4H0LD

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
161
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 26
structure length 161
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h0lD02
1Q90C 4NBCD 1NYKA 2NVEA 5HL4A 3GTSA 1O7NA 2FYUE 4HM2A 4H13C 2XR8A 1NDOA 4HM1A 2BMQA 3C0DA 3FOUA 2E4PA 1EZVE 2ZT9C 4NBGD 4NBAD 4QDDA 3VCPA 1PPJE 5AEUA 4HJLA 1O7WA 4NB8D 2HMLA 4HM7A 2QJPC 3CXHE 3GL0A 3CWBE 2QJKC 2E76D 4PV1C 4NBED 3VMID 4EMJB 1O7HA 3H1HE 4QDFA 2GBWA 2YFJA 3GKEA 1SQPE 4U3FE 2GBXA 2DE7D 3GB4A 4HM8A 3L71E 1ULIA 3GCEA 2YFLA 4HM5A 1ULJA 2B1XA 2D2CC 4OGQD 2A06E 4NBFD 4P1CH 4AAYB 1KYOE 2E4QA 3GOBA 4HKVA 1G8JB 2B24A 2NUMA 1JM1A 2YFIA 1P84E 3AZCA 4H0LD 3N0QA 2HMOA 4PD4E 1SQQE 1VF5C 2NUKA 1NTKE 4H0LC 4QDCA 4QDFB 4QUPA 1SJGA 4PV1D 2HMJA 1BCCE 1SQBE 4HM6A 1SQXE 1BE3E 2NWFA 1G8KB 1UUWA 2YIUC 4I7ZC 4QUQA 3EN1A 2BMOA 3L72E 3CX5E 4P1BH 2E74D 3L73E 2HMMA 2D2CD 4OGQC 3D89A 2E75C 1L0LE 1L0NE 1UUVA 3L70E 3DQYA 4QURA 4HM0A 3GTEA 3GL2A 2CKFA 3VMGD 2NVGA 2Q3WA 4NB9D 2XRXA 3GZXA 3H1KE 4HM4A 2E75D 2DE6D 1EG9A 2BMRA 2ZYLA 3TGUE 1VM9A 3L74E 3VMHD 2BCCE 1NTME 2YMKA 1ZRTE 1VF5D 1RIEA 3H1IE 2HMKA 2YVJB 1PP9E 2E74C 1O7GA 2QPZA 4AIVA 2HMNA 3H1LE 1WQLA 2ZT9D 5KLIC 5BOKA 2E76C 2IBZE 4QCKA 2FYNC 1O7PA 2QJYC 3EQQA 5AEWA 2I7FA 1VCKA 1O7MA 2NVFA 3BCCE 1RFSA 2JZAA 2XSHA 4H13D 3VCAA 4NBHD 4H44C 5KLVE 3GZYA 3L75E 2DE5D 1KB9E 1NTZE 3H1JE 1SQVE 5KKZC 2JO6A 5CXMA 4NBDD 1NU1E 1FQTA 4HM3A 4H44D 2XSOA 4NBBD
chains in the Genus database with same CATH superfamily
3BCCG 1GU4A 5KAFE 3V5BA 4W80A 2W83C 2XDJA 1KMIZ 3AE5C 1KV4A 3C1LA 4PV1C 1Y8AA 1VQ7P 2Q6QA 1RHZB 4U3FE 4GT1A 2KSEA 1L0NG 1RE4C 1SS1A 1KFNA 2WQYC 1RF1C 2D2CC 2Z5HA 4ASWA 1KILD 2V4HA 3RGUA 1JM1A 2HLOA 3P8CE 3KHUA 1X9VA 3GG2A 2JWDA 3KXDA 2M3EA 1VQ5P 1VQLP 4KT0J 4BXLA 2QSIA 3WU2E 2KP8A 4QUQA 2WITA 3L72J 3L70E 1IFIA 4C7NA 1LP1B 1VL2A 3TDKA 5KLVG 1EG9A 3VOPA 1M1KQ 3VMHD 3RL0D 1NVOA 1J1DB 4AQRD 3HTKA 2OGUA 3L74D 1L0LJ 1SQPD 5KAIH 2I7FA 1CSBA 5AW4B 4L74A 2IYOA 2KOGA 5KLVK 1W2EA 1SVFA 3GZYA 1K04A 2WPRA 3M06A 3B5NC 2Z4EA 3CI9A 3CXHD 2NVEA 5AVZB 5HL4A 5CCGC 1Y9BA 1DX7A 1L4AA 3CCEP 3CMEP 2Y9YA 2RN0A 4D6TE 5AEUA 1X22A 3Q3DA 4HJLA 2HMLA 1IFPA 1JTHA 2P7JA 4Y28J 3LIDA 3VMID 2M0BA 2Y0DA 1WRGA 1KB9I 1H8AA 2GBXA 1ZOYC 3SFDC 1KQFB 1SQXJ 2YFLA 3VP8A 2NPSA 5CBNA 3GOBA 1N86A 1FDIA 3M0DC 1LT9B 1W5CE 5AVXB 2R32A 2WTYA 3PRJA 1L4AD 1SQQE 3S1KA 1SQXG 5CJ0A 5KTBA 3MD0A 2NUKA 4QDCA 2H8PD 4PV1B 2NWFA 1HF9A 3H1LG 1LTBC 3M0DA 1L2PA 2E75C 2IPPA 3LW5J 1HJBA 3L74G 3GL2A 1RH5B 1SQPG 2ZFCA 2H43A 2HR3A 1YIJP 1N73A 2VRSA 5KJ7D 2XV5A 2M8RA 5BOKA 2K9JB 3II6A 3L70J 2XNDH 3VCAA 1GDTA 2JO6A 4NBDD 2B87B 4H44D 2R5BA 1SQBK 4H44B 3O6QB 2ZYDA 3WU2H 1S2EA 1JM0A 2OTLP 1PPJE 1PFIA 5H2FH 3HE5A 1O7WA 1JEKA 4UB6H 1GW3A 1JMMA 1KZUB 3CWBE 2RKLA 5DJUB 3T97B 1FZCB 2YXQB 3H1HE 4O9BA 2ZAEB 1GU5A 3L73G 2R3SA 3BRVB 1S9KE 2FYUG 1Q82Q 2WSSH 1FJPA 3HD7D 4WY4A 1LTAC 1ZR2A 1M8OB 2ZVOB 3H1IG 1BGYJ 1P84I 1T3JA 3CWBD 1SQXE 2FYNB 1A02J 2BCCJ 2JWAA 5KAFH 3PH0A 4U3FD 3GLMA 3M9BA 4XE5B 4ZNCA 3L73E 1FU1A 2LXBA 3D89A 3RK2D 2OYHA 1BCCJ 2E5YA 1KORA 2BCCG 5CMZA 1HTLC 1OW6A 1KN7A 1VM9A 1BSHA 2G8YA 3A7OA 3S4RA 3H1IJ 1MKMA 5KLIC 1LWUC 2HPCA 5KLVD 4AYCA 1BGYD 2XSHA 2ITAA 1KQLA 4HB1A 3L75E 1NTZE 2B9BA 3H1JE 3R4YA 1X0TA 1J1EB 3HD7C 1FDOA 5GTIH 1YYCA 4BRYA 4HM2A 3L71G 1YQ4C 4EYYQ 2N1TA 3VCPA 1D7MA 3PP5A 1NWQA 5AW7B 1LWUA 2QJKC 3AEGC 3NFQA 5BVZA 3B5NB 1T2KD 1CI6B 3AE6C 3CC7P 1N2DC 1FZEA 1GK6A 1PGQA 2PP6A 4OGQD 2JP3A 2OYHC 2MKVA 1IFMA 1H0TB 3I5CA 4N78D 1H89A 2YFIA 2KLUA 5AVYB 4QMAA 2HMOA 1AJYA 1L0NK 4QUPA 4QDFB 3BASA 2M5AA 1BE3J 2OYIB 2YKOA 2A45G 4P1BH 1J1DC 4PJ0E 2YKQA 3HTKB 2ZXXA 1KILB 3HE5B 1W2BO 1OWAA 2N9YB 3BCCJ 1KD1Q 4IOIH 2BCCE 4GOEA 3IF4A 2E74C 4AIVA 3AEBC 5APXA 1WQLA 2ZT9D 3N7NA 3CX5H 3L37A 2JEEA 2HODB 2KZJA 3GF7A 1SQVE 1CZQA 3A0HH 3H1LJ 3CCMP 4WB4A 3GHGB 4LLHA 1IFNA 1SQVG 3H1HJ 1JY2N 1UIXA 1USEA 5CCGD 1X8YA 3VMAA 5AW3B 3HD7B 3MGNA 3JC22 1NTZJ 3H1JJ 2YKPA 4UB8E 1AFOA 1SFCB 4DOJA 2JO1A 1SQPK 4XA4A 1GD2E 1RE3C 2WSCJ 1MZ9A 3L71E 1ULIA 1JY2P 3TK1A 4ZKPA 2GUSA 2ZVNB 1VQMP 3OW2O 2B24A 2NUMA 2O01H 1OVUA 2QEXP 3H32B 1LJ2A 3L73J 4PV1D 3L75D 1BCCE 5AW0B 5KLVJ 1G8KB 1M1JB 1U7JA 3L74J 2FBWC 4I7ZC 1NTMJ 1KILE 3HRNA 1VQNP 4PD4D 4OH8B 1FZAA 4GODA 1SQBD 2E75D 2V7QH 4W7YA 2JKVA 5TISH 3CC2P 1NTZD 3H1JD 1KYOI 2OYIA 2YVJB 4JPZB 3GF3A 1ZMEC 3CCJP 5AVRB 3BCCE 3V2QA 3G4SP 3CL3D 5KAIE 1ZV8A 4HM3A 3G6EP 1M7LA 2M3BA 1JY3O 2MJZA 1EZVD 2OTKE 3LIEA 4NPFX 1KYOH 5GTHE 2XNXA 4NBAD 3N4XA 1SQQG 2FFDA 1VPCA 3CXHE 3RK3E 3USSA 3W67A 1YI2P 1EXJA 1OIPA 4UB8H 1JY3P 3GCEA 3A0BE 4HKVA 1G8JB 5APUA 3AZCA 1NTMD 2K3RA 2Z5IA 1LT9A 3U1AA 2NPSD 1UUWA 3L72E 2AEFA 3V6IA 2UWJE 2E74D 1JCDA 4IL6H 2OYHB 3RK3D 4YXDC 4HM0A 3GTEA 1GZLA 2Q3WA 1AVOA 3L74E 1NTME 2YMKA 1OFCX 1N73C 1EXIA 4KJMA 3RL0B 2WSFH 3F5HA 3MIWA 2HMNA 2W90A 4JYCA 2K37A 3L71D 2C0WA 3CXHI 1EZVG 3H6PA 3H1KJ 1SFCD 5KLVE 1NU1K 3D6YA 1NTKG 2QRXA 1CW5A 3SSUA 2AXTH 1JB0J 3CCVP 4OWFA 3CX5I 1G2CB 1NYKA 1ZXGA 3GTSA 1PPJG 5BU8B 3JSVC 1FZCA 3T97A 2WPSA 1LTJB 1N8RQ 2ZYAA 2NPSC 5EFWB 2HFED 2E76D 2WPQA 2B87A 1LT9C 4K35A 3C8VA 2YFJA 2KNCB 3RK3C 1FZFA 2Q9IA 1AVYA 1KTMA 4YPCA 3GB4A 3M9HA 5AVSB 3P8MC 3V2RA 3CWBJ 1G1IA 5AW8B 1E79H 4C46A 3BATA 2YO2A 3KPEA 1NAFA 1SJGA 4IFDK 3MP7B 2QJKB 2Q5UA 2WVRA 4YXWH 1KB9H 4OGQB 3HD7A 4WY4D 2O1KA 1K05A 1SQBJ 2QG4A 2QVAA 2W8ZA 2WPVB 4D6TJ 5CCHC 1BGYG 1ZRTE 1VF5D 2IBZD 2C0XA 1MV8A 1NTKD 3D71A 2E76C 3Q5RA 3E1IA 1RE3A 2FYUJ 4PD4I 1S5LX 4Y99B 1NGMB 3SWYA 2J5UA 4H44C 3TSIA 2A45I 2ZYGA 4KHXA 1QL1A 2CPSA 1PGPA 1G1JA 2B88A 2KUBA 3B71A 1HWTC 3VN0A 1VQ9P 3L70D 1K8AQ 1FZGA 2E5TA 1YBKA 3E1RA 2M5AB 3WUTA 3U59A 4PD4H 3G3ZA 1RF1A 1ZRTD 4WY4C 3TNUB 4QDFA 2CPBA 1MUUA 2Q1KA 4GDOA 1RY3A 2AEMA 4JYBA 1ULJA 3E7KA 3GW6A 4NBFD 3H1LD 1QVGO 3MUDA 3H25A 2O01J 2YIUB 3TGUG 1JNMA 1YHQP 4DZOA 1LWUB 1NKZB 1OZHA 3CCRP 1UUVA 2HYNA 4NB9D 4BRYB 3HE4B 1GL2A 2IZ1A 2QM8A 4U3FG 1FC2C 1EQ7A 3L36A 1RIEA 2FXMA 1NTZK 1PP9J 1M1JC 1RE4A 3AE9C 3D6ZA 1GL2B 2P58A 1KFMA 1VQ4P 1Y47A 2GUVA 2KS1A 4BWNA 3FWLA 5KKZC 3HE4A 3L75J 5CHXA 1QLED 1RF0A 1NTKK 4U7JA 3Q1MA 3AEEC 2FYUE 2W27A 4I1LA 4Z1MH 3FOUA 1VQOP 2ZT9C 4QDDA 2W6AA 2PFXA 3VP9A 3SWKA 5AVWB 2QJPC 1T8ZA 1PP9D 1PGJA 1QEXA 2GBWA 3KYQA 1Q86Q 1IO4A 2Y0CA 1JCCA 4EIJA 1SLQA 1XTGB 1LTJA 3ABVC 2RMZA 3VMYA 3PLNA 3KZIE 1IJDB 4ZMDA 4PD4E 1SQBE 1S9KD 2K1AA 2WT7A 1BE3E 3WUVA 1DEBA 2HG5D 1S4XA 5E79H 2HMMA 1ZR4A 3CLQA 3SWFA 3DQYA 1DD3A 3HUSC 3VYIA 5GTHH 1LTIC 1BCCD 3L35A 4R4LA 1SQXD 1LGHB 2C9NY 4I2LC 3QH9A 5BU5A 2JR8A 2KIKA 1JOCA 1SQQK 1PZQA 3CCQP 1IC2A 3M0AA 3TYYA 1BSNA 2PRRA 2WWWA 2ZT9B 4PJ0H 4C7RA 3K5BA 4H13B 5APYA 2PGDA 2QJPB 1GMJA 2H89C 5M1BA 2H88C 1SQQD 1QX8A 1ZP0C 1HGVA 5KKZB 1L0ND 4DCKA 4N6JA 4WWIA 1GW4A 1OMIA 3GHGA 1GL2C 2HODA 2G3AA 4L76A 3BVHA 1XTCC 2KZIA 4NPDA 2IYPA 5AW2B 3CCUP 2A06E 3RL0C 3V2NA 5AW6B 1UIIA 4RESB 1HJ0A 1BDDA 1SQQJ 3JCUE 1PGOA 1FS0E 4HYTB 5CBOA 4Y99C 3RK3B 2WMMA 3L73D 3AEFC 2FFDC 3A3YB 1M90Q 1H88A 4W7ZA 3CC4P 5L8RJ 2FYUD 1L4AB 1YITP 3V4WA 1Q90D 1PV3A 2V7QJ 1QVFO 1SP4A 2IX7C 1PP9E 5H2FE 4IFMA 2L91A 1WMKA 2FYNC 3RBXA 3Q5SA 3D70A 2J58A 3SFEC 1R5LA 2BCCD 5CXMA 2N1TB 4TT3H 2I1KA 5CJ4A 1USDA 2GA1A 2Y9ZA 3KQGA 3G71P 3W68A 4H13C 1NDOA 1L4AC 1Q7YQ 1KB9D 1YTZT 2AXCA 5APTA 4ASVA 1SFCC 4I6MC 1AQ5A 3H1KG 4B86A 3L75G 2DE7D 4DJGA 2YMYA 1DH3A 1GK4A 3F89A 1SFCA 3CCSP 3HUSB 5KLIB 1K9MQ 3B4SA 1M57D 2J59M 3B8EB 4EDFA 1FDMA 1YJWP 1AV1A 3P32A 3N0QA 3PJSK 1BGYE 1VF5C 1AQTA 4H0LC 3PHLA 1LTGC 3AEAC 3FGAD 2P67A 5B66E 2BEQD 1KYOD 2FXOA 1T6AA 1NU1J 1EDLA 2P10A 4HH2A 2IBZG 1HH0A 2C9LY 1L0NE 1S3JA 4H0LB 3O8ZA 1U7MA 2CKFA 2NVGA 1KQGB 1VQ6P 3H1KE 2ZYLA 1HVVA 1IK7A 3TGUJ 5AW9B 3H1IE 2K88A 2XU6A 3CD6P 1KILA 1NO4A 5B5EE 1OW7A 3VMZA 1ZN5A 1R5SA 1HGZA 4NBHD 2E76B 2DE5D 2R44A 1N7SB 1PP9G 3IFMA 3CCLP 3MUDC 2IBZI 1RF0C 2K9YA 1J2JB 5APSA 2Q3EA 1YTZI 4GOFA 5K5GB 2CK3H 3H32A 3C0DA 2O1JA 3L4FA 1SQVK 1H0TA 1LT1A 2WSCH 1NYHA 1PPJD 3GL0A 1NTMG 2PAJA 3C9IA 1URQA 2O01N 3OJAB 1IFJA 4IFFA 2AEJA 3GMAA 2LXCB 3V4QA 4HM5A 2O3JA 3IAOA 3KDPB 2WSEJ 3BRTB 3AECC 4U3FJ 3EFGA 1DIPA 2WSEH 2W6JH 1LTTC 2YIUC 2KYVA 4UB6E 2BASA 3NMDA 1URQD 3I56P 2N1TC 3VMXA 2DW3A 1HUCA 3S9OA 1NU1G 3AEDC 5CCHD 4HKZH 4AUWA 2DE6D 3EQ2A 2KNCA 5TJHA 2L5GB 1JY3N 1N7LA 3MZWB 1S1CX 2R3CA 4JQ0D 2E42A 1HBWA 2POHA 3QWOC 1L0NJ 1VCKA 4WVZA 2IZ0A 1YJNP 4CPGA 1NH4A 1NU1D 4H13D 1JTHB 1SQBG 4R4MA 4M3LA 1U57A 1P84D 4NBBD 1FOSF 3H1JG 1NTZG 4A7PA 1NOHA 3AE2C 1MFZA 1NAYA 1N7SC 1S72P 4HM1A 1RQUA 4LGDE 3NXSA 1EDIA 2ZJSE 5KJ7A 1IZNB 4HJGH 4D6TD 3AE8C 5APQA 2FXPA 1NTMK 2QIWA 4N3YB 1O7HA 2P1JA 1X79B 1EDKA 2W6BA 3B5NA 3TF5A 2R5DA 2FY8A 4P1CH 2IDBA 1KYOE 2NZ2A 1P84E 1S5LE 4JF7A 4C7NB 1LNQA 2KS1B 5APWA 1OX3A 3P7KA 2YXRB 1Z56A 2D2CD 3TGUD 1FZBA 3B5ND 4RJTA 1KILC 1AA0A 2OARA 2AXTE 3M9QA 4JBZA 3CWBG 4RKUJ 2HMKA 1JY2O 1QL2A 2FFDB 1YJ9P 2HPCB 5AEWA 5AVQB 3PTZA 3A0HE 1NJIQ 1FE6A 2OQQA 1JMBA 1S5LH 1FZCC 1OW8A 2Q7CA 4N78E 1DD4A 2IFMA 1KQSO 3H1KD 4I7ZB 4D6TG 2XR8A 1URQB 2YO3A 2BMQA 1IK9A 1LTSC 4NBGD 1VDFA 1KC8Q 3A2AA 1PIXA 1JUNA 2KI7B 2OYOA 1L0LK 1PL5A 1FBMA 2KK7A 4L75A 1GTWA 1NHLA 1WT6A 3LW5H 3ZDMA 1EZVI 2A06G 3EFFK 1VF5B 2IFNA 1T3UA 3IR9A 2H7HA 2NRGA 3KZIH 1G2CA 3Q2YA 4EI2A 3WMM0 4DT0A 3G9RA 2FKWB 5KJ7C 3CXHH 1A02F 1K73Q 2A06D 3MTUE 3EN1A 2BEZF 3CX5E 3NTNA 2OTJP 1QGKB 1LTJC 1CI6A 1VQ8P 2N9BA 1SQXK 2KLVA 5CCGA 5C39A 2I1JA 5AW5B 2QJYB 3IN6A 1O7GA 1OVVA 1FAVA 2QM7A 1LP1A 2K9JA 4GKGA 1O7PA 4EOTA 1OVRA 1FJKA 1RFSA 1N7SD 2KXPB 1KB9E 3HUSA 5TISE 2E74B 5B5EH 1Q90C 2SPZA 1O7NA 1BDCA 3AE1C 1FOSE 1SQPJ 1EZVE 1BE3G 1GL2D 4MN4C 4L73A 4IL6X 1M56D 1J1EC 4HM7A 2I8DA 1E5WA 3H1HG 2RH0A 4NBED 2OYIC 4EMJB 4YTPC 3GKEA 1SQVD 4HM8A 3L70G 1ZLLA 1T2KC 3AE3C 1L0LG 3ITKA 2WZ7A 4LC1A 3UIAA 3H1HD 5AVVB 1NTKE 3TNUA 2E43A 2HMJA 4HM6A 3OAKA 4WY4B 3WUUA 3H1ID 4NPEA 3A0BH 4XFJA 3Q5PA 4RO0A 3P8CD 2KB7P 2WSFJ 1RF1B 2D2CB 3GZXA 2N1TD 2BMRA 5DJTB 1EDJA 2LKMA 2QPZA 1R8EA 3RK2B 2JDIH 1M1JA 2YNYA 3EQQA 3FXEA 3M91A 2FYZA 1VQKP 2A45H 4IL6E 5B66H 3FXDA 5APVA 3I55P 1BE3D 3GHGC 1NU1E 1FQTA 2XZRA 2Q3IA 3U1CA 2ZXEB 4NBCD 5E79E 2XKMA 2JJLA 2E4PA 3MHVA 4GIFA 4K3AA 4NB8D 3L72G 1TU3F 2B89A 5AVTB 3FWNA 1EC5A 2LR2A 3BCCD 1L0LD 2FYUK 1N73B 2QE7H 3OA7A 1SQPE 4ZKUA 1RQVA 2B1XA 1DEEG 4AAYB 2E75B 3R2PA 1NKNA 2E4QA 3AE7C 4OVNF 1ZW0A 3L72D 3CMAP 4H0LD 1OXZA 1MFTA 3CPWO 3L71J 1P84H 1IFDA 3RK2C 2BMOA 2NPSB 5AW1B 1Q81Q 3FX0A 2GM4A 4OGQC 5GTIE 1L0LE 4QURA 1NTKJ 3VMGD 2XRXA 1VQPP 1N7SA 1YQ3C 4HM4A 3TGUE 3VTPC 1SQVJ 2P2UA 2WT7B 3H1LE 4TLFA 3RBZA 2Y0EA 3AE4C 2IBZE 4QCKA 1Q2NA 3V2PA 2QJYC 3EWKA 1O7MA 2NVFA 2KSJA 2QA4P 2JZAA 4WBAA 5CCHA 1JO5A 5AVUB 1URQC 3CX5D 1BCCG 3O6QA 3A5TA 3JCUH 2XSOA 3RL0g
chains in the Genus database with same CATH topology
4U7JA 3Q1MA 3AEEC 3AE2C 2FYUE 1UIXA 4Z1MH 4HM1A 1RQUA 3FOUA 2ZT9C 4QDDA 1KMIZ 3AE5C 2QJPC 3AE8C 2JO1A 2FXPA 4PV1C 2QIWA 1O7HA 2GBWA 4U3FE 2WSCJ 3L71E 1ULIA 2WQYC 2D2CC 4P1CH 2IDBA 1KYOE 3ABVC 2NZ2A 2B24A 2NUMA 1JM1A 1P84E 4PD4E 4PV1D 1BCCE 1SQBE 1BE3E 4KT0J 2QSIA 1G8KB 2FBWC 4I7ZC 4QUQA 1KILE 2HMMA 2D2CD 3L70E 3DQYA 1DD3A 1VL2A 4R4LA 2E75D 1EG9A 3VMHD 4RKUJ 2HMKA 2YVJB 3GF3A 1ZMEC 5AEWA 2I7FA 3BCCE 2ZT9B 2OQQA 3GZYA 1K04A 4H13B 1OW8A 1DD4A 1GMJA 4HM3A 2H89C 5M1BA 2H88C 2NVEA 5HL4A 1ZP0C 4I7ZB 1Y9BA 2XR8A 2BMQA 4NBGD 4NBAD 5AEUA 1PIXA 3Q3DA 4HJLA 1OMIA 2HMLA 2G3AA 1PL5A 4Y28J 3CXHE 3RK3E 3VMID 1EXJA 2GBXA 1ZOYC 3SFDC 1KQFB 1VF5B 3GCEA 2YFLA 2A06E 3GOBA 3Q2YA 1FDIA 4HKVA 1G8JB 1HJ0A 3AZCA 3G9RA 1SQQE 2NUKA 4QDCA 4PV1B 2NWFA 1UUWA 3AEFC 3EN1A 3L72E 2BEZF 1HF9A 3CX5E 5L8RJ 2E74D 2E75C 4YXDC 3LW5J 3GTEA 4HM0A 3GL2A 2Q3WA 1Q90D 1PV3A 3L74E 1NTME 2YMKA 2V7QJ 3IN6A 1EXIA 1O7GA 1PP9E 2HMNA 5BOKA 1WMKA 2FYNC 1O7PA 3Q5SA 3D70A 1RFSA 3VCAA 3SFEC 5KLVE 3D6YA 1KB9E 2JO6A 5CXMA 4NBDD 1JB0J 2E74B 4TT3H 4H44D 1Q90C 1NYKA 3GTSA 1O7NA 4H13C 4H44B 1NDOA 3AE1C 1EZVE 4IL6X 1PPJE 1O7WA 4HM7A 3CWBE 2E76D 3T97B 4NBED 4EMJB 3C8VA 4YTPC 3H1HE 2YFJA 3GKEA 1KTMA 2DE7D 3GB4A 4HM8A 3AE3C 3N0QA 1VF5C 1NTKE 4H0LC 1SJGA 3AEAC 2HMJA 3FGAD 4HM6A 1SQXE 2BEQD 2P10A 3GLMA 4XFJA 3Q5PA 4OGQB 3L73E 3D89A 1L0NE 4H0LB 2WSFJ 1K05A 2CKFA 2D2CB 2NVGA 1KQGB 1KORA 3GZXA 3H1KE 2ZYLA 1OW6A 2BMRA 1VM9A 2WPVB 1IK7A 2G8YA 1ZRTE 1VF5D 3H1IE 2QPZA 1R8EA 1MKMA 5KLIC 3D71A 2E76C 3Q5RA 3EQQA 1S5LX 1OW7A 1NGMB 2XSHA 4NBHD 2J5UA 4H44C 2E76B 3L75E 2DE5D 3H1JE 1NTZE 3R4YA 1NU1E 1FQTA 2K9YA 4NBCD 1FDOA 3B71A 4HM2A 3C0DA 2E4PA 1YQ4C 3VCPA 4NB8D 1TU3F 1NYHA 3GL0A 2QJKC 3AEGC 4QDFA 1SQPE 3GMAA 3AE6C 4GDOA 1RQVA 4HM5A 1ULJA 2B1XA 4OGQD 4NBFD 4AAYB 2JP3A 2E75B 3IAOA 2MKVA 2E4QA 3AE7C 3H25A 2WSEJ 2YFIA 2O01J 3AECC 4H0LD 2HMOA 1AJYA 4QUPA 1DIPA 4QDFB 2YIUC 2BMOA 4P1BH 4OGQC 1L0LE 1UUVA 4QURA 3S9OA 3VMGD 3AEDC 4NB9D 2XRXA 1YQ3C 4HM4A 2DE6D 3TGUE 2BCCE 1RIEA 2E74C 4AIVA 3AEBC 1S1CX 3H1LE 1WQLA 2ZT9D 3AE4C 3AE9C 2IBZE 4QCKA 3D6ZA 2QJYC 3EWKA 1VCKA 1O7MA 2NVFA 2JZAA 4H13D 3O6QA 4R4MA 5KKZC 3GF7A 1SQVE 1U57A 2XSOA 4NBBD 3RL0g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 C;  4NBC D;  1NYK A;  2NVE A;  5HL4 A;  3GTS A;  1O7N A;  2FYU E;  4HM2 A;  4H13 C;  2XR8 A;  1NDO A;  4HM1 A;  2BMQ A;  3C0D A;  3FOU A;  2E4P A;  1EZV E;  2ZT9 C;  4NBG D;  4NBA D;  4QDD A;  3VCP A;  1PPJ E;  5AEU A;  4HJL A;  1O7W A;  4NB8 D;  2HML A;  4HM7 A;  2QJP C;  3CXH E;  3GL0 A;  3CWB E;  2QJK C;  2E76 D;  4PV1 C;  4NBE D;  3VMI D;  4EMJ B;  1O7H A;  3H1H E;  4QDF A;  2GBW A;  2YFJ A;  3GKE A;  1SQP E;  4U3F E;  2GBX A;  2DE7 D;  3GB4 A;  4HM8 A;  3L71 E;  1ULI A;  3GCE A;  2YFL A;  4HM5 A;  1ULJ A;  2B1X A;  2D2C C;  4OGQ D;  2A06 E;  4NBF D;  4P1C H;  4AAY B;  1KYO E;  2E4Q A;  3GOB A;  4HKV A;  1G8J B;  2B24 A;  2NUM A;  1JM1 A;  2YFI A;  1P84 E;  3AZC A;  4H0L D;  3N0Q A;  2HMO A;  4PD4 E;  1SQQ E;  1VF5 C;  2NUK A;  1NTK E;  4H0L C;  4QDC A;  4QDF B;  4QUP A;  1SJG A;  4PV1 D;  2HMJ A;  1BCC E;  1SQB E;  4HM6 A;  1SQX E;  1BE3 E;  2NWF A;  1G8K B;  1UUW A;  2YIU C;  4I7Z C;  4QUQ A;  3EN1 A;  2BMO A;  3L72 E;  3CX5 E;  4P1B H;  2E74 D;  3L73 E;  2HMM A;  2D2C D;  4OGQ C;  3D89 A;  2E75 C;  1L0L E;  1L0N E;  1UUV A;  3L70 E;  3DQY A;  4QUR A;  4HM0 A;  3GTE A;  3GL2 A;  2CKF A;  3VMG D;  2NVG A;  2Q3W A;  4NB9 D;  2XRX A;  3GZX A;  3H1K E;  4HM4 A;  2E75 D;  2DE6 D;  1EG9 A;  2BMR A;  2ZYL A;  3TGU E;  1VM9 A;  3L74 E;  3VMH D;  2BCC E;  1NTM E;  2YMK A;  1ZRT E;  1VF5 D;  1RIE A;  3H1I E;  2HMK A;  2YVJ B;  1PP9 E;  2E74 C;  1O7G A;  2QPZ A;  4AIV A;  2HMN A;  3H1L E;  1WQL A;  2ZT9 D;  5KLI C;  5BOK A;  2E76 C;  2IBZ E;  4QCK A;  2FYN C;  1O7P A;  2QJY C;  3EQQ A;  5AEW A;  2I7F A;  1VCK A;  1O7M A;  2NVF A;  3BCC E;  1RFS A;  2JZA A;  2XSH A;  4H13 D;  3VCA A;  4NBH D;  4H44 C;  5KLV E;  3GZY A;  3L75 E;  2DE5 D;  1KB9 E;  1NTZ E;  3H1J E;  1SQV E;  5KKZ C;  2JO6 A;  5CXM A;  4NBD D;  1NU1 E;  1FQT A;  4HM3 A;  4H44 D;  2XSO A;  4NBB D; 
#chains in the Genus database with same CATH topology
 3BCC G;  1GU4 A;  5KAF E;  3V5B A;  4W80 A;  2W83 C;  2XDJ A;  1KMI Z;  3AE5 C;  1KV4 A;  3C1L A;  4PV1 C;  1Y8A A;  1VQ7 P;  2Q6Q A;  1RHZ B;  4U3F E;  4GT1 A;  2KSE A;  1L0N G;  1RE4 C;  1SS1 A;  1KFN A;  2WQY C;  1RF1 C;  2D2C C;  2Z5H A;  4ASW A;  1KIL D;  2V4H A;  3RGU A;  1JM1 A;  2HLO A;  3P8C E;  3KHU A;  1X9V A;  3GG2 A;  2JWD A;  3KXD A;  2M3E A;  1VQ5 P;  1VQL P;  4KT0 J;  4BXL A;  2QSI A;  3WU2 E;  2KP8 A;  4QUQ A;  2WIT A;  3L72 J;  3L70 E;  1IFI A;  4C7N A;  1LP1 B;  1VL2 A;  3TDK A;  5KLV G;  1EG9 A;  3VOP A;  1M1K Q;  3VMH D;  3RL0 D;  1NVO A;  1J1D B;  4AQR D;  3HTK A;  2OGU A;  3L74 D;  1L0L J;  1SQP D;  5KAI H;  2I7F A;  1CSB A;  5AW4 B;  4L74 A;  2IYO A;  2KOG A;  5KLV K;  1W2E A;  1SVF A;  3GZY A;  1K04 A;  2WPR A;  3M06 A;  3B5N C;  2Z4E A;  3CI9 A;  3CXH D;  2NVE A;  5AVZ B;  5HL4 A;  5CCG C;  1Y9B A;  1DX7 A;  1L4A A;  3CCE P;  3CME P;  2Y9Y A;  2RN0 A;  4D6T E;  5AEU A;  1X22 A;  3Q3D A;  4HJL A;  2HML A;  1IFP A;  1JTH A;  2P7J A;  4Y28 J;  3LID A;  3VMI D;  2M0B A;  2Y0D A;  1WRG A;  1KB9 I;  1H8A A;  2GBX A;  1ZOY C;  3SFD C;  1KQF B;  1SQX J;  2YFL A;  3VP8 A;  2NPS A;  5CBN A;  3GOB A;  1N86 A;  1FDI A;  3M0D C;  1LT9 B;  1W5C E;  5AVX B;  2R32 A;  2WTY A;  3PRJ A;  1L4A D;  1SQQ E;  3S1K A;  1SQX G;  5CJ0 A;  5KTB A;  3MD0 A;  2NUK A;  4QDC A;  2H8P D;  4PV1 B;  2NWF A;  1HF9 A;  3H1L G;  1LTB C;  3M0D A;  1L2P A;  2E75 C;  2IPP A;  3LW5 J;  1HJB A;  3L74 G;  3GL2 A;  1RH5 B;  1SQP G;  2ZFC A;  2H43 A;  2HR3 A;  1YIJ P;  1N73 A;  2VRS A;  5KJ7 D;  2XV5 A;  2M8R A;  5BOK A;  2K9J B;  3II6 A;  3L70 J;  2XND H;  3VCA A;  1GDT A;  2JO6 A;  4NBD D;  2B87 B;  4H44 D;  2R5B A;  1SQB K;  4H44 B;  3O6Q B;  2ZYD A;  3WU2 H;  1S2E A;  1JM0 A;  2OTL P;  1PPJ E;  1PFI A;  5H2F H;  3HE5 A;  1O7W A;  1JEK A;  4UB6 H;  1GW3 A;  1JMM A;  1KZU B;  3CWB E;  2RKL A;  5DJU B;  3T97 B;  1FZC B;  2YXQ B;  3H1H E;  4O9B A;  2ZAE B;  1GU5 A;  3L73 G;  2R3S A;  3BRV B;  1S9K E;  2FYU G;  1Q82 Q;  2WSS H;  1FJP A;  3HD7 D;  4WY4 A;  1LTA C;  1ZR2 A;  1M8O B;  2ZVO B;  3H1I G;  1BGY J;  1P84 I;  1T3J A;  3CWB D;  1SQX E;  2FYN B;  1A02 J;  2BCC J;  2JWA A;  5KAF H;  3PH0 A;  4U3F D;  3GLM A;  3M9B A;  4XE5 B;  4ZNC A;  3L73 E;  1FU1 A;  2LXB A;  3D89 A;  3RK2 D;  2OYH A;  1BCC J;  2E5Y A;  1KOR A;  2BCC G;  5CMZ A;  1HTL C;  1OW6 A;  1KN7 A;  1VM9 A;  1BSH A;  2G8Y A;  3A7O A;  3S4R A;  3H1I J;  1MKM A;  5KLI C;  1LWU C;  2HPC A;  5KLV D;  4AYC A;  1BGY D;  2XSH A;  2ITA A;  1KQL A;  4HB1 A;  3L75 E;  1NTZ E;  2B9B A;  3H1J E;  3R4Y A;  1X0T A;  1J1E B;  3HD7 C;  1FDO A;  5GTI H;  1YYC A;  4BRY A;  4HM2 A;  3L71 G;  1YQ4 C;  4EYY Q;  2N1T A;  3VCP A;  1D7M A;  3PP5 A;  1NWQ A;  5AW7 B;  1LWU A;  2QJK C;  3AEG C;  3NFQ A;  5BVZ A;  3B5N B;  1T2K D;  1CI6 B;  3AE6 C;  3CC7 P;  1N2D C;  1FZE A;  1GK6 A;  1PGQ A;  2PP6 A;  4OGQ D;  2JP3 A;  2OYH C;  2MKV A;  1IFM A;  1H0T B;  3I5C A;  4N78 D;  1H89 A;  2YFI A;  2KLU A;  5AVY B;  4QMA A;  2HMO A;  1AJY A;  1L0N K;  4QUP A;  4QDF B;  3BAS A;  2M5A A;  1BE3 J;  2OYI B;  2YKO A;  2A45 G;  4P1B H;  1J1D C;  4PJ0 E;  2YKQ A;  3HTK B;  2ZXX A;  1KIL B;  3HE5 B;  1W2B O;  1OWA A;  2N9Y B;  3BCC J;  1KD1 Q;  4IOI H;  2BCC E;  4GOE A;  3IF4 A;  2E74 C;  4AIV A;  3AEB C;  5APX A;  1WQL A;  2ZT9 D;  3N7N A;  3CX5 H;  3L37 A;  2JEE A;  2HOD B;  2KZJ A;  3GF7 A;  1SQV E;  1CZQ A;  3A0H H;  3H1L J;  3CCM P;  4WB4 A;  3GHG B;  4LLH A;  1IFN A;  1SQV G;  3H1H J;  1JY2 N;  1UIX A;  1USE A;  5CCG D;  1X8Y A;  3VMA A;  5AW3 B;  3HD7 B;  3MGN A;  3JC2 2;  1NTZ J;  3H1J J;  2YKP A;  4UB8 E;  1AFO A;  1SFC B;  4DOJ A;  2JO1 A;  1SQP K;  4XA4 A;  1GD2 E;  1RE3 C;  2WSC J;  1MZ9 A;  3L71 E;  1ULI A;  1JY2 P;  3TK1 A;  4ZKP A;  2GUS A;  2ZVN B;  1VQM P;  3OW2 O;  2B24 A;  2NUM A;  2O01 H;  1OVU A;  2QEX P;  3H32 B;  1LJ2 A;  3L73 J;  4PV1 D;  3L75 D;  1BCC E;  5AW0 B;  5KLV J;  1G8K B;  1M1J B;  1U7J A;  3L74 J;  2FBW C;  4I7Z C;  1NTM J;  1KIL E;  3HRN A;  1VQN P;  4PD4 D;  4OH8 B;  1FZA A;  4GOD A;  1SQB D;  2E75 D;  2V7Q H;  4W7Y A;  2JKV A;  5TIS H;  3CC2 P;  1NTZ D;  3H1J D;  1KYO I;  2OYI A;  2YVJ B;  4JPZ B;  3GF3 A;  1ZME C;  3CCJ P;  5AVR B;  3BCC E;  3V2Q A;  3G4S P;  3CL3 D;  5KAI E;  1ZV8 A;  4HM3 A;  3G6E P;  1M7L A;  2M3B A;  1JY3 O;  2MJZ A;  1EZV D;  2OTK E;  3LIE A;  4NPF X;  1KYO H;  5GTH E;  2XNX A;  4NBA D;  3N4X A;  1SQQ G;  2FFD A;  1VPC A;  3CXH E;  3RK3 E;  3USS A;  3W67 A;  1YI2 P;  1EXJ A;  1OIP A;  4UB8 H;  1JY3 P;  3GCE A;  3A0B E;  4HKV A;  1G8J B;  5APU A;  3AZC A;  1NTM D;  2K3R A;  2Z5I A;  1LT9 A;  3U1A A;  2NPS D;  1UUW A;  3L72 E;  2AEF A;  3V6I A;  2UWJ E;  2E74 D;  1JCD A;  4IL6 H;  2OYH B;  3RK3 D;  4YXD C;  4HM0 A;  3GTE A;  1GZL A;  2Q3W A;  1AVO A;  3L74 E;  1NTM E;  2YMK A;  1OFC X;  1N73 C;  1EXI A;  4KJM A;  3RL0 B;  2WSF H;  3F5H A;  3MIW A;  2HMN A;  2W90 A;  4JYC A;  2K37 A;  3L71 D;  2C0W A;  3CXH I;  1EZV G;  3H6P A;  3H1K J;  1SFC D;  5KLV E;  1NU1 K;  3D6Y A;  1NTK G;  2QRX A;  1CW5 A;  3SSU A;  2AXT H;  1JB0 J;  3CCV P;  4OWF A;  3CX5 I;  1G2C B;  1NYK A;  1ZXG A;  3GTS A;  1PPJ G;  5BU8 B;  3JSV C;  1FZC A;  3T97 A;  2WPS A;  1LTJ B;  1N8R Q;  2ZYA A;  2NPS C;  5EFW B;  2HFE D;  2E76 D;  2WPQ A;  2B87 A;  1LT9 C;  4K35 A;  3C8V A;  2YFJ A;  2KNC B;  3RK3 C;  1FZF A;  2Q9I A;  1AVY A;  1KTM A;  4YPC A;  3GB4 A;  3M9H A;  5AVS B;  3P8M C;  3V2R A;  3CWB J;  1G1I A;  5AW8 B;  1E79 H;  4C46 A;  3BAT A;  2YO2 A;  3KPE A;  1NAF A;  1SJG A;  4IFD K;  3MP7 B;  2QJK B;  2Q5U A;  2WVR A;  4YXW H;  1KB9 H;  4OGQ B;  3HD7 A;  4WY4 D;  2O1K A;  1K05 A;  1SQB J;  2QG4 A;  2QVA A;  2W8Z A;  2WPV B;  4D6T J;  5CCH C;  1BGY G;  1ZRT E;  1VF5 D;  2IBZ D;  2C0X A;  1MV8 A;  1NTK D;  3D71 A;  2E76 C;  3Q5R A;  3E1I A;  1RE3 A;  2FYU J;  4PD4 I;  1S5L X;  4Y99 B;  1NGM B;  3SWY A;  2J5U A;  4H44 C;  3TSI A;  2A45 I;  2ZYG A;  4KHX A;  1QL1 A;  2CPS A;  1PGP A;  1G1J A;  2B88 A;  2KUB A;  3B71 A;  1HWT C;  3VN0 A;  1VQ9 P;  3L70 D;  1K8A Q;  1FZG A;  2E5T A;  1YBK A;  3E1R A;  2M5A B;  3WUT A;  3U59 A;  4PD4 H;  3G3Z A;  1RF1 A;  1ZRT D;  4WY4 C;  3TNU B;  4QDF A;  2CPB A;  1MUU A;  2Q1K A;  4GDO A;  1RY3 A;  2AEM A;  4JYB A;  1ULJ A;  3E7K A;  3GW6 A;  4NBF D;  3H1L D;  1QVG O;  3MUD A;  3H25 A;  2O01 J;  2YIU B;  3TGU G;  1JNM A;  1YHQ P;  4DZO A;  1LWU B;  1NKZ B;  1OZH A;  3CCR P;  1UUV A;  2HYN A;  4NB9 D;  4BRY B;  3HE4 B;  1GL2 A;  2IZ1 A;  2QM8 A;  4U3F G;  1FC2 C;  1EQ7 A;  3L36 A;  1RIE A;  2FXM A;  1NTZ K;  1PP9 J;  1M1J C;  1RE4 A;  3AE9 C;  3D6Z A;  1GL2 B;  2P58 A;  1KFM A;  1VQ4 P;  1Y47 A;  2GUV A;  2KS1 A;  4BWN A;  3FWL A;  5KKZ C;  3HE4 A;  3L75 J;  5CHX A;  1QLE D;  1RF0 A;  1NTK K;  4U7J A;  3Q1M A;  3AEE C;  2FYU E;  2W27 A;  4I1L A;  4Z1M H;  3FOU A;  1VQO P;  2ZT9 C;  4QDD A;  2W6A A;  2PFX A;  3VP9 A;  3SWK A;  5AVW B;  2QJP C;  1T8Z A;  1PP9 D;  1PGJ A;  1QEX A;  2GBW A;  3KYQ A;  1Q86 Q;  1IO4 A;  2Y0C A;  1JCC A;  4EIJ A;  1SLQ A;  1XTG B;  1LTJ A;  3ABV C;  2RMZ A;  3VMY A;  3PLN A;  3KZI E;  1IJD B;  4ZMD A;  4PD4 E;  1SQB E;  1S9K D;  2K1A A;  2WT7 A;  1BE3 E;  3WUV A;  1DEB A;  2HG5 D;  1S4X A;  5E79 H;  2HMM A;  1ZR4 A;  3CLQ A;  3SWF A;  3DQY A;  1DD3 A;  3HUS C;  3VYI A;  5GTH H;  1LTI C;  1BCC D;  3L35 A;  4R4L A;  1SQX D;  1LGH B;  2C9N Y;  4I2L C;  3QH9 A;  5BU5 A;  2JR8 A;  2KIK A;  1JOC A;  1SQQ K;  1PZQ A;  3CCQ P;  1IC2 A;  3M0A A;  3TYY A;  1BSN A;  2PRR A;  2WWW A;  2ZT9 B;  4PJ0 H;  4C7R A;  3K5B A;  4H13 B;  5APY A;  2PGD A;  2QJP B;  1GMJ A;  2H89 C;  5M1B A;  2H88 C;  1SQQ D;  1QX8 A;  1ZP0 C;  1HGV A;  5KKZ B;  1L0N D;  4DCK A;  4N6J A;  4WWI A;  1GW4 A;  1OMI A;  3GHG A;  1GL2 C;  2HOD A;  2G3A A;  4L76 A;  3BVH A;  1XTC C;  2KZI A;  4NPD A;  2IYP A;  5AW2 B;  3CCU P;  2A06 E;  3RL0 C;  3V2N A;  5AW6 B;  1UII A;  4RES B;  1HJ0 A;  1BDD A;  1SQQ J;  3JCU E;  1PGO A;  1FS0 E;  4HYT B;  5CBO A;  4Y99 C;  3RK3 B;  2WMM A;  3L73 D;  3AEF C;  2FFD C;  3A3Y B;  1M90 Q;  1H88 A;  4W7Z A;  3CC4 P;  5L8R J;  2FYU D;  1L4A B;  1YIT P;  3V4W A;  1Q90 D;  1PV3 A;  2V7Q J;  1QVF O;  1SP4 A;  2IX7 C;  1PP9 E;  5H2F E;  4IFM A;  2L91 A;  1WMK A;  2FYN C;  3RBX A;  3Q5S A;  3D70 A;  2J58 A;  3SFE C;  1R5L A;  2BCC D;  5CXM A;  2N1T B;  4TT3 H;  2I1K A;  5CJ4 A;  1USD A;  2GA1 A;  2Y9Z A;  3KQG A;  3G71 P;  3W68 A;  4H13 C;  1NDO A;  1L4A C;  1Q7Y Q;  1KB9 D;  1YTZ T;  2AXC A;  5APT A;  4ASV A;  1SFC C;  4I6M C;  1AQ5 A;  3H1K G;  4B86 A;  3L75 G;  2DE7 D;  4DJG A;  2YMY A;  1DH3 A;  1GK4 A;  3F89 A;  1SFC A;  3CCS P;  3HUS B;  5KLI B;  1K9M Q;  3B4S A;  1M57 D;  2J59 M;  3B8E B;  4EDF A;  1FDM A;  1YJW P;  1AV1 A;  3P32 A;  3N0Q A;  3PJS K;  1BGY E;  1VF5 C;  1AQT A;  4H0L C;  3PHL A;  1LTG C;  3AEA C;  3FGA D;  2P67 A;  5B66 E;  2BEQ D;  1KYO D;  2FXO A;  1T6A A;  1NU1 J;  1EDL A;  2P10 A;  4HH2 A;  2IBZ G;  1HH0 A;  2C9L Y;  1L0N E;  1S3J A;  4H0L B;  3O8Z A;  1U7M A;  2CKF A;  2NVG A;  1KQG B;  1VQ6 P;  3H1K E;  2ZYL A;  1HVV A;  1IK7 A;  3TGU J;  5AW9 B;  3H1I E;  2K88 A;  2XU6 A;  3CD6 P;  1KIL A;  1NO4 A;  5B5E E;  1OW7 A;  3VMZ A;  1ZN5 A;  1R5S A;  1HGZ A;  4NBH D;  2E76 B;  2DE5 D;  2R44 A;  1N7S B;  1PP9 G;  3IFM A;  3CCL P;  3MUD C;  2IBZ I;  1RF0 C;  2K9Y A;  1J2J B;  5APS A;  2Q3E A;  1YTZ I;  4GOF A;  5K5G B;  2CK3 H;  3H32 A;  3C0D A;  2O1J A;  3L4F A;  1SQV K;  1H0T A;  1LT1 A;  2WSC H;  1NYH A;  1PPJ D;  3GL0 A;  1NTM G;  2PAJ A;  3C9I A;  1URQ A;  2O01 N;  3OJA B;  1IFJ A;  4IFF A;  2AEJ A;  3GMA A;  2LXC B;  3V4Q A;  4HM5 A;  2O3J A;  3IAO A;  3KDP B;  2WSE J;  3BRT B;  3AEC C;  4U3F J;  3EFG A;  1DIP A;  2WSE H;  2W6J H;  1LTT C;  2YIU C;  2KYV A;  4UB6 E;  2BAS A;  3NMD A;  1URQ D;  3I56 P;  2N1T C;  3VMX A;  2DW3 A;  1HUC A;  3S9O A;  1NU1 G;  3AED C;  5CCH D;  4HKZ H;  4AUW A;  2DE6 D;  3EQ2 A;  2KNC A;  5TJH A;  2L5G B;  1JY3 N;  1N7L A;  3MZW B;  1S1C X;  2R3C A;  4JQ0 D;  2E42 A;  1HBW A;  2POH A;  3QWO C;  1L0N J;  1VCK A;  4WVZ A;  2IZ0 A;  1YJN P;  4CPG A;  1NH4 A;  1NU1 D;  4H13 D;  1JTH B;  1SQB G;  4R4M A;  4M3L A;  1U57 A;  1P84 D;  4NBB D;  1FOS F;  3H1J G;  1NTZ G;  4A7P A;  1NOH A;  3AE2 C;  1MFZ A;  1NAY A;  1N7S C;  1S72 P;  4HM1 A;  1RQU A;  4LGD E;  3NXS A;  1EDI A;  2ZJS E;  5KJ7 A;  1IZN B;  4HJG H;  4D6T D;  3AE8 C;  5APQ A;  2FXP A;  1NTM K;  2QIW A;  4N3Y B;  1O7H A;  2P1J A;  1X79 B;  1EDK A;  2W6B A;  3B5N A;  3TF5 A;  2R5D A;  2FY8 A;  4P1C H;  2IDB A;  1KYO E;  2NZ2 A;  1P84 E;  1S5L E;  4JF7 A;  4C7N B;  1LNQ A;  2KS1 B;  5APW A;  1OX3 A;  3P7K A;  2YXR B;  1Z56 A;  2D2C D;  3TGU D;  1FZB A;  3B5N D;  4RJT A;  1KIL C;  1AA0 A;  2OAR A;  2AXT E;  3M9Q A;  4JBZ A;  3CWB G;  4RKU J;  2HMK A;  1JY2 O;  1QL2 A;  2FFD B;  1YJ9 P;  2HPC B;  5AEW A;  5AVQ B;  3PTZ A;  3A0H E;  1NJI Q;  1FE6 A;  2OQQ A;  1JMB A;  1S5L H;  1FZC C;  1OW8 A;  2Q7C A;  4N78 E;  1DD4 A;  2IFM A;  1KQS O;  3H1K D;  4I7Z B;  4D6T G;  2XR8 A;  1URQ B;  2YO3 A;  2BMQ A;  1IK9 A;  1LTS C;  4NBG D;  1VDF A;  1KC8 Q;  3A2A A;  1PIX A;  1JUN A;  2KI7 B;  2OYO A;  1L0L K;  1PL5 A;  1FBM A;  2KK7 A;  4L75 A;  1GTW A;  1NHL A;  1WT6 A;  3LW5 H;  3ZDM A;  1EZV I;  2A06 G;  3EFF K;  1VF5 B;  2IFN A;  1T3U A;  3IR9 A;  2H7H A;  2NRG A;  3KZI H;  1G2C A;  3Q2Y A;  4EI2 A;  3WMM 0;  4DT0 A;  3G9R A;  2FKW B;  5KJ7 C;  3CXH H;  1A02 F;  1K73 Q;  2A06 D;  3MTU E;  3EN1 A;  2BEZ F;  3CX5 E;  3NTN A;  2OTJ P;  1QGK B;  1LTJ C;  1CI6 A;  1VQ8 P;  2N9B A;  1SQX K;  2KLV A;  5CCG A;  5C39 A;  2I1J A;  5AW5 B;  2QJY B;  3IN6 A;  1O7G A;  1OVV A;  1FAV A;  2QM7 A;  1LP1 A;  2K9J A;  4GKG A;  1O7P A;  4EOT A;  1OVR A;  1FJK A;  1RFS A;  1N7S D;  2KXP B;  1KB9 E;  3HUS A;  5TIS E;  2E74 B;  5B5E H;  1Q90 C;  2SPZ A;  1O7N A;  1BDC A;  3AE1 C;  1FOS E;  1SQP J;  1EZV E;  1BE3 G;  1GL2 D;  4MN4 C;  4L73 A;  4IL6 X;  1M56 D;  1J1E C;  4HM7 A;  2I8D A;  1E5W A;  3H1H G;  2RH0 A;  4NBE D;  2OYI C;  4EMJ B;  4YTP C;  3GKE A;  1SQV D;  4HM8 A;  3L70 G;  1ZLL A;  1T2K C;  3AE3 C;  1L0L G;  3ITK A;  2WZ7 A;  4LC1 A;  3UIA A;  3H1H D;  5AVV B;  1NTK E;  3TNU A;  2E43 A;  2HMJ A;  4HM6 A;  3OAK A;  4WY4 B;  3WUU A;  3H1I D;  4NPE A;  3A0B H;  4XFJ A;  3Q5P A;  4RO0 A;  3P8C D;  2KB7 P;  2WSF J;  1RF1 B;  2D2C B;  3GZX A;  2N1T D;  2BMR A;  5DJT B;  1EDJ A;  2LKM A;  2QPZ A;  1R8E A;  3RK2 B;  2JDI H;  1M1J A;  2YNY A;  3EQQ A;  3FXE A;  3M91 A;  2FYZ A;  1VQK P;  2A45 H;  4IL6 E;  5B66 H;  3FXD A;  5APV A;  3I55 P;  1BE3 D;  3GHG C;  1NU1 E;  1FQT A;  2XZR A;  2Q3I A;  3U1C A;  2ZXE B;  4NBC D;  5E79 E;  2XKM A;  2JJL A;  2E4P A;  3MHV A;  4GIF A;  4K3A A;  4NB8 D;  3L72 G;  1TU3 F;  2B89 A;  5AVT B;  3FWN A;  1EC5 A;  2LR2 A;  3BCC D;  1L0L D;  2FYU K;  1N73 B;  2QE7 H;  3OA7 A;  1SQP E;  4ZKU A;  1RQV A;  2B1X A;  1DEE G;  4AAY B;  2E75 B;  3R2P A;  1NKN A;  2E4Q A;  3AE7 C;  4OVN F;  1ZW0 A;  3L72 D;  3CMA P;  4H0L D;  1OXZ A;  1MFT A;  3CPW O;  3L71 J;  1P84 H;  1IFD A;  3RK2 C;  2BMO A;  2NPS B;  5AW1 B;  1Q81 Q;  3FX0 A;  2GM4 A;  4OGQ C;  5GTI E;  1L0L E;  4QUR A;  1NTK J;  3VMG D;  2XRX A;  1VQP P;  1N7S A;  1YQ3 C;  4HM4 A;  3TGU E;  3VTP C;  1SQV J;  2P2U A;  2WT7 B;  3H1L E;  4TLF A;  3RBZ A;  2Y0E A;  3AE4 C;  2IBZ E;  4QCK A;  1Q2N A;  3V2P A;  2QJY C;  3EWK A;  1O7M A;  2NVF A;  2KSJ A;  2QA4 P;  2JZA A;  4WBA A;  5CCH A;  1JO5 A;  5AVU B;  1URQ C;  3CX5 D;  1BCC G;  3O6Q A;  3A5T A;  3JCU H;  2XSO A;  3RL0 g; 
#chains in the Genus database with same CATH homology
 4U7J A;  3Q1M A;  3AEE C;  3AE2 C;  2FYU E;  1UIX A;  4Z1M H;  4HM1 A;  1RQU A;  3FOU A;  2ZT9 C;  4QDD A;  1KMI Z;  3AE5 C;  2QJP C;  3AE8 C;  2JO1 A;  2FXP A;  4PV1 C;  2QIW A;  1O7H A;  2GBW A;  4U3F E;  2WSC J;  3L71 E;  1ULI A;  2WQY C;  2D2C C;  4P1C H;  2IDB A;  1KYO E;  3ABV C;  2NZ2 A;  2B24 A;  2NUM A;  1JM1 A;  1P84 E;  4PD4 E;  4PV1 D;  1BCC E;  1SQB E;  1BE3 E;  4KT0 J;  2QSI A;  1G8K B;  2FBW C;  4I7Z C;  4QUQ A;  1KIL E;  2HMM A;  2D2C D;  3L70 E;  3DQY A;  1DD3 A;  1VL2 A;  4R4L A;  2E75 D;  1EG9 A;  3VMH D;  4RKU J;  2HMK A;  2YVJ B;  3GF3 A;  1ZME C;  5AEW A;  2I7F A;  3BCC E;  2ZT9 B;  2OQQ A;  3GZY A;  1K04 A;  4H13 B;  1OW8 A;  1DD4 A;  1GMJ A;  4HM3 A;  2H89 C;  5M1B A;  2H88 C;  2NVE A;  5HL4 A;  1ZP0 C;  4I7Z B;  1Y9B A;  2XR8 A;  2BMQ A;  4NBG D;  4NBA D;  5AEU A;  1PIX A;  3Q3D A;  4HJL A;  1OMI A;  2HML A;  2G3A A;  1PL5 A;  4Y28 J;  3CXH E;  3RK3 E;  3VMI D;  1EXJ A;  2GBX A;  1ZOY C;  3SFD C;  1KQF B;  1VF5 B;  3GCE A;  2YFL A;  2A06 E;  3GOB A;  3Q2Y A;  1FDI A;  4HKV A;  1G8J B;  1HJ0 A;  3AZC A;  3G9R A;  1SQQ E;  2NUK A;  4QDC A;  4PV1 B;  2NWF A;  1UUW A;  3AEF C;  3EN1 A;  3L72 E;  2BEZ F;  1HF9 A;  3CX5 E;  5L8R J;  2E74 D;  2E75 C;  4YXD C;  3LW5 J;  3GTE A;  4HM0 A;  3GL2 A;  2Q3W A;  1Q90 D;  1PV3 A;  3L74 E;  1NTM E;  2YMK A;  2V7Q J;  3IN6 A;  1EXI A;  1O7G A;  1PP9 E;  2HMN A;  5BOK A;  1WMK A;  2FYN C;  1O7P A;  3Q5S A;  3D70 A;  1RFS A;  3VCA A;  3SFE C;  5KLV E;  3D6Y A;  1KB9 E;  2JO6 A;  5CXM A;  4NBD D;  1JB0 J;  2E74 B;  4TT3 H;  4H44 D;  1Q90 C;  1NYK A;  3GTS A;  1O7N A;  4H13 C;  4H44 B;  1NDO A;  3AE1 C;  1EZV E;  4IL6 X;  1PPJ E;  1O7W A;  4HM7 A;  3CWB E;  2E76 D;  3T97 B;  4NBE D;  4EMJ B;  3C8V A;  4YTP C;  3H1H E;  2YFJ A;  3GKE A;  1KTM A;  2DE7 D;  3GB4 A;  4HM8 A;  3AE3 C;  3N0Q A;  1VF5 C;  1NTK E;  4H0L C;  1SJG A;  3AEA C;  2HMJ A;  3FGA D;  4HM6 A;  1SQX E;  2BEQ D;  2P10 A;  3GLM A;  4XFJ A;  3Q5P A;  4OGQ B;  3L73 E;  3D89 A;  1L0N E;  4H0L B;  2WSF J;  1K05 A;  2CKF A;  2D2C B;  2NVG A;  1KQG B;  1KOR A;  3GZX A;  3H1K E;  2ZYL A;  1OW6 A;  2BMR A;  1VM9 A;  2WPV B;  1IK7 A;  2G8Y A;  1ZRT E;  1VF5 D;  3H1I E;  2QPZ A;  1R8E A;  1MKM A;  5KLI C;  3D71 A;  2E76 C;  3Q5R A;  3EQQ A;  1S5L X;  1OW7 A;  1NGM B;  2XSH A;  4NBH D;  2J5U A;  4H44 C;  2E76 B;  3L75 E;  2DE5 D;  3H1J E;  1NTZ E;  3R4Y A;  1NU1 E;  1FQT A;  2K9Y A;  4NBC D;  1FDO A;  3B71 A;  4HM2 A;  3C0D A;  2E4P A;  1YQ4 C;  3VCP A;  4NB8 D;  1TU3 F;  1NYH A;  3GL0 A;  2QJK C;  3AEG C;  4QDF A;  1SQP E;  3GMA A;  3AE6 C;  4GDO A;  1RQV A;  4HM5 A;  1ULJ A;  2B1X A;  4OGQ D;  4NBF D;  4AAY B;  2JP3 A;  2E75 B;  3IAO A;  2MKV A;  2E4Q A;  3AE7 C;  3H25 A;  2WSE J;  2YFI A;  2O01 J;  3AEC C;  4H0L D;  2HMO A;  1AJY A;  4QUP A;  1DIP A;  4QDF B;  2YIU C;  2BMO A;  4P1B H;  4OGQ C;  1L0L E;  1UUV A;  4QUR A;  3S9O A;  3VMG D;  3AED C;  4NB9 D;  2XRX A;  1YQ3 C;  4HM4 A;  2DE6 D;  3TGU E;  2BCC E;  1RIE A;  2E74 C;  4AIV A;  3AEB C;  1S1C X;  3H1L E;  1WQL A;  2ZT9 D;  3AE4 C;  3AE9 C;  2IBZ E;  4QCK A;  3D6Z A;  2QJY C;  3EWK A;  1VCK A;  1O7M A;  2NVF A;  2JZA A;  4H13 D;  3O6Q A;  4R4M A;  5KKZ C;  3GF7 A;  1SQV E;  1U57 A;  2XSO A;  4NBB D;  3RL0 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...