4PD4E

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
total genus 44
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4pd4E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4pd4E02
4H0LD 3EQQA 4PD4E 1PP9E 1SJGA 3H1LE 3EN1A 1KYOE 1PPJE 1EG9A 4NBGD 5KLIC 3GCEA 2BMQA 4HM6A 1SQXE 2HMNA 3CWBE 1L0NE 2JO6A 1O7GA 2NVGA 1NTME 2BCCE 2XRXA 4NB8D 1VM9A 1O7PA 2IBZE 2DE6D 3D89A 4HJLA 4QCKA 2FYUE 1JM1A 4NBED 3GKEA 1BCCE 3VCAA 4H13D 4HM1A 2YIUC 3VMHD 2YFIA 1UUWA 3L75E 1NTKE 1P84E 2HMKA 2QJKC 4P1CH 2CKFA 1NU1E 4H44D 4QDFB 2B24A 1SQQE 2HMLA 4QDCA 4NB9D 3GL0A 5KKZC 1RIEA 2HMJA 1SQVE 4NBCD 4OGQD 4HM8A 3CX5E 1NDOA 1L0LE 4NBDD 3H1KE 2HMMA 5AEUA 1G8JB 3VCPA 2YFLA 3H1HE 1ULIA 2JZAA 4QURA 3VMGD 3TGUE 1VF5D 2D2CD 2NUMA 2I7FA 1O7NA 2HMOA 3L73E 1G8KB 3DQYA 2B1XA 3H1JE 4NBBD 1EZVE 3GOBA 3FOUA 2DE5D 1SQBE 4HM2A 2E4QA 1FQTA 4AIVA 3H1IE 2NUKA 4HM7A 2QJPC 3AZCA 3L74E 3GB4A 4U3FE 2NWFA 1KB9E 3BCCE 1O7WA 4QUPA 3GTEA 3C0DA 3N0QA 2YFJA 5BOKA 2NVFA 2YVJB 1BGYE 3L71E 1Q90C 5AEWA 3GZXA 1RFSA 4PV1D 4HKVA 3L70E 2FYNC 3GZYA 1NTZE 4HM3A 3CXHE 2XR8A 2BMRA 2XSHA 4QUQA 2QJYC 1SQPE 1O7MA 3GTSA 1ULJA 2GBXA 2ZYLA 2ZT9D 1VCKA 4QDFA 4D6TE 1ZRTE 3GL2A 4P1BH 4NBHD 5CXMA 4AAYB 2E76D 2A06E 4NBFD 1BE3E 4HM4A 5KLVE 3VMID 1NYKA 2NVEA 2Q3WA 2GBWA 2E74D 4HM0A 3L72E 2E75D 4NBAD 1UUVA 2XSOA 4QDDA 5HL4A 1WQLA 2BMOA 1O7HA 2E4PA 2QPZA 4EMJB 4HM5A 2DE7D
chains in the Genus database with same CATH superfamily
3H1LE 1KYOE 3GHGA 1LWUC 2A06G 2Q9IA 2RH0A 2OYHC 4N78E 3RL0B 3D70A 5GTHH 4D6TD 3V2QA 2WMMA 3D89A 1SFCD 3VMZA 5CCHC 4H13D 1NTKJ 3CCUP 1S2EA 4TT3H 1CSBA 1T3JA 1IFIA 2JP3A 3H1KJ 2B87A 3H1HJ 4QURA 1RQVA 1N73B 2I7FA 3Q1MA 2KLUA 4HYTB 3VMXA 4BWNA 4OH8B 5DJTB 2QE7H 1BCCG 3ITKA 3L75G 5KLVD 5KAIE 2E4QA 1JY3N 2WWWA 3H1IE 2IBZD 4I1LA 3AE8C 3B71A 2XNDH 1SQXK 2Y9ZA 1R8EA 4XFJA 4AYCA 4HKVA 2ZVOB 1GK4A 3GZYA 2XR8A 1LTTC 1RHZB 1GL2B 2ZYGA 2I1JA 1ZW0A 1FDOA 1OW6A 2ZT9D 3O6QB 2N1TA 2WPQA 3AEDC 1YBKA 4XE5B 2CPSA 1M57D 2GA1A 1EDLA 1BGYG 1Y8AA 2KK7A 3AE1C 2WPVB 1NH4A 1KILA 2KZIA 2D2CB 2ZJSE 4ZNCA 4WY4A 4YTPC 1EDKA 2OARA 4DT0A 1LTBC 5AW5B 3GF7A 4WBAA 5B66H 1NHLA 3EN1A 1VQ5P 1LT9A 2YXQB 2OQQA 2W6JH 4PV1C 3Q5PA 1KILD 2XDJA 4IL6H 2OTKE 5TISH 1RF1B 3L72G 2PAJA 3SFDC 3TSIA 1KQSO 5APUA 1DD4A 2W8ZA 1RE4C 2E76C 5KKZC 1SQXG 1KV4A 2K37A 3N7NA 2P58A 1NTMG 3TGUE 2ZYAA 3L73J 1MZ9A 1YQ4C 1AV1A 2E75C 3GMAA 1EZVE 1L2PA 2DE5D 2KNCA 4HM7A 1LT1A 2WZ7A 2GUSA 3R2PA 3L4FA 2YKPA 2Y9YA 3V2NA 3D6ZA 1K04A 2QM7A 3U1CA 3L71E 1QX8A 4W80A 4EIJA 3EQ2A 3HD7B 1SQQK 3QWOC 3L73D 4QDFA 3AE6C 4HH2A 4P1BH 5AW9B 5K5GB 1MUUA 1JB0J 3RK3D 1KYOH 1P84D 1NTZK 2O01N 3L74D 2IZ0A 4JBZA 2IDBA 3AE4C 1N7LA 2O01J 1OW7A 2XSOA 3P8CE 1S5LX 3HE4A 3TK1A 1AQTA 1KZUB 1OVUA 3AEEC 1JY3P 2Q5UA 1JCDA 1O7GA 2O1JA 2XRXA 1LNQA 1KB9D 3RK2D 1ZMEC 4QCKA 2A06D 1BCCJ 2H88C 1NYHA 4RO0A 3L75J 3L36A 1A02F 3HE5A 3UIAA 2WPSA 5AVYB 5AW2B 3M9BA 3L70D 2JWAA 4BRYA 2HPCA 5KAIH 1CI6B 2Z4EA 2QJKB 1NDOA 3MZWB 3VCPA 1NJIQ 2HMOA 1PZQA 3K5BA 3V4WA 5CCGC 1LTGC 3VN0A 4L73A 4HM2A 2NUKA 5EFWB 3GB4A 1JY2N 1BCCD 2NRGA 4KT0J 1W5CE 3MUDA 2LKMA 1BGYJ 2KB7P 1GK6A 1IFPA 2W83C 5APWA 3CXHE 1URQD 1KMIZ 2H8PD 3LIDA 2QJYC 3PRJA 5KJ7A 2R3SA 2V7QH 2RMZA 2OYOA 4OGQC 3CC2P 4AAYB 3HTKA 2NPSA 1VF5B 2QVAA 2GBWA 3A2AA 3L72J 4GDOA 5KJ7D 1BGYD 3P7KA 2WSCH 4UB6E 1GDTA 4AQRD 2J59M 2IPPA 1VQ7P 1NOHA 1SQXJ 3CCMP 1QGKB 3GCEA 2HMNA 1VF5C 1NTMJ 2NPSD 4JQ0D 3RBZA 4PD4I 1O7PA 1G2CA 3BCCD 3PTZA 4NBED 2L91A 2YFIA 4P1CH 3H1LG 1JY2O 1L0NK 1SQVE 2YFLA 2JZAA 2FYUK 4UB8E 3C9IA 2QA4P 2WSFH 5APYA 4K3AA 1SQBE 1J1EC 1NTMD 1URQB 1HUCA 3C8VA 3P8MC 1YQ3C 1YITP 2QJPB 1X79B 1FOSE 1G1JA 2JEEA 1PPJD 2FY8A 1USDA 3GW6A 1A02J 3I56P 2XSHA 2V4HA 1KC8Q 3F89A 2YKOA 3GTSA 3H1IG 2AXTE 1IZNB 2R5DA 2MKVA 3B5NB 2P10A 4H44B 3G6EP 1VPCA 1RH5B 2CK3H 1JUNA 2NVEA 3MGNA 3B4SA 1FJKA 4H44C 5APSA 3EFFK 2GUVA 5CMZA 2IX7C 2IFMA 2IFNA 3IN6A 1L4AB 3AE7C 1J2JB 2B9BA 1HBWA 2DE6D 2FXMA 3A0HE 3RBXA 3VMHD 5GTIE 1SQQJ 1L4AC 5AVZB 3GL0A 2FBWC 3S4RA 3M0AA 4MN4C 1GU5A 1E79H 2NUMA 1H8AA 4XA4A 1P84I 2E74C 2QEXP 1KORA 3CXHH 1M7LA 5APVA 3WU2H 2M0BA 1FC2C 1O7WA 3FX0A 3RL0D 1VDFA 3TGUG 2YVJB 1N73A 2K88A 2Q7CA 2OYIC 1FAVA 2H89C 1N7SC 1NTZE 1IK7A 1EZVG 1Q81Q 1KB9I 1SQPE 3Q2YA 3WMM0 4UB6H 1FZCB 1KQFB 4N3YB 3CI9A 3L71G 3JC22 2WQYC 2JO1A 2C9NY 3L37A 3II6A 1HTLC 1PV3A 1Q82Q 3O6QA 3H1LJ 1JEKA 5KAFE 2WVRA 1KD1Q 3AEBC 1VQ4P 3IFMA 1ZRTD 1LWUB 4GKGA 1YTZT 1VM9A 1GL2D 2OYHB 2ZVNB 4UB8H 4YPCA 2CKFA 3G3ZA 2B24A 2HODB 3VMGD 1EC5A 2D2CD 1KYOD 1RF1A 1G8KB 3DQYA 3BASA 2PRRA 5AVUB 5AW6B 4EOTA 4Y99C 1UIXA 1OVRA 3LW5H 2FFDC 3H1IJ 3AEFC 1N8RQ 3F5HA 1IFJA 2AXTH 4WB4A 2KI7B 5E79E 1OW8A 2IYPA 5DJUB 5AW3B 4KHXA 1PP9D 2YO2A 2YKQA 1FE6A 2A45G 2WSEH 2QM8A 1JCCA 3T97B 1SQVK 3GL2A 1IFMA 5KLVE 1NTKD 3H1ID 1LTAC 1LTJB 1XTGB 3VMID 3CC4P 4RESB 2V7QJ 3E1IA 2HYNA 1SQBK 3H1KD 4B86A 3H1HD 3HD7A 3A0HH 4PD4E 3CCJP 1LTJC 4JYBA 5GTIH 1DEEG 3OAKA 1L0NE 2W6BA 1J1DC 1K73Q 1R5LA 3V6IA 2WSCJ 2ZXXA 4PV1B 2FYUE 3HD7D 1JM1A 3VCAA 2YMKA 1HVVA 1OIPA 1Z56A 3M9QA 2KUBA 4W7ZA 2C0WA 1JMMA 2HMJA 4NBCD 2MJZA 1KQLA 4HB1A 3TGUJ 2E76B 5KKZB 1PIXA 4ZKPA 3H1JE 1MFTA 3MP7B 1JY3O 1DX7A 1KILE 2E75B 5AW1B 2YNYA 1CI6A 1SQVG 3CMAP 1H0TB 1M1KQ 3BATA 3NFQA 1S5LE 2WSFJ 3AE3C 3VYIA 1QL2A 3L71J 2XNXA 3G9RA 4N6JA 5CBNA 3VTPC 4IFDK 4I2LC 2E43A 5CCGD 1SFCC 1EDJA 4H13C 1SQBG 1YJWP 3H32B 3TGUD 3GHGC 1EDIA 2GBXA 3PH0A 3RL0g 1ZLLA 1EQ7A 1KFMA 5KAFH 2BASA 1KFNA 2N9BA 2AEJA 1JTHB 1MV8A 3PLNA 4HM0A 3CX5D 2ZFCA 1GU4A 5HL4A 1FZAA 1O7HA 4GT1A 3GZXA 3V5BA 1SJGA 2KSJA 1FZFA 1EG9A 2H43A 2KIKA 1JO5A 1H89A 4U7JA 4HM6A 2XZRA 2JO6A 1FDIA 1KQGB 4C7NB 4NPFX 1Q90D 1YYCA 1W2BO 1SQPK 3U1AA 2ZT9C 1P84E 1SVFA 3VP9A 2OGUA 2M3EA 4L74A 4L76A 2P2UA 4JF7A 3CCLP 1VF5D 5E79H 2B1XA 2N1TC 1JOCA 2J5UA 1NU1K 3AEGC 4EDFA 2IYOA 1VQ8P 1L0LK 3I5CA 1KB9E 5AVTB 3GTEA 1KILC 3C0DA 3N0QA 2WSSH 4WY4C 3V2PA 2Q1KA 4ASVA 3Q5RA 1OZHA 3L70E 2YMYA 1PGJA 3VP8A 5APTA 4IOIH 1LT9C 1URQA 1X9VA 4C46A 1U7JA 1LP1B 1BSNA 4JYCA 1SQQG 2QJYB 4PD4H 1RF0A 4NBFD 2Q6QA 4HM4A 3L75D 4OGQB 1VL2A 1YTZI 3M9HA 1NTZG 2PFXA 1ZN5A 1JMBA 2BEQD 3WU2E 2R3CA 1K05A 1N86A 2I8DA 2DE7D 2R5BA 3EQQA 3B5NA 1VQMP 3CXHD 1G1IA 5KLIC 3M0DA 1T2KD 3B8EB 1SS1A 2BCCE 2C9LY 1Q2NA 4HJGH 1M56D 2JR8A 4ZMDA 5AW4B 3GKEA 3B5ND 2KYVA 2WT7B 1YJNP 4H44D 4QDFB 2KSEA 3RK3C 1SQVJ 1R5SA 1NO4A 2QSIA 2IBZI 5KLVK 1AQ5A 1OVVA 1G8JB 3VMYA 5AVWB 3A0BE 1S9KE 4ASWA 1S5LH 5AVVB 4C7RA 1AJYA 4NBBD 4W7YA 1SQBJ 1NAYA 2FXOA 1AA0A 1SP4A 4DOJA 1X8YA 2G8YA 3HUSA 1PL5A 1RE3A 1L4AD 4H0LB 1J1EB 3BCCE 3L72D 1U7MA 2YFJA 1S1CX 5AW7B 2NZ2A 3RK2C 1M1JA 3LW5J 3EFGA 1DIPA 3I55P 5CBOA 1SQVD 2O1KA 2P67A 3AE9C 1SQXD 1BSHA 1GW3A 3HE5B 4H0LC 2LXCB 4PJ0E 5M1BA 1AVOA 3GG2A 2M5AB 5BU8B 1BE3E 1FS0E 3AE2C 2BEZF 2ITAA 3MTUE 2WSEJ 3ZDMA 2K9JB 2Q3WA 4YXWH 3CD6P 3M91A 3TDKA 3TNUB 2W27A 1PPJE 3PHLA 1FZCA 1P84H 2HFED 4M3LA 2Y0DA 2XKMA 1FDMA 3KXDA 1OX3A 5KLVG 3MIWA 3FXEA 2Y0EA 1OWAA 3MUDC 1VQLP 3CLQA 2P7JA 1YJ9P 1L0NG 2KS1A 1KB9H 1PGPA 1LWUA 1GD2E 1QVGO 5KJ7C 2FYUG 2OYHA 2JDIH 2FYNB 2E74B 2W90A 4WWIA 1VQ9P 2HODA 5CCHA 3AZCA 4U3FE 5CHXA 2NPSC 1QVFO 1NTZJ 2FYNC 3H1JG 3OA7A 4QUQA 2OYIB 1SQPJ 1N7SB 5CCHD 4IFFA 3USSA 3W68A 1GTWA 1CW5A 4NBHD 2E5YA 3MHVA 3L35A 1SQQD 3PP5A 4NBAD 4OWFA 1HF9A 3KDPB 1NTZD 5AW8B 2YIUB 4NBGD 2BMQA 3CWBE 1IK9A 1ZR2A 1EXJA 4HJLA 1EXIA 3A0BH 5L8RJ 4DCKA 1GL2A 2YIUC 3WUVA 2HMKA 3QH9A 1NU1E 2E42A 2CPBA 4QDCA 3BVHA 4NB9D 4NBDD 4R4LA 1L0LE 4Z1MH 1PFIA 1IC2A 3GLMA 1WRGA 1LTIC 4LC1A 3FOUA 3E1RA 2O3JA 1FQTA 1ZV8A 1VQ6P 2GM4A 2M3BA 4Y99B 3V2RA 3CCRP 2FFDB 4Y28J 2L5GB 4PJ0H 5APXA 1Q7YQ 1RE4A 4LGDE 1RFSA 3H1LD 4PV1D 2FXPA 3JSVC 3RGUA 1WT6A 1Q86Q 4IL6X 1O7MA 4N78D 3A7OA 3NXSA 4D6TE 1H0TA 1ZOYC 3FWLA 2E76D 5KLVJ 4NPDA 4LLHA 3L70G 3VMAA 2E75D 4QDDA 3H32A 3GF3A 3H25A 1PP9E 5B5EE 3RL0C 5TJHA 1FBMA 1L0NJ 2K9YA 1NWQA 2YXRB 3TF5A 2RN0A 1JTHA 2FYUJ 2IBZE 3OW2O 1YI2P 1J1DB 4HM1A 5CJ0A 1NTKE 3SWFA 1S72P 2AXCA 1LTSC 1VQNP 1N73C 1HGVA 5AVQB 5AEUA 3TYYA 1NTMK 3H1KE 3H1HE 4C7NA 4PD4D 2BCCG 4IFMA 5BVZA 2ZAEB 1IO4A 3H1JJ 1ZR4A 4I6MC 1L0ND 2KXPB 3AECC 2FYUD 2Z5IA 2HLOA 3CPWO 4HKZH 1GL2C 4ZKUA 3V4QA 3KHUA 4I7ZB 4YXDC 2ZYDA 2BMRA 1IJDB 2N1TD 2B89A 5CCGA 1SFCB 2KZJA 4H13B 3FWNA 1Y9BA 3BCCG 3H1JD 2P1JA 2QG4A 5CXMA 3BRTB 2K3RA 3FGAD 3GHGB 2D2CC 4I7ZC 2J58A 4WY4D 4JPZB 4KJMA 3AE5C 3LIEA 1OXZA 4EMJB 1LGHB 3SWKA 1LP1A 3FXDA 1YIJP 1VQPP 1NAFA 2FKWB 1EZVD 1RF1C 1BE3G 2B87B 3A5TA 1MKMA 2M8RA 1FZEA 1RQUA 1S4XA 4K35A 3WUUA 2Y0CA 3L71D 3EWKA 3L74J 3C1LA 3N4XA 1PPJG 2JWDA 2ZT9B 2I1KA 4OGQD 2KOGA 2XV5A 3CX5E 2HMMA 4DJGA 2FYZA 1WMKA 1USEA 1FOSF 1X0TA 3L73E 3SWYA 4TLFA 4BXLA 3RK3E 2WT7A 5AVRB 1TU3F 2N1TB 3L74E 3IF4A 2W6AA 3OJAB 3P8CD 3D71A 3IAOA 3CCQP 5AEWA 3L70J 3CCVP 1SLQA 1KILB 3HD7C 2ZXEB 1QLED 4WY4B 1E5WA 3CCSP 2PGDA 1ULJA 1VCKA 4U3FG 3S9OA 1LT9B 2C0XA 1T8ZA 3W67A 5B5EH 2A06E 1HH0A 2Q3EA 1BDDA 1NKZB 3KYQA 1KTMA 4R4MA 1GMJA 2BMOA 3P32A 4DZOA 5AVSB 4H0LD 3KPEA 1QL1A 2OTLP 2HG5D 1QEXA 3A3YB 1S3JA 2M5AA 2B88A 2LR2A 3KQGA 2BCCJ 2NVGA 2K9JA 3CMEP 5KLIB 1PGOA 1KYOI 1M90Q 1BCCE 1OMIA 3TNUA 1SQPG 3L75E 2QJKC 2KNCB 4L75A 1HJ0A 1NVOA 1RIEA 3CCEP 1AVYA 1M8OB 1FZGA 3CWBG 3Q5SA 1LJ2A 1D7MA 1ULIA 3RK3B 2YO3A 3D6YA 2QRXA 3GOBA 1GZLA 1K9MQ 1NU1G 2BCCD 2IZ1A 1T6AA 3BCCJ 3WUTA 1L0LG 1L4AA 1CZQA 3BRVB 1BGYE 3SSUA 1Q90C 1FZBA 3M06A 4GIFA 1DEBA 1NTKK 2K1AA 1UIIA 3RK2B 1HGZA 3AEAC 2AEMA 3KZIE 2WPRA 1S9KD 3HE4B 3VOPA 1X22A 2HR3A 5H2FE 3IR9A 1JM0A 1BE3J 1GW4A 2WITA 1OFCX 3Q3DA 1VQKP 3JCUE 4AUWA 2E74D 1DH3A 3L72E 2OYIA 1N7SA 2E4PA 2QPZA 3CL3D 4D6TG 4BRYB 2HPCB 1RY3A 3PJSK 3E7KA 1SQBD 1SQXE 1U57A 1PGQA 1NTME 3CX5H 3CC7P 1N7SD 1BE3D 1MFZA 2R32A 1PP9G 2HMLA 2QIWA 4WVZA 4A7PA 5GTHE 5BU5A 1JNMA 1O7NA 2H7HA 4RJTA 2IBZG 1URQC 3R4YA 1NTKG 1IFNA 4AIVA 2QJPC 1RF0C 4U3FJ 1HJBA 3H1KG 3H1HG 1T2KC 3HTKB 1EZVI 1KN7A 1FU1A 2LXBA 2Q3IA 4EYYQ 3NMDA 2NPSB 4HM3A 1NKNA 3B5NC 1NGMB 1W2EA 1Y47A 3CX5I 2JJLA 2O01H 3M0DC 3H6PA 2FFDA 4O9BA 1VQOP 1YHQP 1ZP0C 4OVNF 2R44A 4U3FD 1JY2P 4EI2A 1NYKA 5KTBA 1K8AQ 1G2CB 2RKLA 4QMAA 1UUVA 3ABVC 2AEFA 2A45H 1FJPA 3HUSB 1BDCA 2XU6A 3CWBJ 5AW0B 3G71P 1M1JB 4CPGA 4NPEA 4NB8D 5B66E 3HUSC 1RE3C 3MD0A 1UUWA 1NU1J 5AVXB 3G4SP 2KLVA 3T97A 3S1KA 1SQQE 2UWJE 1L0LJ 2N9YB 4HM8A 1M1JC 4IL6E 1T3UA 5TISE 1SQPD 1HWTC 1LTJA 2G3AA 1DD3A 3HRNA 1H88A 1N2DC 3CWBD 1AFOA 4RKUJ 4GOFA 2OTJP 2NWFA 3KZIH 2E5TA 4QUPA 5BOKA 2NVFA 2PP6A 2A45I 1NU1D 5H2FH 3L73G 1XTCC 4GODA 1L0LD 1ZXGA 2DW3A 3JCUH 1FZCC 5CJ4A 2ZYLA 3L74G 4D6TJ 3U59A 1ZRTE 2Z5HA 4GOEA 3SFEC 2JKVA 3O8ZA 3CXHI 2KS1B 2VRSA 3NTNA 2SPZA 5C39A 5APQA 2WTYA 2POHA 1IFDA 1WQLA 4HM5A 1SFCA 1PP9J 2KP8A
chains in the Genus database with same CATH topology
4H0LD 3EQQA 4PD4E 1PP9E 1SJGA 3H1LE 3EN1A 1KYOE 1PPJE 1EG9A 4NBGD 5KLIC 3GCEA 2BMQA 4HM6A 1SQXE 2HMNA 3CWBE 1L0NE 2JO6A 1O7GA 2NVGA 1NTME 2BCCE 2XRXA 4NB8D 1VM9A 1O7PA 2IBZE 2DE6D 3D89A 4HJLA 4QCKA 2FYUE 1JM1A 4NBED 3GKEA 1BCCE 3VCAA 4H13D 4HM1A 2YIUC 3VMHD 2YFIA 1UUWA 3L75E 1NTKE 1P84E 2HMKA 2QJKC 4P1CH 2CKFA 1NU1E 4H44D 4QDFB 2B24A 1SQQE 2HMLA 4QDCA 4NB9D 3GL0A 5KKZC 1RIEA 2HMJA 1SQVE 4NBCD 4OGQD 4HM8A 3CX5E 1NDOA 1L0LE 4NBDD 3H1KE 2HMMA 5AEUA 1G8JB 3VCPA 2YFLA 3H1HE 1ULIA 2JZAA 4QURA 3VMGD 3TGUE 1VF5D 2D2CD 2NUMA 2I7FA 1O7NA 2HMOA 3L73E 1G8KB 3DQYA 2B1XA 3H1JE 4NBBD 1EZVE 3GOBA 3FOUA 2DE5D 1SQBE 4HM2A 2E4QA 1FQTA 4AIVA 3H1IE 2NUKA 4HM7A 2QJPC 3AZCA 3L74E 3GB4A 4U3FE 2NWFA 1KB9E 3BCCE 1O7WA 4QUPA 3GTEA 3C0DA 3N0QA 2YFJA 5BOKA 2NVFA 2YVJB 1BGYE 3L71E 1Q90C 5AEWA 3GZXA 1RFSA 4PV1D 4HKVA 3L70E 2FYNC 3GZYA 1NTZE 4HM3A 3CXHE 2XR8A 2BMRA 2XSHA 4QUQA 2QJYC 1SQPE 1O7MA 3GTSA 1ULJA 2GBXA 2ZYLA 2ZT9D 1VCKA 4QDFA 4D6TE 1ZRTE 3GL2A 4P1BH 4NBHD 5CXMA 4AAYB 2E76D 2A06E 4NBFD 1BE3E 4HM4A 5KLVE 3VMID 1NYKA 2NVEA 2Q3WA 2GBWA 2E74D 4HM0A 3L72E 2E75D 4NBAD 1UUVA 2XSOA 4QDDA 5HL4A 1WQLA 2BMOA 1O7HA 2E4PA 2QPZA 4EMJB 4HM5A 2DE7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0L D;  3EQQ A;  4PD4 E;  1PP9 E;  1SJG A;  3H1L E;  3EN1 A;  1KYO E;  1PPJ E;  1EG9 A;  4NBG D;  5KLI C;  3GCE A;  2BMQ A;  4HM6 A;  1SQX E;  2HMN A;  3CWB E;  1L0N E;  2JO6 A;  1O7G A;  2NVG A;  1NTM E;  2BCC E;  2XRX A;  4NB8 D;  1VM9 A;  1O7P A;  2IBZ E;  2DE6 D;  3D89 A;  4HJL A;  4QCK A;  2FYU E;  1JM1 A;  4NBE D;  3GKE A;  1BCC E;  3VCA A;  4H13 D;  4HM1 A;  2YIU C;  3VMH D;  2YFI A;  1UUW A;  3L75 E;  1NTK E;  1P84 E;  2HMK A;  2QJK C;  4P1C H;  2CKF A;  1NU1 E;  4H44 D;  4QDF B;  2B24 A;  1SQQ E;  2HML A;  4QDC A;  4NB9 D;  3GL0 A;  5KKZ C;  1RIE A;  2HMJ A;  1SQV E;  4NBC D;  4OGQ D;  4HM8 A;  3CX5 E;  1NDO A;  1L0L E;  4NBD D;  3H1K E;  2HMM A;  5AEU A;  1G8J B;  3VCP A;  2YFL A;  3H1H E;  1ULI A;  2JZA A;  4QUR A;  3VMG D;  3TGU E;  1VF5 D;  2D2C D;  2NUM A;  2I7F A;  1O7N A;  2HMO A;  3L73 E;  1G8K B;  3DQY A;  2B1X A;  3H1J E;  4NBB D;  1EZV E;  3GOB A;  3FOU A;  2DE5 D;  1SQB E;  4HM2 A;  2E4Q A;  1FQT A;  4AIV A;  3H1I E;  2NUK A;  4HM7 A;  2QJP C;  3AZC A;  3L74 E;  3GB4 A;  4U3F E;  2NWF A;  1KB9 E;  3BCC E;  1O7W A;  4QUP A;  3GTE A;  3C0D A;  3N0Q A;  2YFJ A;  5BOK A;  2NVF A;  2YVJ B;  1BGY E;  3L71 E;  1Q90 C;  5AEW A;  3GZX A;  1RFS A;  4PV1 D;  4HKV A;  3L70 E;  2FYN C;  3GZY A;  1NTZ E;  4HM3 A;  3CXH E;  2XR8 A;  2BMR A;  2XSH A;  4QUQ A;  2QJY C;  1SQP E;  1O7M A;  3GTS A;  1ULJ A;  2GBX A;  2ZYL A;  2ZT9 D;  1VCK A;  4QDF A;  4D6T E;  1ZRT E;  3GL2 A;  4P1B H;  4NBH D;  5CXM A;  4AAY B;  2E76 D;  2A06 E;  4NBF D;  1BE3 E;  4HM4 A;  5KLV E;  3VMI D;  1NYK A;  2NVE A;  2Q3W A;  2GBW A;  2E74 D;  4HM0 A;  3L72 E;  2E75 D;  4NBA D;  1UUV A;  2XSO A;  4QDD A;  5HL4 A;  1WQL A;  2BMO A;  1O7H A;  2E4P A;  2QPZ A;  4EMJ B;  4HM5 A;  2DE7 D; 
#chains in the Genus database with same CATH topology
 3H1L E;  1KYO E;  3GHG A;  1LWU C;  2A06 G;  2Q9I A;  2RH0 A;  2OYH C;  4N78 E;  3RL0 B;  3D70 A;  5GTH H;  4D6T D;  3V2Q A;  2WMM A;  3D89 A;  1SFC D;  3VMZ A;  5CCH C;  4H13 D;  1NTK J;  3CCU P;  1S2E A;  4TT3 H;  1CSB A;  1T3J A;  1IFI A;  2JP3 A;  3H1K J;  2B87 A;  3H1H J;  4QUR A;  1RQV A;  1N73 B;  2I7F A;  3Q1M A;  2KLU A;  4HYT B;  3VMX A;  4BWN A;  4OH8 B;  5DJT B;  2QE7 H;  1BCC G;  3ITK A;  3L75 G;  5KLV D;  5KAI E;  2E4Q A;  1JY3 N;  2WWW A;  3H1I E;  2IBZ D;  4I1L A;  3AE8 C;  3B71 A;  2XND H;  1SQX K;  2Y9Z A;  1R8E A;  4XFJ A;  4AYC A;  4HKV A;  2ZVO B;  1GK4 A;  3GZY A;  2XR8 A;  1LTT C;  1RHZ B;  1GL2 B;  2ZYG A;  2I1J A;  1ZW0 A;  1FDO A;  1OW6 A;  2ZT9 D;  3O6Q B;  2N1T A;  2WPQ A;  3AED C;  1YBK A;  4XE5 B;  2CPS A;  1M57 D;  2GA1 A;  1EDL A;  1BGY G;  1Y8A A;  2KK7 A;  3AE1 C;  2WPV B;  1NH4 A;  1KIL A;  2KZI A;  2D2C B;  2ZJS E;  4ZNC A;  4WY4 A;  4YTP C;  1EDK A;  2OAR A;  4DT0 A;  1LTB C;  5AW5 B;  3GF7 A;  4WBA A;  5B66 H;  1NHL A;  3EN1 A;  1VQ5 P;  1LT9 A;  2YXQ B;  2OQQ A;  2W6J H;  4PV1 C;  3Q5P A;  1KIL D;  2XDJ A;  4IL6 H;  2OTK E;  5TIS H;  1RF1 B;  3L72 G;  2PAJ A;  3SFD C;  3TSI A;  1KQS O;  5APU A;  1DD4 A;  2W8Z A;  1RE4 C;  2E76 C;  5KKZ C;  1SQX G;  1KV4 A;  2K37 A;  3N7N A;  2P58 A;  1NTM G;  3TGU E;  2ZYA A;  3L73 J;  1MZ9 A;  1YQ4 C;  1AV1 A;  2E75 C;  3GMA A;  1EZV E;  1L2P A;  2DE5 D;  2KNC A;  4HM7 A;  1LT1 A;  2WZ7 A;  2GUS A;  3R2P A;  3L4F A;  2YKP A;  2Y9Y A;  3V2N A;  3D6Z A;  1K04 A;  2QM7 A;  3U1C A;  3L71 E;  1QX8 A;  4W80 A;  4EIJ A;  3EQ2 A;  3HD7 B;  1SQQ K;  3QWO C;  3L73 D;  4QDF A;  3AE6 C;  4HH2 A;  4P1B H;  5AW9 B;  5K5G B;  1MUU A;  1JB0 J;  3RK3 D;  1KYO H;  1P84 D;  1NTZ K;  2O01 N;  3L74 D;  2IZ0 A;  4JBZ A;  2IDB A;  3AE4 C;  1N7L A;  2O01 J;  1OW7 A;  2XSO A;  3P8C E;  1S5L X;  3HE4 A;  3TK1 A;  1AQT A;  1KZU B;  1OVU A;  3AEE C;  1JY3 P;  2Q5U A;  1JCD A;  1O7G A;  2O1J A;  2XRX A;  1LNQ A;  1KB9 D;  3RK2 D;  1ZME C;  4QCK A;  2A06 D;  1BCC J;  2H88 C;  1NYH A;  4RO0 A;  3L75 J;  3L36 A;  1A02 F;  3HE5 A;  3UIA A;  2WPS A;  5AVY B;  5AW2 B;  3M9B A;  3L70 D;  2JWA A;  4BRY A;  2HPC A;  5KAI H;  1CI6 B;  2Z4E A;  2QJK B;  1NDO A;  3MZW B;  3VCP A;  1NJI Q;  2HMO A;  1PZQ A;  3K5B A;  3V4W A;  5CCG C;  1LTG C;  3VN0 A;  4L73 A;  4HM2 A;  2NUK A;  5EFW B;  3GB4 A;  1JY2 N;  1BCC D;  2NRG A;  4KT0 J;  1W5C E;  3MUD A;  2LKM A;  1BGY J;  2KB7 P;  1GK6 A;  1IFP A;  2W83 C;  5APW A;  3CXH E;  1URQ D;  1KMI Z;  2H8P D;  3LID A;  2QJY C;  3PRJ A;  5KJ7 A;  2R3S A;  2V7Q H;  2RMZ A;  2OYO A;  4OGQ C;  3CC2 P;  4AAY B;  3HTK A;  2NPS A;  1VF5 B;  2QVA A;  2GBW A;  3A2A A;  3L72 J;  4GDO A;  5KJ7 D;  1BGY D;  3P7K A;  2WSC H;  4UB6 E;  1GDT A;  4AQR D;  2J59 M;  2IPP A;  1VQ7 P;  1NOH A;  1SQX J;  3CCM P;  1QGK B;  3GCE A;  2HMN A;  1VF5 C;  1NTM J;  2NPS D;  4JQ0 D;  3RBZ A;  4PD4 I;  1O7P A;  1G2C A;  3BCC D;  3PTZ A;  4NBE D;  2L91 A;  2YFI A;  4P1C H;  3H1L G;  1JY2 O;  1L0N K;  1SQV E;  2YFL A;  2JZA A;  2FYU K;  4UB8 E;  3C9I A;  2QA4 P;  2WSF H;  5APY A;  4K3A A;  1SQB E;  1J1E C;  1NTM D;  1URQ B;  1HUC A;  3C8V A;  3P8M C;  1YQ3 C;  1YIT P;  2QJP B;  1X79 B;  1FOS E;  1G1J A;  2JEE A;  1PPJ D;  2FY8 A;  1USD A;  3GW6 A;  1A02 J;  3I56 P;  2XSH A;  2V4H A;  1KC8 Q;  3F89 A;  2YKO A;  3GTS A;  3H1I G;  2AXT E;  1IZN B;  2R5D A;  2MKV A;  3B5N B;  2P10 A;  4H44 B;  3G6E P;  1VPC A;  1RH5 B;  2CK3 H;  1JUN A;  2NVE A;  3MGN A;  3B4S A;  1FJK A;  4H44 C;  5APS A;  3EFF K;  2GUV A;  5CMZ A;  2IX7 C;  2IFM A;  2IFN A;  3IN6 A;  1L4A B;  3AE7 C;  1J2J B;  2B9B A;  1HBW A;  2DE6 D;  2FXM A;  3A0H E;  3RBX A;  3VMH D;  5GTI E;  1SQQ J;  1L4A C;  5AVZ B;  3GL0 A;  2FBW C;  3S4R A;  3M0A A;  4MN4 C;  1GU5 A;  1E79 H;  2NUM A;  1H8A A;  4XA4 A;  1P84 I;  2E74 C;  2QEX P;  1KOR A;  3CXH H;  1M7L A;  5APV A;  3WU2 H;  2M0B A;  1FC2 C;  1O7W A;  3FX0 A;  3RL0 D;  1VDF A;  3TGU G;  2YVJ B;  1N73 A;  2K88 A;  2Q7C A;  2OYI C;  1FAV A;  2H89 C;  1N7S C;  1NTZ E;  1IK7 A;  1EZV G;  1Q81 Q;  1KB9 I;  1SQP E;  3Q2Y A;  3WMM 0;  4UB6 H;  1FZC B;  1KQF B;  4N3Y B;  3CI9 A;  3L71 G;  3JC2 2;  2WQY C;  2JO1 A;  2C9N Y;  3L37 A;  3II6 A;  1HTL C;  1PV3 A;  1Q82 Q;  3O6Q A;  3H1L J;  1JEK A;  5KAF E;  2WVR A;  1KD1 Q;  3AEB C;  1VQ4 P;  3IFM A;  1ZRT D;  1LWU B;  4GKG A;  1YTZ T;  1VM9 A;  1GL2 D;  2OYH B;  2ZVN B;  4UB8 H;  4YPC A;  2CKF A;  3G3Z A;  2B24 A;  2HOD B;  3VMG D;  1EC5 A;  2D2C D;  1KYO D;  1RF1 A;  1G8K B;  3DQY A;  3BAS A;  2PRR A;  5AVU B;  5AW6 B;  4EOT A;  4Y99 C;  1UIX A;  1OVR A;  3LW5 H;  2FFD C;  3H1I J;  3AEF C;  1N8R Q;  3F5H A;  1IFJ A;  2AXT H;  4WB4 A;  2KI7 B;  5E79 E;  1OW8 A;  2IYP A;  5DJU B;  5AW3 B;  4KHX A;  1PP9 D;  2YO2 A;  2YKQ A;  1FE6 A;  2A45 G;  2WSE H;  2QM8 A;  1JCC A;  3T97 B;  1SQV K;  3GL2 A;  1IFM A;  5KLV E;  1NTK D;  3H1I D;  1LTA C;  1LTJ B;  1XTG B;  3VMI D;  3CC4 P;  4RES B;  2V7Q J;  3E1I A;  2HYN A;  1SQB K;  3H1K D;  4B86 A;  3H1H D;  3HD7 A;  3A0H H;  4PD4 E;  3CCJ P;  1LTJ C;  4JYB A;  5GTI H;  1DEE G;  3OAK A;  1L0N E;  2W6B A;  1J1D C;  1K73 Q;  1R5L A;  3V6I A;  2WSC J;  2ZXX A;  4PV1 B;  2FYU E;  3HD7 D;  1JM1 A;  3VCA A;  2YMK A;  1HVV A;  1OIP A;  1Z56 A;  3M9Q A;  2KUB A;  4W7Z A;  2C0W A;  1JMM A;  2HMJ A;  4NBC D;  2MJZ A;  1KQL A;  4HB1 A;  3TGU J;  2E76 B;  5KKZ B;  1PIX A;  4ZKP A;  3H1J E;  1MFT A;  3MP7 B;  1JY3 O;  1DX7 A;  1KIL E;  2E75 B;  5AW1 B;  2YNY A;  1CI6 A;  1SQV G;  3CMA P;  1H0T B;  1M1K Q;  3BAT A;  3NFQ A;  1S5L E;  2WSF J;  3AE3 C;  3VYI A;  1QL2 A;  3L71 J;  2XNX A;  3G9R A;  4N6J A;  5CBN A;  3VTP C;  4IFD K;  4I2L C;  2E43 A;  5CCG D;  1SFC C;  1EDJ A;  4H13 C;  1SQB G;  1YJW P;  3H32 B;  3TGU D;  3GHG C;  1EDI A;  2GBX A;  3PH0 A;  3RL0 g;  1ZLL A;  1EQ7 A;  1KFM A;  5KAF H;  2BAS A;  1KFN A;  2N9B A;  2AEJ A;  1JTH B;  1MV8 A;  3PLN A;  4HM0 A;  3CX5 D;  2ZFC A;  1GU4 A;  5HL4 A;  1FZA A;  1O7H A;  4GT1 A;  3GZX A;  3V5B A;  1SJG A;  2KSJ A;  1FZF A;  1EG9 A;  2H43 A;  2KIK A;  1JO5 A;  1H89 A;  4U7J A;  4HM6 A;  2XZR A;  2JO6 A;  1FDI A;  1KQG B;  4C7N B;  4NPF X;  1Q90 D;  1YYC A;  1W2B O;  1SQP K;  3U1A A;  2ZT9 C;  1P84 E;  1SVF A;  3VP9 A;  2OGU A;  2M3E A;  4L74 A;  4L76 A;  2P2U A;  4JF7 A;  3CCL P;  1VF5 D;  5E79 H;  2B1X A;  2N1T C;  1JOC A;  2J5U A;  1NU1 K;  3AEG C;  4EDF A;  2IYO A;  1VQ8 P;  1L0L K;  3I5C A;  1KB9 E;  5AVT B;  3GTE A;  1KIL C;  3C0D A;  3N0Q A;  2WSS H;  4WY4 C;  3V2P A;  2Q1K A;  4ASV A;  3Q5R A;  1OZH A;  3L70 E;  2YMY A;  1PGJ A;  3VP8 A;  5APT A;  4IOI H;  1LT9 C;  1URQ A;  1X9V A;  4C46 A;  1U7J A;  1LP1 B;  1BSN A;  4JYC A;  1SQQ G;  2QJY B;  4PD4 H;  1RF0 A;  4NBF D;  2Q6Q A;  4HM4 A;  3L75 D;  4OGQ B;  1VL2 A;  1YTZ I;  3M9H A;  1NTZ G;  2PFX A;  1ZN5 A;  1JMB A;  2BEQ D;  3WU2 E;  2R3C A;  1K05 A;  1N86 A;  2I8D A;  2DE7 D;  2R5B A;  3EQQ A;  3B5N A;  1VQM P;  3CXH D;  1G1I A;  5KLI C;  3M0D A;  1T2K D;  3B8E B;  1SS1 A;  2BCC E;  2C9L Y;  1Q2N A;  4HJG H;  1M56 D;  2JR8 A;  4ZMD A;  5AW4 B;  3GKE A;  3B5N D;  2KYV A;  2WT7 B;  1YJN P;  4H44 D;  4QDF B;  2KSE A;  3RK3 C;  1SQV J;  1R5S A;  1NO4 A;  2QSI A;  2IBZ I;  5KLV K;  1AQ5 A;  1OVV A;  1G8J B;  3VMY A;  5AVW B;  3A0B E;  1S9K E;  4ASW A;  1S5L H;  5AVV B;  4C7R A;  1AJY A;  4NBB D;  4W7Y A;  1SQB J;  1NAY A;  2FXO A;  1AA0 A;  1SP4 A;  4DOJ A;  1X8Y A;  2G8Y A;  3HUS A;  1PL5 A;  1RE3 A;  1L4A D;  4H0L B;  1J1E B;  3BCC E;  3L72 D;  1U7M A;  2YFJ A;  1S1C X;  5AW7 B;  2NZ2 A;  3RK2 C;  1M1J A;  3LW5 J;  3EFG A;  1DIP A;  3I55 P;  5CBO A;  1SQV D;  2O1K A;  2P67 A;  3AE9 C;  1SQX D;  1BSH A;  1GW3 A;  3HE5 B;  4H0L C;  2LXC B;  4PJ0 E;  5M1B A;  1AVO A;  3GG2 A;  2M5A B;  5BU8 B;  1BE3 E;  1FS0 E;  3AE2 C;  2BEZ F;  2ITA A;  3MTU E;  2WSE J;  3ZDM A;  2K9J B;  2Q3W A;  4YXW H;  3CD6 P;  3M91 A;  3TDK A;  3TNU B;  2W27 A;  1PPJ E;  3PHL A;  1FZC A;  1P84 H;  2HFE D;  4M3L A;  2Y0D A;  2XKM A;  1FDM A;  3KXD A;  1OX3 A;  5KLV G;  3MIW A;  3FXE A;  2Y0E A;  1OWA A;  3MUD C;  1VQL P;  3CLQ A;  2P7J A;  1YJ9 P;  1L0N G;  2KS1 A;  1KB9 H;  1PGP A;  1LWU A;  1GD2 E;  1QVG O;  5KJ7 C;  2FYU G;  2OYH A;  2JDI H;  2FYN B;  2E74 B;  2W90 A;  4WWI A;  1VQ9 P;  2HOD A;  5CCH A;  3AZC A;  4U3F E;  5CHX A;  2NPS C;  1QVF O;  1NTZ J;  2FYN C;  3H1J G;  3OA7 A;  4QUQ A;  2OYI B;  1SQP J;  1N7S B;  5CCH D;  4IFF A;  3USS A;  3W68 A;  1GTW A;  1CW5 A;  4NBH D;  2E5Y A;  3MHV A;  3L35 A;  1SQQ D;  3PP5 A;  4NBA D;  4OWF A;  1HF9 A;  3KDP B;  1NTZ D;  5AW8 B;  2YIU B;  4NBG D;  2BMQ A;  3CWB E;  1IK9 A;  1ZR2 A;  1EXJ A;  4HJL A;  1EXI A;  3A0B H;  5L8R J;  4DCK A;  1GL2 A;  2YIU C;  3WUV A;  2HMK A;  3QH9 A;  1NU1 E;  2E42 A;  2CPB A;  4QDC A;  3BVH A;  4NB9 D;  4NBD D;  4R4L A;  1L0L E;  4Z1M H;  1PFI A;  1IC2 A;  3GLM A;  1WRG A;  1LTI C;  4LC1 A;  3FOU A;  3E1R A;  2O3J A;  1FQT A;  1ZV8 A;  1VQ6 P;  2GM4 A;  2M3B A;  4Y99 B;  3V2R A;  3CCR P;  2FFD B;  4Y28 J;  2L5G B;  4PJ0 H;  5APX A;  1Q7Y Q;  1RE4 A;  4LGD E;  1RFS A;  3H1L D;  4PV1 D;  2FXP A;  3JSV C;  3RGU A;  1WT6 A;  1Q86 Q;  4IL6 X;  1O7M A;  4N78 D;  3A7O A;  3NXS A;  4D6T E;  1H0T A;  1ZOY C;  3FWL A;  2E76 D;  5KLV J;  4NPD A;  4LLH A;  3L70 G;  3VMA A;  2E75 D;  4QDD A;  3H32 A;  3GF3 A;  3H25 A;  1PP9 E;  5B5E E;  3RL0 C;  5TJH A;  1FBM A;  1L0N J;  2K9Y A;  1NWQ A;  2YXR B;  3TF5 A;  2RN0 A;  1JTH A;  2FYU J;  2IBZ E;  3OW2 O;  1YI2 P;  1J1D B;  4HM1 A;  5CJ0 A;  1NTK E;  3SWF A;  1S72 P;  2AXC A;  1LTS C;  1VQN P;  1N73 C;  1HGV A;  5AVQ B;  5AEU A;  3TYY A;  1NTM K;  3H1K E;  3H1H E;  4C7N A;  4PD4 D;  2BCC G;  4IFM A;  5BVZ A;  2ZAE B;  1IO4 A;  3H1J J;  1ZR4 A;  4I6M C;  1L0N D;  2KXP B;  3AEC C;  2FYU D;  2Z5I A;  2HLO A;  3CPW O;  4HKZ H;  1GL2 C;  4ZKU A;  3V4Q A;  3KHU A;  4I7Z B;  4YXD C;  2ZYD A;  2BMR A;  1IJD B;  2N1T D;  2B89 A;  5CCG A;  1SFC B;  2KZJ A;  4H13 B;  3FWN A;  1Y9B A;  3BCC G;  3H1J D;  2P1J A;  2QG4 A;  5CXM A;  3BRT B;  2K3R A;  3FGA D;  3GHG B;  2D2C C;  4I7Z C;  2J58 A;  4WY4 D;  4JPZ B;  4KJM A;  3AE5 C;  3LIE A;  1OXZ A;  4EMJ B;  1LGH B;  3SWK A;  1LP1 A;  3FXD A;  1YIJ P;  1VQP P;  1NAF A;  2FKW B;  1EZV D;  1RF1 C;  1BE3 G;  2B87 B;  3A5T A;  1MKM A;  2M8R A;  1FZE A;  1RQU A;  1S4X A;  4K35 A;  3WUU A;  2Y0C A;  3L71 D;  3EWK A;  3L74 J;  3C1L A;  3N4X A;  1PPJ G;  2JWD A;  2ZT9 B;  2I1K A;  4OGQ D;  2KOG A;  2XV5 A;  3CX5 E;  2HMM A;  4DJG A;  2FYZ A;  1WMK A;  1USE A;  1FOS F;  1X0T A;  3L73 E;  3SWY A;  4TLF A;  4BXL A;  3RK3 E;  2WT7 A;  5AVR B;  1TU3 F;  2N1T B;  3L74 E;  3IF4 A;  2W6A A;  3OJA B;  3P8C D;  3D71 A;  3IAO A;  3CCQ P;  5AEW A;  3L70 J;  3CCV P;  1SLQ A;  1KIL B;  3HD7 C;  2ZXE B;  1QLE D;  4WY4 B;  1E5W A;  3CCS P;  2PGD A;  1ULJ A;  1VCK A;  4U3F G;  3S9O A;  1LT9 B;  2C0X A;  1T8Z A;  3W67 A;  5B5E H;  2A06 E;  1HH0 A;  2Q3E A;  1BDD A;  1NKZ B;  3KYQ A;  1KTM A;  4R4M A;  1GMJ A;  2BMO A;  3P32 A;  4DZO A;  5AVS B;  4H0L D;  3KPE A;  1QL1 A;  2OTL P;  2HG5 D;  1QEX A;  3A3Y B;  1S3J A;  2M5A A;  2B88 A;  2LR2 A;  3KQG A;  2BCC J;  2NVG A;  2K9J A;  3CME P;  5KLI B;  1PGO A;  1KYO I;  1M90 Q;  1BCC E;  1OMI A;  3TNU A;  1SQP G;  3L75 E;  2QJK C;  2KNC B;  4L75 A;  1HJ0 A;  1NVO A;  1RIE A;  3CCE P;  1AVY A;  1M8O B;  1FZG A;  3CWB G;  3Q5S A;  1LJ2 A;  1D7M A;  1ULI A;  3RK3 B;  2YO3 A;  3D6Y A;  2QRX A;  3GOB A;  1GZL A;  1K9M Q;  1NU1 G;  2BCC D;  2IZ1 A;  1T6A A;  3BCC J;  3WUT A;  1L0L G;  1L4A A;  1CZQ A;  3BRV B;  1BGY E;  3SSU A;  1Q90 C;  1FZB A;  3M06 A;  4GIF A;  1DEB A;  1NTK K;  2K1A A;  1UII A;  3RK2 B;  1HGZ A;  3AEA C;  2AEM A;  3KZI E;  2WPR A;  1S9K D;  3HE4 B;  3VOP A;  1X22 A;  2HR3 A;  5H2F E;  3IR9 A;  1JM0 A;  1BE3 J;  1GW4 A;  2WIT A;  1OFC X;  3Q3D A;  1VQK P;  3JCU E;  4AUW A;  2E74 D;  1DH3 A;  3L72 E;  2OYI A;  1N7S A;  2E4P A;  2QPZ A;  3CL3 D;  4D6T G;  4BRY B;  2HPC B;  1RY3 A;  3PJS K;  3E7K A;  1SQB D;  1SQX E;  1U57 A;  1PGQ A;  1NTM E;  3CX5 H;  3CC7 P;  1N7S D;  1BE3 D;  1MFZ A;  2R32 A;  1PP9 G;  2HML A;  2QIW A;  4WVZ A;  4A7P A;  5GTH E;  5BU5 A;  1JNM A;  1O7N A;  2H7H A;  4RJT A;  2IBZ G;  1URQ C;  3R4Y A;  1NTK G;  1IFN A;  4AIV A;  2QJP C;  1RF0 C;  4U3F J;  1HJB A;  3H1K G;  3H1H G;  1T2K C;  3HTK B;  1EZV I;  1KN7 A;  1FU1 A;  2LXB A;  2Q3I A;  4EYY Q;  3NMD A;  2NPS B;  4HM3 A;  1NKN A;  3B5N C;  1NGM B;  1W2E A;  1Y47 A;  3CX5 I;  2JJL A;  2O01 H;  3M0D C;  3H6P A;  2FFD A;  4O9B A;  1VQO P;  1YHQ P;  1ZP0 C;  4OVN F;  2R44 A;  4U3F D;  1JY2 P;  4EI2 A;  1NYK A;  5KTB A;  1K8A Q;  1G2C B;  2RKL A;  4QMA A;  1UUV A;  3ABV C;  2AEF A;  2A45 H;  1FJP A;  3HUS B;  1BDC A;  2XU6 A;  3CWB J;  5AW0 B;  3G71 P;  1M1J B;  4CPG A;  4NPE A;  4NB8 D;  5B66 E;  3HUS C;  1RE3 C;  3MD0 A;  1UUW A;  1NU1 J;  5AVX B;  3G4S P;  2KLV A;  3T97 A;  3S1K A;  1SQQ E;  2UWJ E;  1L0L J;  2N9Y B;  4HM8 A;  1M1J C;  4IL6 E;  1T3U A;  5TIS E;  1SQP D;  1HWT C;  1LTJ A;  2G3A A;  1DD3 A;  3HRN A;  1H88 A;  1N2D C;  3CWB D;  1AFO A;  4RKU J;  4GOF A;  2OTJ P;  2NWF A;  3KZI H;  2E5T A;  4QUP A;  5BOK A;  2NVF A;  2PP6 A;  2A45 I;  1NU1 D;  5H2F H;  3L73 G;  1XTC C;  4GOD A;  1L0L D;  1ZXG A;  2DW3 A;  3JCU H;  1FZC C;  5CJ4 A;  2ZYL A;  3L74 G;  4D6T J;  3U59 A;  1ZRT E;  2Z5H A;  4GOE A;  3SFE C;  2JKV A;  3O8Z A;  3CXH I;  2KS1 B;  2VRS A;  3NTN A;  2SPZ A;  5C39 A;  5APQ A;  2WTY A;  2POH A;  1IFD A;  1WQL A;  4HM5 A;  1SFC A;  1PP9 J;  2KP8 A; 
#chains in the Genus database with same CATH homology
 4H0L D;  3EQQ A;  4PD4 E;  1PP9 E;  1SJG A;  3H1L E;  3EN1 A;  1KYO E;  1PPJ E;  1EG9 A;  4NBG D;  5KLI C;  3GCE A;  2BMQ A;  4HM6 A;  1SQX E;  2HMN A;  3CWB E;  1L0N E;  2JO6 A;  1O7G A;  2NVG A;  1NTM E;  2BCC E;  2XRX A;  4NB8 D;  1VM9 A;  1O7P A;  2IBZ E;  2DE6 D;  3D89 A;  4HJL A;  4QCK A;  2FYU E;  1JM1 A;  4NBE D;  3GKE A;  1BCC E;  3VCA A;  4H13 D;  4HM1 A;  2YIU C;  3VMH D;  2YFI A;  1UUW A;  3L75 E;  1NTK E;  1P84 E;  2HMK A;  2QJK C;  4P1C H;  2CKF A;  1NU1 E;  4H44 D;  4QDF B;  2B24 A;  1SQQ E;  2HML A;  4QDC A;  4NB9 D;  3GL0 A;  5KKZ C;  1RIE A;  2HMJ A;  1SQV E;  4NBC D;  4OGQ D;  4HM8 A;  3CX5 E;  1NDO A;  1L0L E;  4NBD D;  3H1K E;  2HMM A;  5AEU A;  1G8J B;  3VCP A;  2YFL A;  3H1H E;  1ULI A;  2JZA A;  4QUR A;  3VMG D;  3TGU E;  1VF5 D;  2D2C D;  2NUM A;  2I7F A;  1O7N A;  2HMO A;  3L73 E;  1G8K B;  3DQY A;  2B1X A;  3H1J E;  4NBB D;  1EZV E;  3GOB A;  3FOU A;  2DE5 D;  1SQB E;  4HM2 A;  2E4Q A;  1FQT A;  4AIV A;  3H1I E;  2NUK A;  4HM7 A;  2QJP C;  3AZC A;  3L74 E;  3GB4 A;  4U3F E;  2NWF A;  1KB9 E;  3BCC E;  1O7W A;  4QUP A;  3GTE A;  3C0D A;  3N0Q A;  2YFJ A;  5BOK A;  2NVF A;  2YVJ B;  1BGY E;  3L71 E;  1Q90 C;  5AEW A;  3GZX A;  1RFS A;  4PV1 D;  4HKV A;  3L70 E;  2FYN C;  3GZY A;  1NTZ E;  4HM3 A;  3CXH E;  2XR8 A;  2BMR A;  2XSH A;  4QUQ A;  2QJY C;  1SQP E;  1O7M A;  3GTS A;  1ULJ A;  2GBX A;  2ZYL A;  2ZT9 D;  1VCK A;  4QDF A;  4D6T E;  1ZRT E;  3GL2 A;  4P1B H;  4NBH D;  5CXM A;  4AAY B;  2E76 D;  2A06 E;  4NBF D;  1BE3 E;  4HM4 A;  5KLV E;  3VMI D;  1NYK A;  2NVE A;  2Q3W A;  2GBW A;  2E74 D;  4HM0 A;  3L72 E;  2E75 D;  4NBA D;  1UUV A;  2XSO A;  4QDD A;  5HL4 A;  1WQL A;  2BMO A;  1O7H A;  2E4P A;  2QPZ A;  4EMJ B;  4HM5 A;  2DE7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...