4H0LD

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
161
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
total genus 26
structure length 161
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h0lD02
2GBWA 4HM7A 3D89A 4U3FE 2NWFA 2B1XA 2XR8A 1Q90C 4PV1C 2QJYC 4HKVA 4QDFB 1BE3E 3L75E 4H0LD 3H1LE 3FOUA 4NB9D 1O7WA 2IBZE 4P1BH 4HM6A 3GTEA 1SJGA 1ULIA 2XSOA 2NUMA 1JM1A 1SQBE 4H44C 2HMLA 2Q3WA 3GL2A 3CXHE 2HMJA 2E74D 1KB9E 1VCKA 3GCEA 4QCKA 1O7HA 5HL4A 1VF5D 3GL0A 4HM5A 2BMRA 4NBDD 2BCCE 1O7NA 4NBBD 1NTME 4NBGD 4EMJB 3DQYA 5AEWA 2E4QA 4HM0A 3VMGD 4H13C 4NB8D 3CWBE 3GZYA 5AEUA 1G8KB 4OGQD 2XRXA 4HM8A 4QDDA 2E76C 1BCCE 2E75C 1PPJE 3C0DA 2XSHA 2HMMA 2E4PA 1SQXE 2NVEA 4H13D 2QJKC 2I7FA 4PV1D 4AAYB 1EZVE 1WQLA 3EQQA 2HMOA 1SQQE 2E76D 4QDFA 1SQPE 2E75D 5KLVE 1NDOA 3GZXA 1VM9A 2ZYLA 1KYOE 1NYKA 2B24A 2DE5D 2JO6A 3AZCA 4H44D 3GB4A 3H1KE 2NVFA 2YFJA 2NVGA 5CXMA 1RIEA 1UUVA 3H1IE 1NU1E 4HJLA 4P1CH 2CKFA 1P84E 1EG9A 3TGUE 3L71E 2BMOA 1O7GA 1O7PA 2YVJB 4HM3A 2FYUE 2A06E 3L73E 3VMHD 1O7MA 2JZAA 2YMKA 2DE7D 4NBCD 1FQTA 4NBHD 4QDCA 2YIUC 3GOBA 1NTKE 2HMKA 5BOKA 1RFSA 2D2CC 4QUQA 2DE6D 2QPZA 3EN1A 5KLIC 3VMID 5KKZC 2QJPC 3GKEA 4QURA 2YFIA 4NBAD 2BMQA 1PP9E 3H1JE 3L70E 4NBED 2ZT9C 4HM1A 1L0LE 2E74C 4QUPA 4HM4A 4PD4E 2D2CD 1VF5C 1G8JB 3VCAA 3H1HE 3N0QA 4HM2A 4NBFD 3GTSA 3VCPA 4I7ZC 4AIVA 1ZRTE 2GBXA 2NUKA 3CX5E 2ZT9D 1NTZE 2HMNA 2YFLA 2FYNC 3BCCE 1ULJA 1SQVE 3L74E 4OGQC 1L0NE 1UUWA 4H0LC 3L72E
chains in the Genus database with same CATH superfamily
4A7PA 1YBKA 1KQSO 4U3FE 3P8MC 4UB6E 3M0AA 1DEBA 3O8ZA 3H6PA 2M0BA 1IO4A 1K73Q 1NH4A 3L75J 1SQBE 4H44C 2UWJE 5KAFE 4N78D 1JMMA 2A06G 4QCKA 4HB1A 4EYYQ 2HODA 3CCVP 4H44B 3P7KA 1O7NA 2IBZI 1GZLA 2KI7B 4HM0A 1YHQP 1S3JA 3ABVC 3H1KJ 4RJTA 4HM8A 1NJIQ 3L70G 2E76C 3C0DA 1EDKA 3V2RA 4H13D 4ASWA 2E76B 3L73J 2HMOA 3L75D 4RO0A 1L0NK 1AVOA 3HD7D 2DE5D 3L72G 3GB4A 1NAYA 4D6TD 1IFPA 3TGUE 5CCGD 1L0LJ 1CSBA 1A02J 4HM3A 1N73C 2JR8A 4GT1A 1NWQA 1NTKE 1N73B 2QPZA 1CI6B 1IFMA 3AEBC 5GTHH 3FGAD 3D70A 4JQ0D 1RY3A 3G71P 1ZW0A 2M3EA 5TISE 2WSEH 2POHA 2GUSA 1IFIA 3CX5E 2AEJA 1L4AA 1OVUA 1DIPA 1K05A 2BEZF 1P84D 1AJYA 1NHLA 2N1TA 2NWFA 1H0TB 1OXZA 1NU1G 4LC1A 4Y28J 1VQKP 1FZCA 5AW2B 1X9VA 1VCKA 4WB4A 2Q7CA 1KILA 3GLMA 2N9YB 3TGUD 2BCCE 3CLQA 2OYOA 3HUSC 5DJTB 3CC4P 1EQ7A 2WSCH 1L0LK 3CXHI 3CC7P 3HUSB 1LTIC 3L4FA 2KSJA 3A0HH 2XKMA 3KZIH 1BDDA 3U59A 2I1JA 2K37A 3II6A 1EZVE 3AE2C 1SQQE 2RH0A 5KJ7C 1L0NG 1S5LX 3BASA 1YJNP 3BVHA 2OYIC 1LTJA 2RMZA 3H1LG 2XV5A 2OYIB 2R3SA 4W80A 1K9MQ 2DE7D 1ZV8A 2WZ7A 2D2CC 3VMID 3RK3C 4ZKPA 1USDA 4IFFA 1IFNA 1PP9E 2D2CB 2ZYDA 4NBED 2ZT9C 2Y0DA 3RK3B 3PP5A 1G8JB 1GU5A 2ZT9B 3Q1MA 1MFTA 1FS0E 5CJ4A 1R8EA 2FYNC 5CCHD 3G4SP 3OJAB 3HE4B 4PD4I 2FYNB 1NTMJ 3H1KG 3KDPB 1EZVD 3B4SA 1LT9C 2ZAEB 2ZVNB 1N73A 1CI6A 5APYA 1N8RQ 2XSOA 3L36A 2P67A 3L73G 3B5ND 3H1HD 5CCGC 3E7KA 2YNYA 2QIWA 2XDJA 2LKMA 3ITKA 2FXMA 1RH5B 3MIWA 1JUNA 1L0LG 2E43A 5AW3B 1SQXE 5AVUB 2I7FA 4PV1D 1X22A 2J59M 1SFCD 5KLVE 1H0TA 3IF4A 1NDOA 2ZYLA 5AW0B 3KPEA 3L74G 2JO6A 1SQPJ 4JYBA 2YFJA 1OMIA 2G8YA 2OTLP 1LT1A 3CCLP 1X0TA 2O1KA 2HMKA 3HUSA 4N3YB 1BCCD 3S4RA 1NTMK 4NBAD 4N6JA 2G3AA 1FZFA 1SQPD 1BE3J 1ZRTE 3EFFK 2HMNA 5KJ7A 4JF7A 3SWYA 1AA0A 4GODA 1NOHA 3G9RA 2J5UA 4U7JA 2OQQA 2KK7A 4I1LA 1O7WA 4BWNA 1JM1A 3F89A 3H1JD 2E5YA 2P2UA 4IFDK 2E4QA 2K1AA 1G8KB 3HE5B 1FOSE 3HE4A 1LWUB 3I55P 3MUDC 3V4QA 2E5TA 2ZYAA 2QA4P 1X79B 5E79E 2QG4A 2H43A 4ASVA 5AW8B 4M3LA 4YXWH 2QVAA 2GM4A 3H32B 2WPSA 4P1CH 2QM8A 2CKFA 1N7SB 2IZ1A 2MJZA 5AVQB 2W83C 4YTPC 3G6EP 1OIPA 2A45G 5AW5B 1FU1A 3G3ZA 3BCCJ 1XTCC 2C9NY 2AXTH 3VMAA 1ZLLA 1NTMG 3KZIE 5TJHA 1JY2O 2QM7A 1KQLA 3N0QA 4EOTA 2KP8A 1CW5A 1NTZE 2O01J 2YFLA 3Q2YA 2BASA 3SSUA 5GTIH 1YTZT 4DZOA 2A06D 1T2KD 5B5EE 3TF5A 2CK3H 4PV1C 2O01N 1SFCC 1AVYA 3H1IG 4PV1B 2B9BA 1H89A 1Q90D 4GKGA 1SFCB 3GL2A 3L70D 3GCEA 3Q5SA 2H7HA 1BGYG 3PLNA 1EXJA 3PHLA 3EQ2A 5AEWA 2NPSD 1J1EC 1KTMA 1OW6A 4WY4D 1M57D 4B86A 3JC22 3L72D 3NXSA 1J1EB 4DOJA 3VOPA 1Y8AA 2IFNA 1ZN5A 4AAYB 3BRTB 2IPPA 2CPSA 3EFGA 2A45H 3JCUH 1VQ7P 3TYYA 4R4MA 3WMM0 1E79H 4O9BA 1FZEA 1IC2A 1K04A 1AV1A 2H8PD 2A45I 1BE3G 1NU1J 2IBZG 3WU2H 1UIXA 3M9BA 4KJMA 4OH8B 2IDBA 1L2PA 1HBWA 1Y47A 3GOBA 3AE3C 4QUQA 3HE5A 1YITP 3CCEP 1LWUA 3SFEC 2ZVOB 4IL6H 4N78E 3Q5RA 1HUCA 1FBMA 3VCAA 3CWBG 1USEA 2BEQD 2KIKA 1NKZB 4C46A 2NUKA 2L5GB 3H32A 1AQTA 1NU1D 5B66H 3QH9A 2PGDA 1N7SA 2N9BA 1Q2NA 4UB8E 2Q3IA 2XR8A 2WPQA 2YXQB 4HKZH 2FKWB 2Z4EA 5KLIB 3L75E 2XNDH 2FFDC 3ZDMA 2P58A 3E1RA 4HM6A 1SJGA 1S9KD 3CCUP 1ULIA 3H1LJ 2W6JH 2FFDB 3KYQA 4WWIA 4D6TE 3NMDA 2B87B 2FYUG 3GHGC 1M1JC 1Q82Q 3GHGB 1M1JB 2WSFJ 3P8CD 3A0BH 1NU1K 1L0ND 3PTZA 1SP4A 2W27A 3LIDA 2HMMA 2E4PA 3I5CA 1VQ5P 3CI9A 4BRYB 4OVNF 1UIIA 3H1LD 5EFWB 3BCCG 1WMKA 1P84E 1KB9I 1VQOP 1IK7A 1T2KC 4I6MC 1HF9A 1S5LH 1RFSA 2PP6A 3GF7A 3RL0D 3AEEC 5AVWB 4TLFA 4Y99C 1KYOH 2DW3A 5AW9B 1RHZB 4Y99B 4IL6X 5AVTB 4I7ZC 3HTKB 3H1KD 1KYOI 2NPSC 3MTUE 2Z5IA 4I7ZB 2WVRA 4H0LC 2NPSB 2Q3EA 3L74J 1ZXGA 3L73D 4H0LB 1JNMA 2ZJSE 3FWLA 3L71G 4AQRD 3M9HA 2AXTE 1G2CB 2K9JB 2HMJA 2W90A 1L0LD 1T3JA 4W7YA 1GL2D 1LTAC 1FAVA 1VQ4P 5CMZA 1BDCA 3AE4C 3AE6C 1PGPA 4OGQD 3L74D 1PZQA 2E75C 2JKVA 5GTIE 5DJUB 1LP1B 2E75B 2O01H 5K5GB 1M90Q 1IFJA 2I1KA 3CXHH 2P7JA 2FFDA 1UUVA 1R5SA 2Y9ZA 2B87A 1O7GA 1O7PA 1QEXA 5KAIH 1EDLA 3A3YB 1GU4A 3KXDA 1FC2C 1WRGA 2LR2A 3GHGA 1M1JA 4DT0A 5AW4B 1KD1Q 2R5DA 5APTA 2YIUC 2XU6A 1X8YA 3OAKA 3VYIA 1RE4C 3AE9C 2YIUB 1VQ8P 1YQ4C 1URQD 2ZXXA 4XFJA 1N7LA 2WMMA 3H1HE 1GK6A 1U7JA 2ZYGA 5H2FE 1PPJG 2QRXA 3V2PA 5M1BA 1FDIA 3FOUA 2QE7H 1DEEG 4PD4H 1GW4A 1VDFA 2E74D 1M8OB 1O7HA 2IYOA 5AW1B 3H25A 4IL6E 2O1JA 4C7NB 5AW6B 1SQQJ 4EIJA 4NBGD 3HTKA 4H13C 3WUTA 4NB8D 2XRXA 3L35A 1BCCE 3VMYA 3N7NA 4H13B 1W2BO 2NPSA 3HD7C 2YKPA 3FXDA 1YI2P 3MD0A 1LT9B 3MGNA 1SQPE 3HD7B 3GW6A 1SQVG 2B24A 2ITAA 3MZWB 4ZNCA 4U3FG 4HJLA 1G2CA 2K9JA 4RKUJ 1MKMA 3V5BA 3H1IJ 1G1IA 1NTMD 2R32A 1FZAA 1SQBG 4I2LC 5APWA 1VQPP 1BGYJ 2P10A 3CPWO 3H1JE 2WSFH 1LP1A 3P32A 2HFED 1KC8Q 1MV8A 4EDFA 1HTLC 4C7RA 3AEGC 3HRNA 3H1ID 1SQQK 2WITA 4OGQC 2PFXA 3D89A 1FJKA 5BU8B 2Z5HA 1S5LE 3TGUG 2NUMA 2HMLA 2NRGA 1YJ9P 4JBZA 1KN7A 1SQXJ 5AVRB 1RE4A 3U1AA 2BMRA 2Y0CA 1NTKG 4QMAA 5KLVJ 2FY8A 2OYIA 1JY3N 2WPVB 3C8VA 4UB6H 3KQGA 3CWBJ 1URQC 5GTHE 1EC5A 1BE3D 1YQ3C 2IBZD 3A2AA 3RGUA 2YKOA 1ZP0C 3CCJP 1NYKA 1JY2P 1URQB 2XZRA 3CCMP 1L4AD 1KB9D 1NGMB 1M56D 2GA1A 2BMOA 4L75A 1Q7YQ 5AVZB 4C7NA 2YVJB 2N1TD 2A06E 1KQGB 1VL2A 3CWBD 3M0DC 4NBHD 2FYUJ 1AFOA 3GKEA 1P84I 3R4YA 2FBWC 5APQA 1JM0A 2BCCG 1KZUB 3C1LA 3L70E 1LT9A 1QLED 2E74C 2H88C 2R44A 1KILD 3R2PA 5CCHC 3HD7A 2JWDA 1KYOD 1OW8A 4NPFX 1SQXK 3V4WA 1NYHA 3L37A 1Q86Q 2JP3A 3OA7A 5CCGA 1EZVG 2FXPA 3L72E 5KLVK 2H89C 1SQQG 4HH2A 2FYUD 3GMAA 3LW5H 3A0HE 1BSHA 4MN4C 2WQYC 4YPCA 3B5NC 1FE6A 1JMBA 1IK9A 3B5NB 4HYTB 4TT3H 3M91A 4NBDD 4R4LA 2K88A 2KNCB 5AVYB 1DD3A 3VMGD 2Y9YA 3BCCD 3CX5I 1PP9G 2V4HA 4JPZB 2YO2A 3BRVB 3SWKA 2OTKE 2FYUK 5C39A 2K9YA 3V2QA 2AEFA 2E76D 2PAJA 2E42A 1GTWA 3TNUB 3IFMA 4K35A 3CXHD 1IFDA 1NU1E 2HPCB 1VQNP 2Q6QA 3GG2A 2C0WA 1JCDA 3VMXA 1HWTC 3AEDC 3C9IA 3IAOA 2OARA 3L71J 3VMHD 2MKVA 1OZHA 2JDIH 4GDOA 5KKZC 1OX3A 1PGQA 5CBOA 1S9KE 2V7QJ 1KORA 2YMYA 5KKZB 2KSEA 4HM4A 1EZVI 4XE5B 1URQA 2VRSA 3P8CE 1QL2A 3B8EB 4IOIH 1SQXG 1CZQA 1QX8A 2KS1B 1L0NE 3L71D 5AW7B 5KLVG 2XNXA 5AVSB 2QJYC 5BVZA 1QVGO 2GUVA 3H1JG 3H1LE 1JCCA 3V2NA 3GTEA 3MUDA 2QJYB 1S72P 3VTPC 1FJPA 4GOEA 4PD4D 1RF1C 2FYZA 2Y0EA 1DX7A 2W8ZA 2B89A 3CC2P 2N1TC 1RF1B 1ZR2A 5CCHA 2KOGA 3GZYA 4QDDA 3M9QA 1FOSF 1GD2E 2NVEA 4IFMA 1VPCA 3EQQA 4WBAA 1KFNA 3GZXA 3H1KE 2NVGA 4GOFA 4PJ0H 3W67A 2OGUA 1Y9BA 3B5NA 5KJ7D 3VMZA 1HVVA 2JO1A 2LXCB 3L73E 1EDJA 2KNCA 1JO5A 1FQTA 1LGHB 1KQFB 5L8RJ 3F5HA 3VP8A 3GF3A 1PPJD 1H8AA 1KB9H 1RQUA 3UIAA 1L0LE 1SFCA 1N2DC 2D2CD 2KZIA 3RK3D 2R3CA 1LTJC 2HYNA 1LTSC 3VCPA 3TNUA 4AIVA 2ZT9D 5APSA 1LTJB 1ULJA 4ZMDA 4D6TJ 2HPCA 3L74E 1KV4A 2GBWA 4HM7A 2C9LY 1SQVJ 4BXLA 1ZMEC 1Q90C 1LNQA 1S4XA 1HH0A 3CL3D 4U3FJ 4HKVA 1FDOA 1IJDB 4P1BH 1PGJA 4Z1MH 1D7MA 2OYHC 2SPZA 1T8ZA 1OVVA 4WY4C 1SQBJ 1LJ2A 3USSA 2OYHB 5BU5A 1EXIA 4NBBD 4WY4B 1JOCA 1YYCA 2IFMA 2AXCA 1SQVD 1J2JB 1E5WA 2KS1A 3D71A 1ZR4A 4U3FD 2QJKC 1NTZG 3PJSK 2R5BA 1QGKB 2QJKB 3RL0g 4YXDC 1SQBD 3V6IA 3WUUA 5CXMA 2WPRA 1RIEA 2FXOA 2HLOA 1OVRA 2W6AA 1EG9A 1IZNB 3TGUJ 1RF1A 1GMJA 5KTBA 3VP9A 4NBCD 4QDCA 1SQVK 5BOKA 5E79H 1JTHB 1SVFA 3AEAC 1J1DC 1NTKJ 3LW5J 1M1KQ 4HM1A 5AVVB 4QUPA 1M7LA 1ZOYC 1J1DB 1R5LA 1U7MA 1PGOA 4NBFD 3EWKA 4NPEA 3CD6P 1SQBK 4KT0J 4DJGA 1RQVA 1SLQA 3B71A 1JEKA 4BRYA 1EDIA 4QDFB 4EI2A 1MZ9A 3K5BA 1NTKD 3JCUE 3Q3DA 5HL4A 2RN0A 2YKQA 1VQ6P 3FWNA 1NTME 3CX5D 2V7QH 2BCCJ 3WU2E 5APVA 1VQLP 5B5EH 1JB0J 1U57A 3AE5C 1MUUA 5APXA 3RBXA 2KUBA 3AEFC 1NTKK 2B88A 2WWWA 3CCSP 1OWAA 3T97B 3H1IE 2ZFCA 1A02F 3L75G 2OYHA 2BCCD 5B66E 1N7SD 3H1HJ 4WY4A 3RK2D 3RL0C 1NVOA 1BGYE 4D6TG 3D6ZA 3BATA 2DE6D 3IR9A 3RL0B 2JWAA 1TU3F 1NAFA 1T3UA 2JEEA 2LXBA 2RKLA 1HGZA 4L76A 1SQQD 1PP9J 2Q1KA 3JSVC 3GTSA 2HR3A 3LIEA 4W7ZA 4GIFA 2NZ2A 4PJ0E 3A0BE 3NFQA 2L91A 3TDKA 1JY3P 3A7OA 2IX7C 1BE3E 4NB9D 2IBZE 1VQ9P 1GL2C 1JTHA 2M5AB 1BCCJ 2Q3WA 1PP9D 1KB9E 2QSIA 1VF5D 1GL2B 2WTYA 3DQYA 1FZBA 4OGQB 3CWBE 1HGVA 1BGYD 4UB8H 4L73A 2WT7B 1FDMA 3NTNA 2XSHA 3IN6A 3E1IA 3OW2O 4QDFA 1KILE 3A5TA 3PRJA 1KYOE 3AE1C 4WVZA 2I8DA 2O3JA 3H1JJ 1QVFO 1K8AQ 1JY3O 2FYUE 2WSSH 2M3BA 1OW7A 1Q81Q 4AYCA 1Z56A 4QURA 5KAFH 1YJWP 1RF0C 1SQXD 2ZXEB 1AQ5A 1VQMP 2CPBA 1DH3A 5APUA 3KHUA 5KLVD 2K3RA 4KHXA 2IZ0A 1WT6A 1FZGA 3MP7B 4L74A 5CBNA 1P84H 3T97A 1PV3A 3BCCE 2KYVA 1SQPK 1UUWA 1H88A 1LWUC 1KMIZ 1YTZI 3N4XA 1HJ0A 2E74B 2J58A 3I56P 1GDTA 3AE8C 2Q9IA 3CXHE 4RESB 4JYCA 1LTTC 2P1JA 3GL0A 1N7SC 1ZRTD 4EMJB 2Q5UA 3AE7C 2KB7P 5KAIE 3RK2C 3O6QB 2WSEJ 1W2EA 1QL1A 3RK2B 3H1HG 3TSIA 4CPGA 1WQLA 5TISH 1LTBC 2YXRB 1RE3C 3CX5H 3U1CA 1VM9A 1JY2N 3AZCA 4H44D 4HJGH 2M5AA 4LLHA 2JJLA 3L70J 3L71E 1GL2A 1YIJP 1KFMA 2KLUA 3RBZA 1S2EA 3CMEP 2JZAA 4DCKA 2OTJP 1XTGB 2AEMA 2WT7A 1SS1A 2YFIA 3L72J 2WSCJ 2IYPA 1N86A 3SFDC 2HODB 4PD4E 1VF5C 4LGDE 1NKNA 4XA4A 4HM2A 3S9OA 1BCCG 1VF5B 4AUWA 3FX0A 1NTZJ 2KZJA 1SQPG 3PH0A 2B1XA 1S1CX 3W68A 1OFCX 4H0LD 2KXPB 2HG5D 1GK4A 5H2FH 4HM5A 3FXEA 1RF0A 2PRRA 3SWFA 1NTZD 5AEUA 1PFIA 5CHXA 1PPJE 4ZKUA 1HJBA 1LTGC 3M0DA 2M8RA 3TK1A 1L4AC 1DD4A 2E75D 1BSNA 3RK3E 1NO4A 3CCRP 1L4AB 3D6YA 2NVFA 2KLVA 2N1TB 3WUVA 3S1KA 5CJ0A 3QWOC 1FZCC 1O7MA 1NTZK 2YMKA 3M06A 3CMAP 3O6QA 1FZCB 5KLIC 3EN1A 1KILC 2QJPC 1L0NJ 3MHVA 2YO3A 1G1JA 5AVXB 2BMQA 4K3AA 3VN0A 3Q5PA 1MFZA 1KILB 2QJPB 1PIXA 4NPDA 2W6BA 4OWFA 1W5CE 3AECC 3CCQP 1PL5A 2GBXA 2QEXP 1RE3A 1SQVE 2C0XA 1T6AA 1GW3A
chains in the Genus database with same CATH topology
3D89A 4U3FE 3B71A 4PV1C 4QDFB 4PV1B 2NUMA 1SQBE 4H44C 1Q90D 2HMLA 3GL2A 3GCEA 3Q3DA 3Q5SA 4QCKA 5HL4A 4H44B 2BMRA 1O7NA 1EXJA 1NTME 5AEWA 4HM0A 1KTMA 1OW6A 3ABVC 2WPVB 4HM8A 3C8VA 2E76C 1JB0J 3C0DA 1U57A 4H13D 3AE5C 2E76B 4AAYB 2HMOA 1YQ3C 3AEFC 1ZP0C 1NYKA 2DE5D 3GB4A 3T97B 4R4MA 3H1IE 1K04A 1NGMB 3TGUE 2BMOA 2YVJB 4HM3A 1UIXA 2A06E 1KQGB 1VL2A 2IDBA 4NBHD 3D6ZA 3GOBA 3AE3C 1NTKE 4QUQA 2DE6D 2QPZA 3GKEA 3AEBC 3R4YA 1TU3F 2FBWC 3FGAD 3SFEC 3D70A 3L70E 2E74C 2H88C 3Q5RA 3VCAA 2BEQD 1OW8A 3GTSA 3CX5E 2NUKA 1NYHA 2JP3A 1DIPA 1K05A 2BEZF 2NZ2A 1AJYA 2FXPA 3L72E 2H89C 2NWFA 3GMAA 2XR8A 1BE3E 3L75E 2WQYC 4NB9D 2IBZE 4HM6A 4Y28J 1SJGA 1ULIA 2Q3WA 1KB9E 1VCKA 2QSIA 4TT3H 1VF5D 3GLMA 4NBDD 4R4LA 2BCCE 2WSFJ 3DQYA 4OGQB 1DD3A 3VMGD 3CWBE 2XSHA 2HMMA 2E4PA 1EZVE 3IN6A 3AE2C 2K9YA 1SQQE 2E76D 4QDFA 1KILE 1KYOE 1WMKA 1S5LX 3AE1C 1NU1E 1P84E 3AEDC 3IAOA 1IK7A 2FYUE 3VMHD 1OW7A 2DE7D 2MKVA 1HF9A 1RFSA 2D2CC 4GDOA 5KKZC 3VMID 3GF7A 4QURA 2V7QJ 1KORA 3AEEC 1PP9E 2D2CB 4NBED 2ZT9C 4HM4A 1G8JB 2ZT9B 3Q1MA 4IL6X 4I7ZC 1R8EA 2FYNC 1PV3A 3BCCE 1L0NE 1UUWA 4I7ZB 4H0LC 1KMIZ 4H0LB 2QJYC 3H1LE 1HJ0A 3GTEA 2XSOA 2E74B 3AE8C 3CXHE 2HMJA 3GL0A 4EMJB 3AE7C 2QIWA 3AE4C 3AE6C 3GZYA 4OGQD 4QDDA 2WSEJ 2E75C 1SQXE 2NVEA 2I7FA 4PV1D 2E75B 1WQLA 3EQQA 5KLVE 1NDOA 3GZXA 1VM9A 2ZYLA 2JO6A 3AZCA 4H44D 3H1KE 2YFJA 2NVGA 1OMIA 1UUVA 1Y9BA 2G8YA 3L71E 1O7GA 1O7PA 2JO1A 3L73E 2JZAA 1FQTA 1KQFB 2YIUC 5L8RJ 2HMKA 3GF3A 2YFIA 3AE9C 4NBAD 2WSCJ 1RQUA 2G3AA 1YQ4C 3SFDC 1L0LE 4XFJA 4PD4E 2D2CD 1VF5C 3H1HE 4HM2A 3VCPA 4AIVA 3S9OA 1ZRTE 1VF5B 2ZT9D 2HMNA 5M1BA 1ULJA 3L74E 2GBWA 4HM7A 3G9RA 2B1XA 1FDIA 1ZMEC 1Q90C 1S1CX 2J5UA 4HKVA 1FDOA 4H0LD 4U7JA 3FOUA 2OQQA 1O7WA 4P1BH 4Z1MH 1JM1A 2E74D 1O7HA 3H25A 4HM5A 1EXIA 4NBBD 4NBGD 2E4QA 4H13C 4NB8D 5AEUA 1G8KB 2XRXA 1BCCE 1PPJE 4H13B 3D71A 2QJKC 1DD4A 1SQPE 2E75D 3RK3E 3RL0g 2B24A 4YXDC 3D6YA 2NVFA 5CXMA 1RIEA 4HJLA 4P1CH 2CKFA 1EG9A 4RKUJ 1MKMA 4YTPC 1O7MA 2YMKA 1GMJA 4NBCD 4QDCA 3O6QA 5BOKA 5KLIC 3EN1A 2QJPC 3AEAC 2P10A 3LW5J 2BMQA 3H1JE 4HM1A 3Q5PA 4QUPA 1PIXA 1ZOYC 3N0QA 4NBFD 3EWKA 3AECC 1PL5A 2GBXA 2O01J 4KT0J 1NTZE 3AEGC 2YFLA 3Q2YA 1SQVE 4OGQC 1RQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBW A;  4HM7 A;  3D89 A;  4U3F E;  2NWF A;  2B1X A;  2XR8 A;  1Q90 C;  4PV1 C;  2QJY C;  4HKV A;  4QDF B;  1BE3 E;  3L75 E;  4H0L D;  3H1L E;  3FOU A;  4NB9 D;  1O7W A;  2IBZ E;  4P1B H;  4HM6 A;  3GTE A;  1SJG A;  1ULI A;  2XSO A;  2NUM A;  1JM1 A;  1SQB E;  4H44 C;  2HML A;  2Q3W A;  3GL2 A;  3CXH E;  2HMJ A;  2E74 D;  1KB9 E;  1VCK A;  3GCE A;  4QCK A;  1O7H A;  5HL4 A;  1VF5 D;  3GL0 A;  4HM5 A;  2BMR A;  4NBD D;  2BCC E;  1O7N A;  4NBB D;  1NTM E;  4NBG D;  4EMJ B;  3DQY A;  5AEW A;  2E4Q A;  4HM0 A;  3VMG D;  4H13 C;  4NB8 D;  3CWB E;  3GZY A;  5AEU A;  1G8K B;  4OGQ D;  2XRX A;  4HM8 A;  4QDD A;  2E76 C;  1BCC E;  2E75 C;  1PPJ E;  3C0D A;  2XSH A;  2HMM A;  2E4P A;  1SQX E;  2NVE A;  4H13 D;  2QJK C;  2I7F A;  4PV1 D;  4AAY B;  1EZV E;  1WQL A;  3EQQ A;  2HMO A;  1SQQ E;  2E76 D;  4QDF A;  1SQP E;  2E75 D;  5KLV E;  1NDO A;  3GZX A;  1VM9 A;  2ZYL A;  1KYO E;  1NYK A;  2B24 A;  2DE5 D;  2JO6 A;  3AZC A;  4H44 D;  3GB4 A;  3H1K E;  2NVF A;  2YFJ A;  2NVG A;  5CXM A;  1RIE A;  1UUV A;  3H1I E;  1NU1 E;  4HJL A;  4P1C H;  2CKF A;  1P84 E;  1EG9 A;  3TGU E;  3L71 E;  2BMO A;  1O7G A;  1O7P A;  2YVJ B;  4HM3 A;  2FYU E;  2A06 E;  3L73 E;  3VMH D;  1O7M A;  2JZA A;  2YMK A;  2DE7 D;  4NBC D;  1FQT A;  4NBH D;  4QDC A;  2YIU C;  3GOB A;  1NTK E;  2HMK A;  5BOK A;  1RFS A;  2D2C C;  4QUQ A;  2DE6 D;  2QPZ A;  3EN1 A;  5KLI C;  3VMI D;  5KKZ C;  2QJP C;  3GKE A;  4QUR A;  2YFI A;  4NBA D;  2BMQ A;  1PP9 E;  3H1J E;  3L70 E;  4NBE D;  2ZT9 C;  4HM1 A;  1L0L E;  2E74 C;  4QUP A;  4HM4 A;  4PD4 E;  2D2C D;  1VF5 C;  1G8J B;  3VCA A;  3H1H E;  3N0Q A;  4HM2 A;  4NBF D;  3GTS A;  3VCP A;  4I7Z C;  4AIV A;  1ZRT E;  2GBX A;  2NUK A;  3CX5 E;  2ZT9 D;  1NTZ E;  2HMN A;  2YFL A;  2FYN C;  3BCC E;  1ULJ A;  1SQV E;  3L74 E;  4OGQ C;  1L0N E;  1UUW A;  4H0L C;  3L72 E; 
#chains in the Genus database with same CATH topology
 4A7P A;  1YBK A;  1KQS O;  4U3F E;  3P8M C;  4UB6 E;  3M0A A;  1DEB A;  3O8Z A;  3H6P A;  2M0B A;  1IO4 A;  1K73 Q;  1NH4 A;  3L75 J;  1SQB E;  4H44 C;  2UWJ E;  5KAF E;  4N78 D;  1JMM A;  2A06 G;  4QCK A;  4HB1 A;  4EYY Q;  2HOD A;  3CCV P;  4H44 B;  3P7K A;  1O7N A;  2IBZ I;  1GZL A;  2KI7 B;  4HM0 A;  1YHQ P;  1S3J A;  3ABV C;  3H1K J;  4RJT A;  4HM8 A;  1NJI Q;  3L70 G;  2E76 C;  3C0D A;  1EDK A;  3V2R A;  4H13 D;  4ASW A;  2E76 B;  3L73 J;  2HMO A;  3L75 D;  4RO0 A;  1L0N K;  1AVO A;  3HD7 D;  2DE5 D;  3L72 G;  3GB4 A;  1NAY A;  4D6T D;  1IFP A;  3TGU E;  5CCG D;  1L0L J;  1CSB A;  1A02 J;  4HM3 A;  1N73 C;  2JR8 A;  4GT1 A;  1NWQ A;  1NTK E;  1N73 B;  2QPZ A;  1CI6 B;  1IFM A;  3AEB C;  5GTH H;  3FGA D;  3D70 A;  4JQ0 D;  1RY3 A;  3G71 P;  1ZW0 A;  2M3E A;  5TIS E;  2WSE H;  2POH A;  2GUS A;  1IFI A;  3CX5 E;  2AEJ A;  1L4A A;  1OVU A;  1DIP A;  1K05 A;  2BEZ F;  1P84 D;  1AJY A;  1NHL A;  2N1T A;  2NWF A;  1H0T B;  1OXZ A;  1NU1 G;  4LC1 A;  4Y28 J;  1VQK P;  1FZC A;  5AW2 B;  1X9V A;  1VCK A;  4WB4 A;  2Q7C A;  1KIL A;  3GLM A;  2N9Y B;  3TGU D;  2BCC E;  3CLQ A;  2OYO A;  3HUS C;  5DJT B;  3CC4 P;  1EQ7 A;  2WSC H;  1L0L K;  3CXH I;  3CC7 P;  3HUS B;  1LTI C;  3L4F A;  2KSJ A;  3A0H H;  2XKM A;  3KZI H;  1BDD A;  3U59 A;  2I1J A;  2K37 A;  3II6 A;  1EZV E;  3AE2 C;  1SQQ E;  2RH0 A;  5KJ7 C;  1L0N G;  1S5L X;  3BAS A;  1YJN P;  3BVH A;  2OYI C;  1LTJ A;  2RMZ A;  3H1L G;  2XV5 A;  2OYI B;  2R3S A;  4W80 A;  1K9M Q;  2DE7 D;  1ZV8 A;  2WZ7 A;  2D2C C;  3VMI D;  3RK3 C;  4ZKP A;  1USD A;  4IFF A;  1IFN A;  1PP9 E;  2D2C B;  2ZYD A;  4NBE D;  2ZT9 C;  2Y0D A;  3RK3 B;  3PP5 A;  1G8J B;  1GU5 A;  2ZT9 B;  3Q1M A;  1MFT A;  1FS0 E;  5CJ4 A;  1R8E A;  2FYN C;  5CCH D;  3G4S P;  3OJA B;  3HE4 B;  4PD4 I;  2FYN B;  1NTM J;  3H1K G;  3KDP B;  1EZV D;  3B4S A;  1LT9 C;  2ZAE B;  2ZVN B;  1N73 A;  1CI6 A;  5APY A;  1N8R Q;  2XSO A;  3L36 A;  2P67 A;  3L73 G;  3B5N D;  3H1H D;  5CCG C;  3E7K A;  2YNY A;  2QIW A;  2XDJ A;  2LKM A;  3ITK A;  2FXM A;  1RH5 B;  3MIW A;  1JUN A;  1L0L G;  2E43 A;  5AW3 B;  1SQX E;  5AVU B;  2I7F A;  4PV1 D;  1X22 A;  2J59 M;  1SFC D;  5KLV E;  1H0T A;  3IF4 A;  1NDO A;  2ZYL A;  5AW0 B;  3KPE A;  3L74 G;  2JO6 A;  1SQP J;  4JYB A;  2YFJ A;  1OMI A;  2G8Y A;  2OTL P;  1LT1 A;  3CCL P;  1X0T A;  2O1K A;  2HMK A;  3HUS A;  4N3Y B;  1BCC D;  3S4R A;  1NTM K;  4NBA D;  4N6J A;  2G3A A;  1FZF A;  1SQP D;  1BE3 J;  1ZRT E;  3EFF K;  2HMN A;  5KJ7 A;  4JF7 A;  3SWY A;  1AA0 A;  4GOD A;  1NOH A;  3G9R A;  2J5U A;  4U7J A;  2OQQ A;  2KK7 A;  4I1L A;  1O7W A;  4BWN A;  1JM1 A;  3F89 A;  3H1J D;  2E5Y A;  2P2U A;  4IFD K;  2E4Q A;  2K1A A;  1G8K B;  3HE5 B;  1FOS E;  3HE4 A;  1LWU B;  3I55 P;  3MUD C;  3V4Q A;  2E5T A;  2ZYA A;  2QA4 P;  1X79 B;  5E79 E;  2QG4 A;  2H43 A;  4ASV A;  5AW8 B;  4M3L A;  4YXW H;  2QVA A;  2GM4 A;  3H32 B;  2WPS A;  4P1C H;  2QM8 A;  2CKF A;  1N7S B;  2IZ1 A;  2MJZ A;  5AVQ B;  2W83 C;  4YTP C;  3G6E P;  1OIP A;  2A45 G;  5AW5 B;  1FU1 A;  3G3Z A;  3BCC J;  1XTC C;  2C9N Y;  2AXT H;  3VMA A;  1ZLL A;  1NTM G;  3KZI E;  5TJH A;  1JY2 O;  2QM7 A;  1KQL A;  3N0Q A;  4EOT A;  2KP8 A;  1CW5 A;  1NTZ E;  2O01 J;  2YFL A;  3Q2Y A;  2BAS A;  3SSU A;  5GTI H;  1YTZ T;  4DZO A;  2A06 D;  1T2K D;  5B5E E;  3TF5 A;  2CK3 H;  4PV1 C;  2O01 N;  1SFC C;  1AVY A;  3H1I G;  4PV1 B;  2B9B A;  1H89 A;  1Q90 D;  4GKG A;  1SFC B;  3GL2 A;  3L70 D;  3GCE A;  3Q5S A;  2H7H A;  1BGY G;  3PLN A;  1EXJ A;  3PHL A;  3EQ2 A;  5AEW A;  2NPS D;  1J1E C;  1KTM A;  1OW6 A;  4WY4 D;  1M57 D;  4B86 A;  3JC2 2;  3L72 D;  3NXS A;  1J1E B;  4DOJ A;  3VOP A;  1Y8A A;  2IFN A;  1ZN5 A;  4AAY B;  3BRT B;  2IPP A;  2CPS A;  3EFG A;  2A45 H;  3JCU H;  1VQ7 P;  3TYY A;  4R4M A;  3WMM 0;  1E79 H;  4O9B A;  1FZE A;  1IC2 A;  1K04 A;  1AV1 A;  2H8P D;  2A45 I;  1BE3 G;  1NU1 J;  2IBZ G;  3WU2 H;  1UIX A;  3M9B A;  4KJM A;  4OH8 B;  2IDB A;  1L2P A;  1HBW A;  1Y47 A;  3GOB A;  3AE3 C;  4QUQ A;  3HE5 A;  1YIT P;  3CCE P;  1LWU A;  3SFE C;  2ZVO B;  4IL6 H;  4N78 E;  3Q5R A;  1HUC A;  1FBM A;  3VCA A;  3CWB G;  1USE A;  2BEQ D;  2KIK A;  1NKZ B;  4C46 A;  2NUK A;  2L5G B;  3H32 A;  1AQT A;  1NU1 D;  5B66 H;  3QH9 A;  2PGD A;  1N7S A;  2N9B A;  1Q2N A;  4UB8 E;  2Q3I A;  2XR8 A;  2WPQ A;  2YXQ B;  4HKZ H;  2FKW B;  2Z4E A;  5KLI B;  3L75 E;  2XND H;  2FFD C;  3ZDM A;  2P58 A;  3E1R A;  4HM6 A;  1SJG A;  1S9K D;  3CCU P;  1ULI A;  3H1L J;  2W6J H;  2FFD B;  3KYQ A;  4WWI A;  4D6T E;  3NMD A;  2B87 B;  2FYU G;  3GHG C;  1M1J C;  1Q82 Q;  3GHG B;  1M1J B;  2WSF J;  3P8C D;  3A0B H;  1NU1 K;  1L0N D;  3PTZ A;  1SP4 A;  2W27 A;  3LID A;  2HMM A;  2E4P A;  3I5C A;  1VQ5 P;  3CI9 A;  4BRY B;  4OVN F;  1UII A;  3H1L D;  5EFW B;  3BCC G;  1WMK A;  1P84 E;  1KB9 I;  1VQO P;  1IK7 A;  1T2K C;  4I6M C;  1HF9 A;  1S5L H;  1RFS A;  2PP6 A;  3GF7 A;  3RL0 D;  3AEE C;  5AVW B;  4TLF A;  4Y99 C;  1KYO H;  2DW3 A;  5AW9 B;  1RHZ B;  4Y99 B;  4IL6 X;  5AVT B;  4I7Z C;  3HTK B;  3H1K D;  1KYO I;  2NPS C;  3MTU E;  2Z5I A;  4I7Z B;  2WVR A;  4H0L C;  2NPS B;  2Q3E A;  3L74 J;  1ZXG A;  3L73 D;  4H0L B;  1JNM A;  2ZJS E;  3FWL A;  3L71 G;  4AQR D;  3M9H A;  2AXT E;  1G2C B;  2K9J B;  2HMJ A;  2W90 A;  1L0L D;  1T3J A;  4W7Y A;  1GL2 D;  1LTA C;  1FAV A;  1VQ4 P;  5CMZ A;  1BDC A;  3AE4 C;  3AE6 C;  1PGP A;  4OGQ D;  3L74 D;  1PZQ A;  2E75 C;  2JKV A;  5GTI E;  5DJU B;  1LP1 B;  2E75 B;  2O01 H;  5K5G B;  1M90 Q;  1IFJ A;  2I1K A;  3CXH H;  2P7J A;  2FFD A;  1UUV A;  1R5S A;  2Y9Z A;  2B87 A;  1O7G A;  1O7P A;  1QEX A;  5KAI H;  1EDL A;  3A3Y B;  1GU4 A;  3KXD A;  1FC2 C;  1WRG A;  2LR2 A;  3GHG A;  1M1J A;  4DT0 A;  5AW4 B;  1KD1 Q;  2R5D A;  5APT A;  2YIU C;  2XU6 A;  1X8Y A;  3OAK A;  3VYI A;  1RE4 C;  3AE9 C;  2YIU B;  1VQ8 P;  1YQ4 C;  1URQ D;  2ZXX A;  4XFJ A;  1N7L A;  2WMM A;  3H1H E;  1GK6 A;  1U7J A;  2ZYG A;  5H2F E;  1PPJ G;  2QRX A;  3V2P A;  5M1B A;  1FDI A;  3FOU A;  2QE7 H;  1DEE G;  4PD4 H;  1GW4 A;  1VDF A;  2E74 D;  1M8O B;  1O7H A;  2IYO A;  5AW1 B;  3H25 A;  4IL6 E;  2O1J A;  4C7N B;  5AW6 B;  1SQQ J;  4EIJ A;  4NBG D;  3HTK A;  4H13 C;  3WUT A;  4NB8 D;  2XRX A;  3L35 A;  1BCC E;  3VMY A;  3N7N A;  4H13 B;  1W2B O;  2NPS A;  3HD7 C;  2YKP A;  3FXD A;  1YI2 P;  3MD0 A;  1LT9 B;  3MGN A;  1SQP E;  3HD7 B;  3GW6 A;  1SQV G;  2B24 A;  2ITA A;  3MZW B;  4ZNC A;  4U3F G;  4HJL A;  1G2C A;  2K9J A;  4RKU J;  1MKM A;  3V5B A;  3H1I J;  1G1I A;  1NTM D;  2R32 A;  1FZA A;  1SQB G;  4I2L C;  5APW A;  1VQP P;  1BGY J;  2P10 A;  3CPW O;  3H1J E;  2WSF H;  1LP1 A;  3P32 A;  2HFE D;  1KC8 Q;  1MV8 A;  4EDF A;  1HTL C;  4C7R A;  3AEG C;  3HRN A;  3H1I D;  1SQQ K;  2WIT A;  4OGQ C;  2PFX A;  3D89 A;  1FJK A;  5BU8 B;  2Z5H A;  1S5L E;  3TGU G;  2NUM A;  2HML A;  2NRG A;  1YJ9 P;  4JBZ A;  1KN7 A;  1SQX J;  5AVR B;  1RE4 A;  3U1A A;  2BMR A;  2Y0C A;  1NTK G;  4QMA A;  5KLV J;  2FY8 A;  2OYI A;  1JY3 N;  2WPV B;  3C8V A;  4UB6 H;  3KQG A;  3CWB J;  1URQ C;  5GTH E;  1EC5 A;  1BE3 D;  1YQ3 C;  2IBZ D;  3A2A A;  3RGU A;  2YKO A;  1ZP0 C;  3CCJ P;  1NYK A;  1JY2 P;  1URQ B;  2XZR A;  3CCM P;  1L4A D;  1KB9 D;  1NGM B;  1M56 D;  2GA1 A;  2BMO A;  4L75 A;  1Q7Y Q;  5AVZ B;  4C7N A;  2YVJ B;  2N1T D;  2A06 E;  1KQG B;  1VL2 A;  3CWB D;  3M0D C;  4NBH D;  2FYU J;  1AFO A;  3GKE A;  1P84 I;  3R4Y A;  2FBW C;  5APQ A;  1JM0 A;  2BCC G;  1KZU B;  3C1L A;  3L70 E;  1LT9 A;  1QLE D;  2E74 C;  2H88 C;  2R44 A;  1KIL D;  3R2P A;  5CCH C;  3HD7 A;  2JWD A;  1KYO D;  1OW8 A;  4NPF X;  1SQX K;  3V4W A;  1NYH A;  3L37 A;  1Q86 Q;  2JP3 A;  3OA7 A;  5CCG A;  1EZV G;  2FXP A;  3L72 E;  5KLV K;  2H89 C;  1SQQ G;  4HH2 A;  2FYU D;  3GMA A;  3LW5 H;  3A0H E;  1BSH A;  4MN4 C;  2WQY C;  4YPC A;  3B5N C;  1FE6 A;  1JMB A;  1IK9 A;  3B5N B;  4HYT B;  4TT3 H;  3M91 A;  4NBD D;  4R4L A;  2K88 A;  2KNC B;  5AVY B;  1DD3 A;  3VMG D;  2Y9Y A;  3BCC D;  3CX5 I;  1PP9 G;  2V4H A;  4JPZ B;  2YO2 A;  3BRV B;  3SWK A;  2OTK E;  2FYU K;  5C39 A;  2K9Y A;  3V2Q A;  2AEF A;  2E76 D;  2PAJ A;  2E42 A;  1GTW A;  3TNU B;  3IFM A;  4K35 A;  3CXH D;  1IFD A;  1NU1 E;  2HPC B;  1VQN P;  2Q6Q A;  3GG2 A;  2C0W A;  1JCD A;  3VMX A;  1HWT C;  3AED C;  3C9I A;  3IAO A;  2OAR A;  3L71 J;  3VMH D;  2MKV A;  1OZH A;  2JDI H;  4GDO A;  5KKZ C;  1OX3 A;  1PGQ A;  5CBO A;  1S9K E;  2V7Q J;  1KOR A;  2YMY A;  5KKZ B;  2KSE A;  4HM4 A;  1EZV I;  4XE5 B;  1URQ A;  2VRS A;  3P8C E;  1QL2 A;  3B8E B;  4IOI H;  1SQX G;  1CZQ A;  1QX8 A;  2KS1 B;  1L0N E;  3L71 D;  5AW7 B;  5KLV G;  2XNX A;  5AVS B;  2QJY C;  5BVZ A;  1QVG O;  2GUV A;  3H1J G;  3H1L E;  1JCC A;  3V2N A;  3GTE A;  3MUD A;  2QJY B;  1S72 P;  3VTP C;  1FJP A;  4GOE A;  4PD4 D;  1RF1 C;  2FYZ A;  2Y0E A;  1DX7 A;  2W8Z A;  2B89 A;  3CC2 P;  2N1T C;  1RF1 B;  1ZR2 A;  5CCH A;  2KOG A;  3GZY A;  4QDD A;  3M9Q A;  1FOS F;  1GD2 E;  2NVE A;  4IFM A;  1VPC A;  3EQQ A;  4WBA A;  1KFN A;  3GZX A;  3H1K E;  2NVG A;  4GOF A;  4PJ0 H;  3W67 A;  2OGU A;  1Y9B A;  3B5N A;  5KJ7 D;  3VMZ A;  1HVV A;  2JO1 A;  2LXC B;  3L73 E;  1EDJ A;  2KNC A;  1JO5 A;  1FQT A;  1LGH B;  1KQF B;  5L8R J;  3F5H A;  3VP8 A;  3GF3 A;  1PPJ D;  1H8A A;  1KB9 H;  1RQU A;  3UIA A;  1L0L E;  1SFC A;  1N2D C;  2D2C D;  2KZI A;  3RK3 D;  2R3C A;  1LTJ C;  2HYN A;  1LTS C;  3VCP A;  3TNU A;  4AIV A;  2ZT9 D;  5APS A;  1LTJ B;  1ULJ A;  4ZMD A;  4D6T J;  2HPC A;  3L74 E;  1KV4 A;  2GBW A;  4HM7 A;  2C9L Y;  1SQV J;  4BXL A;  1ZME C;  1Q90 C;  1LNQ A;  1S4X A;  1HH0 A;  3CL3 D;  4U3F J;  4HKV A;  1FDO A;  1IJD B;  4P1B H;  1PGJ A;  4Z1M H;  1D7M A;  2OYH C;  2SPZ A;  1T8Z A;  1OVV A;  4WY4 C;  1SQB J;  1LJ2 A;  3USS A;  2OYH B;  5BU5 A;  1EXI A;  4NBB D;  4WY4 B;  1JOC A;  1YYC A;  2IFM A;  2AXC A;  1SQV D;  1J2J B;  1E5W A;  2KS1 A;  3D71 A;  1ZR4 A;  4U3F D;  2QJK C;  1NTZ G;  3PJS K;  2R5B A;  1QGK B;  2QJK B;  3RL0 g;  4YXD C;  1SQB D;  3V6I A;  3WUU A;  5CXM A;  2WPR A;  1RIE A;  2FXO A;  2HLO A;  1OVR A;  2W6A A;  1EG9 A;  1IZN B;  3TGU J;  1RF1 A;  1GMJ A;  5KTB A;  3VP9 A;  4NBC D;  4QDC A;  1SQV K;  5BOK A;  5E79 H;  1JTH B;  1SVF A;  3AEA C;  1J1D C;  1NTK J;  3LW5 J;  1M1K Q;  4HM1 A;  5AVV B;  4QUP A;  1M7L A;  1ZOY C;  1J1D B;  1R5L A;  1U7M A;  1PGO A;  4NBF D;  3EWK A;  4NPE A;  3CD6 P;  1SQB K;  4KT0 J;  4DJG A;  1RQV A;  1SLQ A;  3B71 A;  1JEK A;  4BRY A;  1EDI A;  4QDF B;  4EI2 A;  1MZ9 A;  3K5B A;  1NTK D;  3JCU E;  3Q3D A;  5HL4 A;  2RN0 A;  2YKQ A;  1VQ6 P;  3FWN A;  1NTM E;  3CX5 D;  2V7Q H;  2BCC J;  3WU2 E;  5APV A;  1VQL P;  5B5E H;  1JB0 J;  1U57 A;  3AE5 C;  1MUU A;  5APX A;  3RBX A;  2KUB A;  3AEF C;  1NTK K;  2B88 A;  2WWW A;  3CCS P;  1OWA A;  3T97 B;  3H1I E;  2ZFC A;  1A02 F;  3L75 G;  2OYH A;  2BCC D;  5B66 E;  1N7S D;  3H1H J;  4WY4 A;  3RK2 D;  3RL0 C;  1NVO A;  1BGY E;  4D6T G;  3D6Z A;  3BAT A;  2DE6 D;  3IR9 A;  3RL0 B;  2JWA A;  1TU3 F;  1NAF A;  1T3U A;  2JEE A;  2LXB A;  2RKL A;  1HGZ A;  4L76 A;  1SQQ D;  1PP9 J;  2Q1K A;  3JSV C;  3GTS A;  2HR3 A;  3LIE A;  4W7Z A;  4GIF A;  2NZ2 A;  4PJ0 E;  3A0B E;  3NFQ A;  2L91 A;  3TDK A;  1JY3 P;  3A7O A;  2IX7 C;  1BE3 E;  4NB9 D;  2IBZ E;  1VQ9 P;  1GL2 C;  1JTH A;  2M5A B;  1BCC J;  2Q3W A;  1PP9 D;  1KB9 E;  2QSI A;  1VF5 D;  1GL2 B;  2WTY A;  3DQY A;  1FZB A;  4OGQ B;  3CWB E;  1HGV A;  1BGY D;  4UB8 H;  4L73 A;  2WT7 B;  1FDM A;  3NTN A;  2XSH A;  3IN6 A;  3E1I A;  3OW2 O;  4QDF A;  1KIL E;  3A5T A;  3PRJ A;  1KYO E;  3AE1 C;  4WVZ A;  2I8D A;  2O3J A;  3H1J J;  1QVF O;  1K8A Q;  1JY3 O;  2FYU E;  2WSS H;  2M3B A;  1OW7 A;  1Q81 Q;  4AYC A;  1Z56 A;  4QUR A;  5KAF H;  1YJW P;  1RF0 C;  1SQX D;  2ZXE B;  1AQ5 A;  1VQM P;  2CPB A;  1DH3 A;  5APU A;  3KHU A;  5KLV D;  2K3R A;  4KHX A;  2IZ0 A;  1WT6 A;  1FZG A;  3MP7 B;  4L74 A;  5CBN A;  1P84 H;  3T97 A;  1PV3 A;  3BCC E;  2KYV A;  1SQP K;  1UUW A;  1H88 A;  1LWU C;  1KMI Z;  1YTZ I;  3N4X A;  1HJ0 A;  2E74 B;  2J58 A;  3I56 P;  1GDT A;  3AE8 C;  2Q9I A;  3CXH E;  4RES B;  4JYC A;  1LTT C;  2P1J A;  3GL0 A;  1N7S C;  1ZRT D;  4EMJ B;  2Q5U A;  3AE7 C;  2KB7 P;  5KAI E;  3RK2 C;  3O6Q B;  2WSE J;  1W2E A;  1QL1 A;  3RK2 B;  3H1H G;  3TSI A;  4CPG A;  1WQL A;  5TIS H;  1LTB C;  2YXR B;  1RE3 C;  3CX5 H;  3U1C A;  1VM9 A;  1JY2 N;  3AZC A;  4H44 D;  4HJG H;  2M5A A;  4LLH A;  2JJL A;  3L70 J;  3L71 E;  1GL2 A;  1YIJ P;  1KFM A;  2KLU A;  3RBZ A;  1S2E A;  3CME P;  2JZA A;  4DCK A;  2OTJ P;  1XTG B;  2AEM A;  2WT7 A;  1SS1 A;  2YFI A;  3L72 J;  2WSC J;  2IYP A;  1N86 A;  3SFD C;  2HOD B;  4PD4 E;  1VF5 C;  4LGD E;  1NKN A;  4XA4 A;  4HM2 A;  3S9O A;  1BCC G;  1VF5 B;  4AUW A;  3FX0 A;  1NTZ J;  2KZJ A;  1SQP G;  3PH0 A;  2B1X A;  1S1C X;  3W68 A;  1OFC X;  4H0L D;  2KXP B;  2HG5 D;  1GK4 A;  5H2F H;  4HM5 A;  3FXE A;  1RF0 A;  2PRR A;  3SWF A;  1NTZ D;  5AEU A;  1PFI A;  5CHX A;  1PPJ E;  4ZKU A;  1HJB A;  1LTG C;  3M0D A;  2M8R A;  3TK1 A;  1L4A C;  1DD4 A;  2E75 D;  1BSN A;  3RK3 E;  1NO4 A;  3CCR P;  1L4A B;  3D6Y A;  2NVF A;  2KLV A;  2N1T B;  3WUV A;  3S1K A;  5CJ0 A;  3QWO C;  1FZC C;  1O7M A;  1NTZ K;  2YMK A;  3M06 A;  3CMA P;  3O6Q A;  1FZC B;  5KLI C;  3EN1 A;  1KIL C;  2QJP C;  1L0N J;  3MHV A;  2YO3 A;  1G1J A;  5AVX B;  2BMQ A;  4K3A A;  3VN0 A;  3Q5P A;  1MFZ A;  1KIL B;  2QJP B;  1PIX A;  4NPD A;  2W6B A;  4OWF A;  1W5C E;  3AEC C;  3CCQ P;  1PL5 A;  2GBX A;  2QEX P;  1RE3 A;  1SQV E;  2C0X A;  1T6A A;  1GW3 A; 
#chains in the Genus database with same CATH homology
 3D89 A;  4U3F E;  3B71 A;  4PV1 C;  4QDF B;  4PV1 B;  2NUM A;  1SQB E;  4H44 C;  1Q90 D;  2HML A;  3GL2 A;  3GCE A;  3Q3D A;  3Q5S A;  4QCK A;  5HL4 A;  4H44 B;  2BMR A;  1O7N A;  1EXJ A;  1NTM E;  5AEW A;  4HM0 A;  1KTM A;  1OW6 A;  3ABV C;  2WPV B;  4HM8 A;  3C8V A;  2E76 C;  1JB0 J;  3C0D A;  1U57 A;  4H13 D;  3AE5 C;  2E76 B;  4AAY B;  2HMO A;  1YQ3 C;  3AEF C;  1ZP0 C;  1NYK A;  2DE5 D;  3GB4 A;  3T97 B;  4R4M A;  3H1I E;  1K04 A;  1NGM B;  3TGU E;  2BMO A;  2YVJ B;  4HM3 A;  1UIX A;  2A06 E;  1KQG B;  1VL2 A;  2IDB A;  4NBH D;  3D6Z A;  3GOB A;  3AE3 C;  1NTK E;  4QUQ A;  2DE6 D;  2QPZ A;  3GKE A;  3AEB C;  3R4Y A;  1TU3 F;  2FBW C;  3FGA D;  3SFE C;  3D70 A;  3L70 E;  2E74 C;  2H88 C;  3Q5R A;  3VCA A;  2BEQ D;  1OW8 A;  3GTS A;  3CX5 E;  2NUK A;  1NYH A;  2JP3 A;  1DIP A;  1K05 A;  2BEZ F;  2NZ2 A;  1AJY A;  2FXP A;  3L72 E;  2H89 C;  2NWF A;  3GMA A;  2XR8 A;  1BE3 E;  3L75 E;  2WQY C;  4NB9 D;  2IBZ E;  4HM6 A;  4Y28 J;  1SJG A;  1ULI A;  2Q3W A;  1KB9 E;  1VCK A;  2QSI A;  4TT3 H;  1VF5 D;  3GLM A;  4NBD D;  4R4L A;  2BCC E;  2WSF J;  3DQY A;  4OGQ B;  1DD3 A;  3VMG D;  3CWB E;  2XSH A;  2HMM A;  2E4P A;  1EZV E;  3IN6 A;  3AE2 C;  2K9Y A;  1SQQ E;  2E76 D;  4QDF A;  1KIL E;  1KYO E;  1WMK A;  1S5L X;  3AE1 C;  1NU1 E;  1P84 E;  3AED C;  3IAO A;  1IK7 A;  2FYU E;  3VMH D;  1OW7 A;  2DE7 D;  2MKV A;  1HF9 A;  1RFS A;  2D2C C;  4GDO A;  5KKZ C;  3VMI D;  3GF7 A;  4QUR A;  2V7Q J;  1KOR A;  3AEE C;  1PP9 E;  2D2C B;  4NBE D;  2ZT9 C;  4HM4 A;  1G8J B;  2ZT9 B;  3Q1M A;  4IL6 X;  4I7Z C;  1R8E A;  2FYN C;  1PV3 A;  3BCC E;  1L0N E;  1UUW A;  4I7Z B;  4H0L C;  1KMI Z;  4H0L B;  2QJY C;  3H1L E;  1HJ0 A;  3GTE A;  2XSO A;  2E74 B;  3AE8 C;  3CXH E;  2HMJ A;  3GL0 A;  4EMJ B;  3AE7 C;  2QIW A;  3AE4 C;  3AE6 C;  3GZY A;  4OGQ D;  4QDD A;  2WSE J;  2E75 C;  1SQX E;  2NVE A;  2I7F A;  4PV1 D;  2E75 B;  1WQL A;  3EQQ A;  5KLV E;  1NDO A;  3GZX A;  1VM9 A;  2ZYL A;  2JO6 A;  3AZC A;  4H44 D;  3H1K E;  2YFJ A;  2NVG A;  1OMI A;  1UUV A;  1Y9B A;  2G8Y A;  3L71 E;  1O7G A;  1O7P A;  2JO1 A;  3L73 E;  2JZA A;  1FQT A;  1KQF B;  2YIU C;  5L8R J;  2HMK A;  3GF3 A;  2YFI A;  3AE9 C;  4NBA D;  2WSC J;  1RQU A;  2G3A A;  1YQ4 C;  3SFD C;  1L0L E;  4XFJ A;  4PD4 E;  2D2C D;  1VF5 C;  3H1H E;  4HM2 A;  3VCP A;  4AIV A;  3S9O A;  1ZRT E;  1VF5 B;  2ZT9 D;  2HMN A;  5M1B A;  1ULJ A;  3L74 E;  2GBW A;  4HM7 A;  3G9R A;  2B1X A;  1FDI A;  1ZME C;  1Q90 C;  1S1C X;  2J5U A;  4HKV A;  1FDO A;  4H0L D;  4U7J A;  3FOU A;  2OQQ A;  1O7W A;  4P1B H;  4Z1M H;  1JM1 A;  2E74 D;  1O7H A;  3H25 A;  4HM5 A;  1EXI A;  4NBB D;  4NBG D;  2E4Q A;  4H13 C;  4NB8 D;  5AEU A;  1G8K B;  2XRX A;  1BCC E;  1PPJ E;  4H13 B;  3D71 A;  2QJK C;  1DD4 A;  1SQP E;  2E75 D;  3RK3 E;  3RL0 g;  2B24 A;  4YXD C;  3D6Y A;  2NVF A;  5CXM A;  1RIE A;  4HJL A;  4P1C H;  2CKF A;  1EG9 A;  4RKU J;  1MKM A;  4YTP C;  1O7M A;  2YMK A;  1GMJ A;  4NBC D;  4QDC A;  3O6Q A;  5BOK A;  5KLI C;  3EN1 A;  2QJP C;  3AEA C;  2P10 A;  3LW5 J;  2BMQ A;  3H1J E;  4HM1 A;  3Q5P A;  4QUP A;  1PIX A;  1ZOY C;  3N0Q A;  4NBF D;  3EWK A;  3AEC C;  1PL5 A;  2GBX A;  2O01 J;  4KT0 J;  1NTZ E;  3AEG C;  2YFL A;  3Q2Y A;  1SQV E;  4OGQ C;  1RQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...