2P A;  2OTJ P;  1LWU A;  4W7Z A;  4IFF A;  2XNX A;  5AW5 B;  5B5E E;  1ZRT D;  3EFG A;  3GHG B;  1W2B O;  3GHG C;  4N78 E;  2FYU K;  2N1T B;  1KYO E;  2JO6 A;  2YFI A;  2JJL A;  4QMA A;  1JEK A;  3GTS A;  3V2Q A;  2WQY C;  2WSS H;  1X0T A;  2D2C C;  2HR3 A;  1KQS O;  2B88 A;  3G3Z A;  3P8C E;  2QEX P;  2ZXE B;  5DJU B;  3H1H E;  3W67 A;  3CWB D;  1YQ3 C;  3M9H A;  3CCE P;  4GKG A;  1SQQ J;  3RL0 D;  1FC2 C;  2E5T A;  2JEE A;  3HD7 D;  2IYO A;  3OAK A;  1W2E A;  3KQG A;  1NTK K;  1FU1 A;  4OVN F;  4HM3 A;  3AE6 C;  3CC2 P;  2QSI A;  1IFN A;  2DE5 D;  2L5G B;  3WUU A;  1GK6 A;  4EI2 A;  3GKE A;  3L74 G;  3VMI D;  1N7S C;  1LTJ B;  2Y0D A;  1LTJ C;  1USE A;  2NVE A;  2KXP B;  1LTB C;  1OVR A;  1BCC E;  1EDL A;  1EC5 A;  1M1J A;  1N86 A;  3N0Q A;  3AEA C;  2KB7 P;  3H1K G;  5KLV G;  3RK3 B;  2WTY A;  2P58 A;  3RK3 C;  1OVU A;  4JYC A;  2IFM A;  1FDM A;  3B8E B;  1K9M Q;  4Y28 J;  2DW3 A;  2DE6 D;  2M3E A;  3D70 A;  2KS1 A;  2FFD B;  2B87 B;  3A2A A;  2HML A;  2XND H;  2KZJ A;  1FZG A;  2P7J A;  3S9O A;  2KOG A;  3L72 E;  2KYV A;  2NVF A;  4AUW A;  5CCG C;  3L74 D;  1HTL C;  1ZOY C;  1O7W A;  3HUS A;  2YMK A;  4BRY A;  3Q3D A;  2E75 C;  4PD4 D;  4YXW H;  3TGU J;  1EDI A;  4K3A A;  2OGU A;  2Y9Z A;  5AW0 B;  3H1K D;  4HM5 A;  3CPW O;  2J58 A;  1MZ9 A;  5KLV D;  1JCD A;  3JSV C;  3T97 B;  4EOT A;  2M0B A;  2OYH B;  1JTH A;  3F89 A;  1LTS C;  2OYH C;  3VMH D;  2FYN C;  1YJ9 P;  3L75 D;  3VTP C;  1L0N E;  2Q1K A;  3GZY A;  3TGU G;  1RQV A;  2G8Y A;  1ULJ A;  1SQB J;  3VMZ A;  1FOS E;  3Q5R A;  4P1C H;  1SQV K;  2XU6 A;  1T8Z A;  1QVG O;  1HBW A;  3L71 J;  3H6P A;  2ZYG A;  2KSE A;  1PPJ G;  2BCC E;  1CSB A;  1O7M A;  5CCH C;  2QG4 A;  3L73 E;  3GB4 A;  3C0D A;  1JY2 P;  4D6T J;  3MD0 A;  1KZU B;  1KMI Z;  3IR9 A;  5CXM A;  2HPC B;  3JC2 2;  1BE3 E;  1KC8 Q;  4NBA D;  1J1D B;  1J1D C;  5KJ7 A;  5KTB A;  1NTZ E;  5AVR B;  1NKZ B;  1T6A A;  4GIF A;  2P1J A;  1KFM A;  3EQQ A;  3BVH A;  4D6T G;  3TGU D;  3G9R A;  3H1I E;  3O6Q A;  3GCE A;  1KIL A;  2LKM A;  1Y47 A;  1IC2 A;  2P10 A;  1QVF O;  3RL0 B;  2ZFC A;  3HD7 C;  2ZVO B;  4YTP C;  1MKM A;  5CMZ A;  3WMM 0;  4WY4 B;  2HYN A;  3QH9 A;  2A06 G;  2XSH A;  5M1B A;  2PP6 A;  2KNC B;  3CC4 P;  1RHZ B;  1OW6 A;  3B5N D;  1KD1 Q;  3P32 A;  2QVA A;  4NB9 D;  3H1H J;  1UUV A;  2WSC H;  4B86 A;  1WQL A;  4HM4 A;  4TLF A;  4U3F E;  5AW7 B;  1JO5 A;  1SFC A;  2FXP A;  4UB6 E;  1W5C E;  2IX7 C;  4D6T D;  1AJY A;  2K9Y A;  2K9J A;  2MKV A;  1RF1 B;  3IF4 A;  1RF1 C;  2FYZ A;  3P7K A;  4NPF X;  4L76 A;  1VPC A;  2BEZ F;  3GHG A;  3P8M C;  4I7Z B;  4I7Z C;  1SQX D;  2LXC B;  2QJY B;  1GK4 A;  4L73 A;  3L37 A;  2QJY C;  4R4M A;  2RKL A;  5E79 H;  1U7M A;  1DD3 A;  3ABV C;  1L0L E;  2ZYD A;  5AW1 B;  2E76 C;  5AW8 B;  1Y9B A;  1IK7 A;  1X9V A;  2JWD A;  2RN0 A;  2PRR A;  1OX3 A;  1QX8 A;  3JCU E;  4M3L A;  3SFE C;  2KIK A;  1VQ7 P;  1S9K E;  1SQP E;  1Q90 D;  1FDO A;  4ZMD A;  1O7G A;  2W83 C;  1G1I A;  2A45 H;  3L72 J;  3CXH D;  1S2E A;  4GOD A;  1SQQ K;  3KHU A;  1N7S A;  3M0A A;  1GL2 C;  5E79 E;  1LTJ A;  1LNQ A;  2HMO A;  2KS1 B;  2LR2 A;  1K05 A;  5KLV K;  2Q3W A;  3F5H A;  2CKF A;  5EFW B;  4C7R A;  2D2C D;  2H89 C;  4UB8 E;  1CW5 A;  1LGH B;  1YIT P;  3HUS B;  2QE7 H;  2HOD B;  3D89 A;  1L0N J;  1FS0 E;  2I7F A;  3H1L D;  5TIS E;  1Q2N A;  2XDJ A;  2Z4E A;  2IBZ I;  1HUC A;  2R5B A;  1NAY A;  1OXZ A;  4IFM A;  2P67 A;  5AW6 B;  3L73 J;  2QIW A;  5CCG A;  3L75 E;  3VMA A;  1NAF A;  1EZV G;  1KN7 A;  3CX5 I;  2E4P A;  2M8R A;  1N7S D;  3HRN A;  1NTM E;  2AEJ A;  2WSF J;  1G2C B;  3FX0 A;  3MIW A;  3T97 A;  1NTZ J;  1PP9 J;  3L73 G;  2OYH A;  2GBX A;  1NDO A;  2ZT9 D;  1BDD A;  2GM4 A;  3AEE C;  3B5N B;  3B5N C;  3H1I J;  1TU3 F;  2BMQ A;  2KLU A;  2XKM A;  1P84 D;  1KB9 I;  2N9B A;  3CI9 A;  3PTZ A;  1VF5 D;  4HJG H;  3G6E P;  5CCH A;  1JUN A;  2IYP A;  1PP9 G;  4ZNC A;  1EZV D;  4I2L C;  3LW5 J;  1FZA A;  2H88 C;  4ZKP A;  2E75 D;  3O6Q B;  1H89 A;  1RH5 B;  1KQL A;  1KIL B;  2HPC A;  2H8P D;  5AVW B;  3SWK A;  1PGO A;  2I8D A;  4WWI A;  5GTI H;  1PGQ A;  1LP1 A;  3BRT B;  3PHL A;  5APS A;  4U3F J;  1LT9 C;  3Q2Y A;  1BGY E;  2W8Z A;  1G8K B;  3IAO A;  5B5E H;  3L70 E;  1MFZ A;  2R32 A;  3CME P;  4NBE D;  3HD7 A;  1Q82 Q;  2BAS A;  1PP9 D;  1EDK A;  1WMK A;  2WSC J;  1YJW P;  1VQN P;  1Q90 C;  4ASW A;  2HLO A;  2QJP B;  1BSN A;  1YTZ I;  1VM9 A;  1KIL E;  4MN4 C;  3CCV P;  4TT3 H;  1L0L J;  5AVV B;  1IK9 A;  1SQX E;  3HTK B;  3KZI E;  3M91 A;  1DX7 A;  1FZC C;  1FZB A;  4PV1 D;  2D2C B;  2XRX A;  1RE3 C;  1RIE A;  1FE6 A;  1RF1 A;  3MP7 B;  2W6B A;  1OZH A;  1A02 F;  1FOS F;  4DT0 A;  1QL1 A;  2FYU E;  2W27 A;  3H1J J;  2XV5 A;  4GOE A;  2AEF A;  4EIJ A;  3I56 P;  2R3C A;  3BCC D;  1S4X A;  3A0H E;  2Q3I A;  5CJ4 A;  2ZXX A;  2YXQ B;  4EMJ B;  3EQ2 A;  4JPZ B;  2B1X A;  1OW7 A;  1GW3 A;  5KAI H;  1N7S B;  4PD4 I;  2YFJ A;  1IFD A;  2NWF A;  4NBF D;  3KXD A;  3U1C A;  1BDC A;  1SQQ G;  4QDD A;  1EQ7 A;  2Q6Q A;  1QGK B;  3H1J G;  2ZVN B;  1NTK E;  3BAS A;  1NWQ A;  4JBZ A;  3V2P A;  1SLQ A;  2OYI B;  4HKV A;  2ZT9 B;  1NH4 A;  2OYI C;  2ZT9 C;  3M9Q A;  2FY8 A;  4HM0 A;  2RH0 A;  3H1L E;  1PZQ A;  1GL2 A;  3N7N A;  2IFN A;  3CCJ P;  2A45 G;  2QA4 P;  5KAI E;  4C7N B;  3CLQ A;  1L4A D;  4GOF A;  4W7Y A;  1NTM J;  2MJZ A;  1VF5 C;  5B66 E;  1VDF A;  2M5A B;  5HL4 A;  4HM6 A;  3MUD C;  4H44 D;  2JKV A;  3L36 A;  3SFD C;  1PFI A;  2E75 B;  1SQQ D;  2HOD A;  2E76 D;  2Q3E A;  5APU A;  3AE3 C;  3S4R A;  1E5W A;  4OWF A;  1S5L E;  3H1J D;  3AE4 C;  2PFX A;  3A5T A;  1R5S A;  3RK3 E;  2FYN B;  4WB4 A;  1AQT A;  5APW A;  1NU1 J;  1GL2 D;  5BVZ A;  1KQF B;  2WSF H;  4Y99 C;  3Q5S A;  2IBZ E;  2AEM A;  2B24 A;  4KT0 J;  1YI2 P;  2Y9Y A;  2E42 A;  1WRG A;  1G2C A;  1NO4 A;  3SSU A;  1BGY J;  4RKU J;  4NBC D;  1KOR A;  2WPS A;  2Z5I A;  3B5N A;  3WUT A;  2WPV B;  4WVZ A;  3CX5 E;  1QLE D;  1SJG A;  1NU1 G;  2NZ2 A;  1H8A A;  5H2F E;  3RL0 g;  1O7N A;  1SQB G;  3L70 J;  1SQV E;  1RE4 C;  1IFP A;  2GBW A;  1LP1 B;  1USD A;  3L71 G;  4EDF A;  1T2K D;  1NTZ K;  1S72 P;  4YXD C;  3M0D C;  4PV1 B;  3M9B A;  1OWA A;  3LW5 H;  1BGY G;  4PV1 C;  3AEG C;  2WPQ A;  3A3Y B;  2B89 A;  3TSI A;  2H7H A;  3LID A;  4K35 A;  1YJN P;  2KZI A;  1FZF A;  2QPZ A;  3RBX A;  3CCR P;  5AVU B;  4QUQ A;  1KB9 E;  3IFM A;  3HD7 B;  4UB6 H;  1PPJ D;  1CZQ A;  3H25 A;  1NYH A;  1MFT A;  3DQY A;  1VQL P;  2C9L Y;  1NU1 D;  2IZ0 A;  1FJK A;  1ZN5 A;  1SQB D;  2O3J A;  1ZRT E;  4HH2 A;  4GT1 A;  3L71 D;  2R3S A;  4N6J A;  3N4X A;  4W80 A;  3KPE A;  1ZV8 A;  1KYO I;  1WT6 A;  2FYU J;  3PH0 A;  1UII A;  1H0T A;  5AW4 B;  2AXC A;  1EXJ A;  2WT7 B;  5APY A;  2IZ1 A;  4NBH D;  1QL2 A;  1AA0 A;  3CXH I;  1ZP0 C;  3CWB E;  3FXE A;  1VL2 A; 
#chains in the Genus database with same CATH homology
 1VCK A;  1NYK A;  2HMM A;  5KLI C;  1P84 E;  1KYO E;  1NTM E;  2JO6 A;  2YFI A;  2WSF J;  3GTS A;  2WQY C;  2D2C C;  4H44 B;  4U7J A;  2GBX A;  1NDO A;  1EZV E;  2ZT9 D;  4H44 C;  3AEE C;  3H1H E;  1YQ3 C;  2E76 B;  1TU3 F;  2BMQ A;  1ULI A;  1S1C X;  1DIP A;  2BMO A;  1VF5 D;  3GZX A;  2YIU C;  2J5U A;  2E74 C;  3GLM A;  1U57 A;  4GDO A;  4HM3 A;  3AE6 C;  3LW5 J;  2QSI A;  2DE5 D;  2H88 C;  3GKE A;  2JP3 A;  2E75 D;  1HJ0 A;  3VMI D;  3D6Z A;  1G8J B;  2FBW C;  2NVE A;  2V7Q J;  4HM8 A;  4QCK A;  4P1B H;  1BCC E;  3AEF C;  1PP9 E;  3Q2Y A;  3IN6 A;  3N0Q A;  3AEA C;  3AEC C;  4QUP A;  3AED C;  1O7H A;  1G8K B;  3IAO A;  2JZA A;  2DE7 D;  3L74 E;  3EN1 A;  3AEB C;  4NBG D;  3AE8 C;  4PD4 E;  3C8V A;  3L70 E;  4Y28 J;  2DE6 D;  4NBE D;  3D70 A;  3GL0 A;  3H1K E;  2HML A;  2ZYL A;  5KLV E;  4QUR A;  4AAY B;  1WMK A;  2YVJ B;  2WSC J;  1ZME C;  3GOB A;  3S9O A;  2BEQ D;  3L72 E;  1Q90 C;  2NVF A;  1ZOY C;  1O7W A;  2QJK C;  2YMK A;  1VM9 A;  3EWK A;  1KIL E;  2E75 C;  3Q3D A;  4TT3 H;  1OMI A;  2HMN A;  2NUK A;  1SQX E;  1O7P A;  3GF3 A;  3AE7 C;  4HM5 A;  3T97 B;  4PV1 D;  1S5L X;  3BCC E;  3GF7 A;  2D2C B;  3VMH D;  4HM1 A;  2XRX A;  4QDC A;  1RIE A;  2FYN C;  1L0N E;  3GZY A;  1RQV A;  2E4Q A;  2G8Y A;  1ULJ A;  3Q5R A;  4OGQ D;  4P1C H;  2FYU E;  1KTM A;  2BCC E;  1O7M A;  3AE1 C;  3L73 E;  3GB4 A;  2E74 B;  3C0D A;  3GTE A;  4EMJ B;  4H13 D;  3TGU E;  2B1X A;  1OW7 A;  1KMI Z;  5CXM A;  2JO1 A;  1BE3 E;  2YFJ A;  2NWF A;  4R4L A;  4NBA D;  5KKZ C;  3AZC A;  4NBF D;  1NGM B;  3B71 A;  4QDD A;  2IDB A;  1NTK E;  1NTZ E;  1PIX A;  4H0L D;  4HJL A;  3VCP A;  2BMR A;  2G3A A;  4HKV A;  2OQQ A;  3EQQ A;  2ZT9 B;  1JM1 A;  2ZT9 C;  3G9R A;  3H1I E;  4HM0 A;  3O6Q A;  3GCE A;  3H1L E;  1SQQ E;  1OW8 A;  2P10 A;  1RFS A;  1JB0 J;  3H1J E;  3Q5P A;  4YTP C;  2HMK A;  1MKM A;  1VF5 C;  2XSH A;  5HL4 A;  4HM6 A;  4H44 D;  5M1B A;  1OW6 A;  4AIV A;  1YQ4 C;  3VMG D;  4NB9 D;  3SFD C;  2E75 B;  2E76 D;  3AE3 C;  1UUV A;  3FGA D;  1WQL A;  4HM4 A;  3AE4 C;  2NVG A;  4U3F E;  2HMJ A;  2FXP A;  1AJY A;  3RK3 E;  2K9Y A;  2MKV A;  4QDF A;  1EXI A;  2O01 J;  4XFJ A;  1R8E A;  1KQF B;  3AE9 C;  3Q5S A;  2IBZ E;  1DD4 A;  2BEZ F;  4I7Z B;  2B24 A;  4KT0 J;  4I7Z C;  2YFL A;  3VCA A;  2QJY C;  4NBB D;  4R4M A;  3D71 A;  2XR8 A;  4RKU J;  4NBC D;  1KOR A;  3CXH E;  3D6Y A;  1FQT A;  4HM2 A;  2WPV B;  1DD3 A;  3ABV C;  3CX5 E;  1L0L E;  1SJG A;  2NZ2 A;  2E76 C;  1Y9B A;  1IK7 A;  3RL0 g;  1O7N A;  1K04 A;  1SQV E;  2GBW A;  1PPJ E;  1UIX A;  3SFE C;  4IL6 X;  4YXD C;  4PV1 B;  4HM7 A;  4PV1 C;  3AEG C;  3Q1M A;  1FDI A;  1SQP E;  1EG9 A;  1Q90 D;  1FDO A;  1PV3 A;  1O7G A;  1NU1 E;  5BOK A;  1SQB E;  5L8R J;  2QPZ A;  3L71 E;  4OGQ B;  4QUQ A;  2HMO A;  1KB9 E;  4OGQ C;  1UUW A;  1K05 A;  2Q3W A;  3H25 A;  2CKF A;  1NYH A;  4NB8 D;  1VF5 B;  3DQY A;  2D2C D;  2H89 C;  3AE5 C;  5AEU A;  4H13 B;  4H13 C;  3AE2 C;  3D89 A;  1ZRT E;  2I7F A;  3GMA A;  2XSO A;  3FOU A;  2NUM A;  4H0L B;  3GL2 A;  1RQU A;  2A06 E;  1KQG B;  4NBD D;  4H0L C;  1EXJ A;  3R4Y A;  2E74 D;  4Z1M H;  4NBH D;  5AEW A;  1HF9 A;  2QIW A;  3L75 E;  1PL5 A;  2WSE J;  4QDF B;  2QJP C;  1GMJ A;  1ZP0 C;  3CWB E;  2E4P A;  1VL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...