4PD4E

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4pd4E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4pd4E02
1EG9A 2E75D 1UUVA 4QDDA 2XRXA 1SJGA 4EMJB 3EQQA 3GL2A 1KB9E 2XR8A 1ULIA 3L75E 3GZXA 4H0LD 2XSHA 4QUPA 4P1BH 2B1XA 3CX5E 1SQQE 3GOBA 4QURA 4HJLA 4HM1A 1VCKA 3VMHD 3GTSA 1ULJA 2HMLA 4NBCD 4HM7A 4P1CH 2NWFA 1G8JB 2YIUC 1O7WA 3D89A 2IBZE 2B24A 3CXHE 2JO6A 2NVFA 4NB9D 2HMNA 3H1LE 4QDFB 3H1HE 2YVJB 3AZCA 2HMMA 2NUKA 3CWBE 3H1JE 1P84E 4NBGD 2Q3WA 4D6TE 3N0QA 2DE6D 1O7HA 4NB8D 2DE5D 4AAYB 2YFLA 2A06E 1BGYE 4HKVA 2QJKC 2I7FA 3H1KE 1SQBE 5KLIC 3GL0A 4HM8A 4QUQA 1VM9A 1SQVE 1WQLA 1SQPE 4HM5A 3L74E 1O7PA 4HM4A 2CKFA 3VMGD 4NBHD 5AEWA 1UUWA 2BCCE 2BMOA 1BCCE 3L72E 1Q90C 2BMQA 4QDCA 5KLVE 1VF5D 3GZYA 1NTZE 5AEUA 2E74D 1ZRTE 3H1IE 2ZT9D 3VMID 2YFIA 2DE7D 2NVEA 3GTEA 4HM0A 2ZYLA 3VCAA 4QDFA 4NBAD 1PP9E 3GB4A 2GBWA 1O7NA 2QPZA 2HMJA 1NYKA 4AIVA 2HMOA 5BOKA 4HM3A 5HL4A 1NU1E 2NUMA 4HM2A 3EN1A 5KKZC 1O7GA 3BCCE 4U3FE 1RIEA 1L0NE 2XSOA 4PV1D 4OGQD 5CXMA 2QJYC 4H13D 3VCPA 2E4QA 1RFSA 2HMKA 3GCEA 1NTME 3L71E 1NTKE 1G8KB 1O7MA 2BMRA 1KYOE 3L73E 1BE3E 1FQTA 2JZAA 4NBBD 4QCKA 2NVGA 2FYNC 3DQYA 1L0LE 4NBED 4NBDD 1SQXE 2D2CD 2GBXA 2YFJA 2FYUE 3FOUA 1PPJE 2E4PA 1JM1A 1EZVE 1NDOA 4NBFD 3C0DA 3TGUE 2E76D 3GKEA 4PD4E 2QJPC 4H44D 3L70E 4HM6A
chains in the Genus database with same CATH superfamily
3FWLA 3UIAA 1EG9A 2XRXA 3GL2A 3Q5SA 3GW6A 4DJGA 2H43A 3EFFK 4H0LB 2QG4A 3H1KG 4PJ0H 3N4XA 1VCKA 4UB8H 2OTJP 4JYCA 1HWTC 1AJYA 1DIPA 5E79H 1MV8A 2M5AB 2FYUK 1PP9D 3Q5RA 4NB8D 2RN0A 1PP9G 1T2KD 3CX5H 1KILB 1ZXGA 4GOEA 1SQBE 3RK3E 3I56P 3AEGC 1L4AC 3L74E 1O7PA 1E79H 2BCCE 1GU5A 1JCDA 1SQQK 1VQLP 3IAOA 2KIKA 3WU2H 2R3CA 1RH5B 4EIJA 1L0LD 3VMID 1SFCD 4A7PA 1EQ7A 1L0LG 1G1IA 2AXTH 2CPSA 4PD4D 3HTKA 2YKOA 1U7MA 1NTME 1G8KB 1IK7A 3KZIH 3PJSK 3T97A 3CWBJ 2XZRA 3MP7B 4Y99B 2OTLP 5KLVK 2IFNA 4IL6X 3H1LD 1S9KE 2FYZA 3FWNA 3D71A 5CCGC 3H1LG 1EZVE 2B89A 4O9BA 3S4RA 1OIPA 1SQVJ 1SQXK 4DT0A 4QDDA 1KB9E 1LP1A 1ULIA 4H0LD 2XNDH 5AVVB 1L0NK 4ZMDA 1JY2N 2AEJA 3H32B 1R5LA 4HJLA 3V6IA 1ULJA 4NBCD 4HM7A 4KHXA 1QVGO 4PD4I 3F89A 4N78E 2B24A 3ITKA 4TLFA 3A5TA 4QDFB 3VP8A 1QL2A 2R32A 1P84E 3A0BE 3S1KA 2C9LY 2DE6D 1M57D 4KJMA 4XFJA 1KILD 1BGYE 3E7KA 2IZ1A 1LT9A 4UB6H 1N73A 3P8MC 1KTMA 3BCCD 2OYIB 3AEBC 3BCCG 4EI2A 4HM5A 1Q81Q 5KJ7D 2OARA 5DJUB 2XKMA 2B87B 3LIDA 4HYTB 1LT1A 3CC2P 3LW5J 1N86A 1DD4A 1QVFO 1ZOYC 2J59M 5M1BA 1GDTA 3GF7A 3L71D 4WVZA 1KYOD 3L71G 1JMMA 2PRRA 3L73E 2IYPA 4W80A 3NMDA 1EXJA 3B5ND 1IFIA 1CI6A 2ZAEB 4JQ0D 4NPFX 1HH0A 1SLQA 5BVZA 1FBMA 1UUVA 3B4SA 4PV1B 4K3AA 3O6QB 1BCCJ 2XSHA 1NTZJ 1MFTA 2JO1A 2WSEJ 3M9QA 5APXA 4HJGH 2QIWA 2OYHC 1NO4A 2E74C 1CW5A 4EDFA 2P2UA 1KYOI 4DCKA 2PP6A 4U3FJ 2K9JA 3TK1A 1HJ0A 1EXIA 4HKVA 3L71J 4L76A 2YNYA 1OW6A 1LT9C 1N73C 1SQPE 3VMZA 2V7QH 3GHGA 1MFZA 1Y8AA 1FZCB 2WT7A 1EDJA 1YQ3C 1IJDB 2DE7D 3QH9A 2J58A 2D2CC 5APUA 1R5SA 4XA4A 3M9BA 1G1JA 4AIVA 2IZ0A 1X0TA 3JCUH 1NU1E 5B5EH 1PZQA 2H8PD 1JTHA 4OGQD 1LTAC 1M90Q 1BSNA 4NBBD 2FYUD 2L5GB 1NAYA 2FFDA 3KYQA 1H89A 3MGNA 3TGUE 5AW0B 4BRYA 1JUNA 3BRTB 5EFWB 2XR8A 1YI2P 4P1BH 5GTHE 2P67A 3L4FA 5KAFH 3L72D 5APWA 4YTPC 3L72G 1H0TA 2IBZE 3CLQA 3HE4B 5TISE 4C7NA 1NVOA 3H1JE 1N8RQ 4L73A 1Y47A 1O7HA 2KS1A 1RE3C 3TNUA 1RE4A 1M1JC 3HD7C 3A0HH 4OH8B 1OZHA 1PGJA 4MN4C 3AEEC 5AVSB 5AVXB 1URQA 2FYUJ 2B88A 2KNCA 3H1IE 2N1TB 2ZXEB 1SQXD 3GTEA 1SQXG 1Z56A 2BEQD 3MTUE 4OVNF 1QX8A 1NYHA 4I6MC 4ZNCA 1SQQJ 1GL2A 1RIEA 5CBOA 2E75C 2I8DA 1RFSA 2Z5IA 3GCEA 1YHQP 4H13B 3VYIA 2ZYGA 2R5BA 1JM0A 4WY4B 4ZKUA 4PJ0E 3CMEP 4NBDD 1FZBA 2WSFJ 4WWIA 2K9YA 1N7SA 2KB7P 3C0DA 3N7NA 3Q5PA 1VF5C 2FFDC 5E79E 2P10A 1SQBD 1VQ6P 5KLVJ 3CX5E 1SQBG 2W27A 2UWJE 3EFGA 1KC8Q 3L74D 1LTJB 1GW3A 3M0DC 2WWWA 2IDBA 3L74G 1WT6A 2BCCD 5TJHA 3TSIA 2NWFA 3H1HD 2BCCG 1SQXJ 1PIXA 1K04A 3H1HG 3KHUA 3WU2E 2NUKA 2IFMA 1NGMB 2YMYA 1JY3P 5KKZB 1L0NJ 3LW5H 2R5DA 4K35A 2JKVA 3G4SP 2NZ2A 1ZLLA 2QE7H 1JY3O 2WITA 3O8ZA 2AXTE 1RE4C 2NPSB 1LTIC 3D6ZA 1T6AA 1AQ5A 4Z1MH 1NTMD 1NTMG 2DW3A 1ZMEC 4W7ZA 1LWUB 5CJ4A 2N1TD 3WUUA 3KZIE 1VQNP 1URQC 1S9KD 2PGDA 3B71A 3V2PA 4NBAD 3GB4A 1EZVD 1IFPA 1EZVG 2O1KA 2QM8A 5AVTB 5L8RJ 4JYBA 1J2JB 4HM2A 1KB9D 1S4XA 3A2AA 4H13D 1GL2C 5AVZB 1NTKE 4WY4D 1RF1B 1T2KC 2E42A 3H1HJ 2WSEH 3E1IA 3DQYA 3C1LA 1JNMA 1PV3A 1X22A 1NKNA 1ZR4A 3FOUA 2FXPA 1PPJE 1JM1A 1NDOA 1P84D 4HM6A 3AEAC 4IFMA 2L91A 3RL0B 1SFCC 2JEEA 2PFXA 4H44B 1BGYD 2J5UA 2V7QJ 1BGYG 1KYOH 1W2EA 4QUPA 3NFQA 5AVRB 5AW8B 2QM7A 4UB6E 1VDFA 5CCGA 3CI9A 1EZVI 5GTIE 2XU6A 1W5CE 2HMNA 4JPZB 1KB9I 3S9OA 2GUVA 4D6TE 3H1KD 2HPCA 5AW2B 1IC2A 2NPSD 3K5BA 5K5GB 1VM9A 2R3SA 1WQLA 3QWOC 2FYNB 1P84I 1FZEA 1HGZA 4H0LC 2AEFA 4I7ZB 1YIJP 3NTNA 3Q3DA 1RY3A 5AW5B 5CCHC 4QDFA 2Q3IA 2K37A 1RQVA 3FGAD 4WBAA 2AEMA 3AE3C 2POHA 3CCQP 2KK7A 2QPZA 2RMZA 4HM3A 3EN1A 4RJTA 2IX7C 4TT3H 1VL2A 2OYIA 1HBWA 4HH2A 1KILC 2WTYA 2ITAA 1FZGA 3FXDA 1FZAA 2LXCB 2QSIA 2E4PA 1G2CA 5KJ7C 3H1KJ 2N9BA 2QEXP 2CPBA 3V2NA 3RL0D 4JBZA 4H44D 2GA1A 1HJBA 2E76B 3L36A 1SJGA 1AFOA 3I5CA 3SWYA 1LTGC 1IO4A 3RL0g 1FU1A 1HUCA 5DJTB 1SQPD 2N9YB 3RGUA 3PP5A 3VMHD 1SQPG 3SFEC 1S5LH 1O7WA 1A02J 1PP9J 3USSA 3B5NB 1LGHB 1Q2NA 1RF0C 3ABVC 4Y99C 4DZOA 2NRGA 3AECC 1QLED 2Q7CA 2KUBA 3O6QA 4HM8A 2PAJA 3WUVA 1L0LJ 5B5EE 2OYHA 1OW7A 3CXHH 1AVYA 3AE5C 2HLOA 2QJPB 3G3ZA 1VQOP 2H88C 2WSFH 4I2LC 3TGUD 3BVHA 3TGUG 3H25A 1AQTA 2OTKE 1M1KQ 1L4AD 2KLUA 2JWDA 3MZWB 1SQBK 2HMKA 4OWFA 2ZFCA 2XNXA 1O7MA 3H1LJ 1H8AA 2OYIC 2HYNA 3AE8C 5KAFE 2IBZG 3TYYA 3A3YB 4IFDK 4GT1A 3R2PA 4DOJA 2E76D 3GKEA 3CC4P 1FOSF 3EQQA 4OGQB 3WMM0 3GZXA 3IFMA 2A45G 3CL3D 4I1LA 3HTKB 1NTMK 1VQ8P 3T97B 3PHLA 5CCGD 4U7JA 3H1ID 5CMZA 2HMMA 3H1IG 3CWBE 5B66H 3BCCJ 5CHXA 4YXWH 5AVUB 2YFLA 2JDIH 4Y28J 2QA4P 3PH0A 1LP1B 1SQVE 3ZDMA 4PV1C 1J1DB 2O01J 1YTZI 3VOPA 1NJIQ 4ASVA 4QDCA 4L74A 1RE3A 2OGUA 1ZRTE 1M1JA 2E74B 3HD7A 4HM0A 2ZYLA 2A45I 5H2FH 3JSVC 1EDIA 1NHLA 1KN7A 3SWFA 2AXCA 3CMAP 3E1RA 1IFJA 5AVYB 3G6EP 4M3LA 1O7GA 3G9RA 2JWAA 1S5LX 3V4WA 1N73B 1S1CX 2YIUB 3U1AA 1NAFA 3BRVB 1VQMP 1BE3E 3C9IA 3TF5A 2O1JA 1K05A 3F5HA 3MD0A 4JF7A 1DX7A 1K8AQ 3KXDA 5C39A 2KXPB 2GBXA 1FZCC 4NBFD 5KLIB 4GIFA 3L70E 1FDIA 2JJLA 3L75E 3V2RA 1MZ9A 2Q5UA 1VQ9P 1EDLA 1IFNA 3GTSA 2HMLA 3P7KA 4L75A 3EWKA 2JO6A 2O01N 1CI6B 3N0QA 1M8OB 3HUSB 3KPEA 1PGPA 2KYVA 4IL6E 3M0DA 1KD1Q 1FDMA 3RK3B 1W2BO 4YXDC 1JOCA 1LTSC 1A02F 2FXMA 4NBHD 3II6A 3W67A 1Q82Q 1BCCE 2R44A 3P32A 3RK2B 1NTKG 3M0AA 1VQ4P 1NTZE 1U57A 2E74D 1MKMA 2QRXA 4LLHA 3SFDC 1DEBA 2W6JH 3AE7C 2K88A 2XV5A 1VQ5P 1ZW0A 1PPJD 3OJAB 2QVAA 3HE5A 1PPJG 4N3YB 1L2PA 3GMAA 2WPRA 4NPDA 2NUMA 4U3FE 4RKUJ 5CXMA 1OX3A 3MHVA 3VCPA 1SP4A 3L71E 2Y0DA 1J1EB 1KYOE 1SQPK 5APVA 3GHGB 1QGKB 1LWUA 2WVRA 2WT7B 1N2DC 2D2CD 2YO3A 1LTTC 3P8CE 1GZLA 4D6TD 2N1TC 2KLVA 4AUWA 4D6TG 2OQQA 1TU3F 4EMJB 2ZYAA 4EOTA 3L72J 2RH0A 3CCLP 1YBKA 1NU1K 2MJZA 1Q7YQ 1JY3N 2YKQA 1JTHB 4W7YA 4GKGA 1GK4A 2KP8A 3R4YA 2E5TA 4P1CH 4UB8E 1NWQA 1Q86Q 2I1JA 3IN6A 3Q2YA 1X79B 1SFCA 4PD4H 4WY4C 3AZCA 2ZT9C 1FS0E 2Q3WA 3CPWO 2KI7B 2FFDB 3RK3D 4BRYB 2QJKC 2YXRB 1UIXA 1KFNA 4QUQA 3RK2D 3VMGD 1X9VA 5AEWA 3JC22 1Q90C 1GW4A 3W68A 2Y0CA 4NPEA 4AQRD 3KDPB 1LTJC 1KZUB 1OMIA 4IOIH 1H0TB 5BU8B 4QMAA 1FC2C 3LIEA 2GBWA 5KTBA 3IR9A 1NYKA 2Z4EA 2KS1B 5KKZC 2HODB 1AV1A 3TNUB 1CSBA 2W6BA 5APSA 5CCHA 1WMKA 2HG5D 1FE6A 1H88A 1URQB 2M5AA 2KNCB 1LWUC 2FYUE 1SQBJ 3H6PA 1KILA 2E75D 3L74J 1KQFB 1KV4A 5AW6B 2BCCJ 3V2QA 1YITP 3D6YA 1SQQE 4N78D 2O01H 5KJ7A 1OW8A 2Q6QA 1G8JB 2P1JA 4LC1A 2B9BA 1RF1C 5TISH 3CXHE 3CCEP 3CCRP 1FDOA 1XTCC 2W6AA 1JMBA 2QJYB 1N7SB 3MIWA 4ZKPA 1NTMJ 1HF9A 3GF3A 4C7RA 2IYOA 1PL5A 3KQGA 1CZQA 3RL0C 4H44C 1UUWA 1RF0A 2SPZA 1K9MQ 1T8ZA 5KLVE 3GZYA 1GMJA 3PTZA 2I1KA 1ZR2A 4EYYQ 1LNQA 1BDCA 2HMOA 1N7LA 1L0NE 3L73D 3V4QA 3H32A 4B86A 2W83C 3L73G 1URQD 4ASWA 2FYNC 1AVOA 3OAKA 1BGYJ 2YFJA 3CCVP 5KAIH 4I7ZC 3CWBD 1RQUA 3CWBG 5B66E 1L4AB 2E43A 2FXOA 1GL2D 2XDJA 1PFIA 2B1XA 1VQKP 2W90A 2WQYC 2YO2A 1SQVD 2E5YA 2WPSA 1SQVG 1NTKK 2B87A 4RO0A 3U59A 1FOSE 2FKWB 2HR3A 1ZRTD 3H1HE 1N7SD 2P58A 3TDKA 5H2FE 2A06E 5AW9B 1VQ7P 1QL1A 3L73J 2E76C 3IF4A 3U1CA 4HM4A 3GG2A 2CKFA 1T3JA 1BE3D 1T3UA 1BE3G 5AEUA 1YJNP 2WSCJ 1WRGA 1EDKA 3B5NC 2K1AA 2LKMA 1NU1D 3L70D 1NU1G 1DEEG 2Y0EA 3L70G 3JCUE 5CJ0A 2XSOA 3L75D 2HPCB 3RBXA 3L75G 4HKZH 4KT0J 1VPCA 2O3JA 2Q3EA 3WUTA 4WB4A 3FXEA 2JZAA 1FAVA 1QEXA 5CCHD 3CCUP 4LGDE 4NBED 3B8EB 2C0XA 1NOHA 3Q1MA 4CPGA 2QJPC 2GM4A 1YTZT 1SQPJ 3AE6C 2WPVB 3AEDC 1BE3J 1YYCA 1FZCA 4HM1A 2Y9ZA 2IBZD 5GTIH 1BCCD 1KFMA 1AA0A 1BCCG 2CK3H 3L35A 1NTZD 3H1JD 4NB9D 1NTZG 3H1JG 2G8YA 2W8ZA 2H7HA 4YPCA 3PLNA 1NU1J 3L70J 1KQLA 1YQ4C 1JY2P 4GDOA 1HTLC 1G2CB 4AAYB 2HFED 1BSHA 3L75J 4BWNA 3H1KE 4U3FD 1JY2O 3A0HE 3VN0A 4U3FG 1USDA 1LJ2A 4OGQC 1M56D 1JB0J 2BMOA 1S72P 2C0WA 4GODA 1PGOA 3TGUJ 1U7JA 2G3AA 2YFIA 3VCAA 2WSSH 1RHZB 2Z5HA 1PP9E 4IFFA 3P8CD 3VTPC 3HUSA 2VRSA 2IBZI 3PRJA 5AW4B 1GK6A 1M7LA 1OWAA 2OYHB 3H1JJ 3HE4A 1GD2E 2WZ7A 1J1DC 1L0LE 5AW3B 3M9HA 1ZV8A 1KMIZ 4PD4E 1HGVA 1LT9B 2P7JA 3OA7A 3CX5D 3I55P 1GTWA 3AEFC 2YMKA 3GOBA 3H1IJ 3MUDA 2WMMA 3AE2C 1HVVA 2C9NY 1OVUA 2YIUC 2N1TA 3D89A 2D2CB 3H1LE 4NBGD 3A7OA 1KB9H 1NH4A 3RBZA 1OVRA 3VMXA 5KLIC 1ZP0C 4WY4A 3D70A 2BEZF 1KORA 1KQGB 2FBWC 1P84H 2M8RA 3A0BH 4XE5B 3CX5I 5APQA 3AE9C 2LR2A 2ZJSE 2MKVA 2FYUG 3BATA 1KILE 2HMJA 3AE4C 5BOKA 5HL4A 3BCCE 2YKPA 3HUSC 3M91A 1NTKD 4PV1D 1LTJA 1SVFA 2K3RA 3C8VA 3RK3C 1SQQD 2H89C 1SQVK 3FX0A 1SQQG 1FQTA 4QCKA 2NVGA 1EC5A 3CXHD 3HRNA 3RK2C 1JO5A 2K9JB 1M1JB 3VMAA 3HD7B 1L0LK 2M3EA 1NKZB 2NPSA 3OW2O 3GLMA 2HODA 5AVWB 2GUSA 4QURA 1XTGB 4N6JA 2ZYDA 5APYA 3MUDC 4HB1A 3BASA 1FJKA 5KLVD 1J1EC 5KLVG 2M3BA 2WSCH 3GHGC 4R4LA 3NXSA 2E75B 1R8EA 3CC7P 2V4HA 1NTKJ 1FZFA 2ZVOB 1LTBC 5AW1B 1X8YA 1OFCX 3GL0A 2KOGA 1L0ND 3M06A 1RF1A 3CXHI 1L0NG 1JEKA 4H13C 4BXLA 2BMQA 5AVQB 1BDDA 3CD6P 2ZXXA 2JR8A 1VF5B 4R4MA 2ZT9B 3V5BA 1K73Q 3CCMP 1S3JA 1VQPP 2Q9IA 1O7NA 2QJKB 5KAIE 2FY8A 3CCSP 2YXQB 2ZVNB 2RKLA 1E5WA 4D6TJ 1OXZA 5APTA 1FJPA 4C7NB 1NTZK 2M0BA 3HD7D 2JP3A 4C46A 1MUUA 1OVVA 2A06D 3HE5B 3G71P 3VP9A 2A06G 2OYOA 3SWKA 2NPSC 2IPPA 2KSJA 2Q1KA 1S5LE 2NVFA 2BASA 1YJ9P 2YVJB 1PGQA 2DE5D 5GTHH 1GL2B 4IL6H 1USEA 2I7FA 1L4AA 1IFMA 4GOFA 3AE1C 3SSUA 1KQSO 3L72E 1IZNB 3CCJP 2LXBA 1VF5D 5AW7B 2ZT9D 1DD3A 2NVEA 3EQ2A 1SFCB 1Y9BA 1YJWP 2Y9YA 1IFDA 2A45H 1UIIA 4RESB 2WPQA 3VMYA 5CBNA 1D7MA 1JCCA 1IK9A 2QJYC 2E4QA 2KZJA 1N7SC 2KZIA 1Q90D 2BMRA 1ZN5A 3L37A 5BU5A 1DH3A 3B5NA 1S2EA 1SQXE 4AYCA 2KSEA 1SS1A 1GU4A
chains in the Genus database with same CATH topology
1EG9A 2E75D 1UUVA 4QDDA 2XRXA 1SJGA 4EMJB 3EQQA 3GL2A 1KB9E 2XR8A 1ULIA 3L75E 3GZXA 4H0LD 2XSHA 4QUPA 4P1BH 2B1XA 3CX5E 1SQQE 3GOBA 4QURA 4HJLA 4HM1A 1VCKA 3VMHD 3GTSA 1ULJA 2HMLA 4NBCD 4HM7A 4P1CH 2NWFA 1G8JB 2YIUC 1O7WA 3D89A 2IBZE 2B24A 3CXHE 2JO6A 2NVFA 4NB9D 2HMNA 3H1LE 4QDFB 3H1HE 2YVJB 3AZCA 2HMMA 2NUKA 3CWBE 3H1JE 1P84E 4NBGD 2Q3WA 4D6TE 3N0QA 2DE6D 1O7HA 4NB8D 2DE5D 4AAYB 2YFLA 2A06E 1BGYE 4HKVA 2QJKC 2I7FA 3H1KE 1SQBE 5KLIC 3GL0A 4HM8A 4QUQA 1VM9A 1SQVE 1WQLA 1SQPE 4HM5A 3L74E 1O7PA 4HM4A 2CKFA 3VMGD 4NBHD 5AEWA 1UUWA 2BCCE 2BMOA 1BCCE 3L72E 1Q90C 2BMQA 4QDCA 5KLVE 1VF5D 3GZYA 1NTZE 5AEUA 2E74D 1ZRTE 3H1IE 2ZT9D 3VMID 2YFIA 2DE7D 2NVEA 3GTEA 4HM0A 2ZYLA 3VCAA 4QDFA 4NBAD 1PP9E 3GB4A 2GBWA 1O7NA 2QPZA 2HMJA 1NYKA 4AIVA 2HMOA 5BOKA 4HM3A 5HL4A 1NU1E 2NUMA 4HM2A 3EN1A 5KKZC 1O7GA 3BCCE 4U3FE 1RIEA 1L0NE 2XSOA 4PV1D 4OGQD 5CXMA 2QJYC 4H13D 3VCPA 2E4QA 1RFSA 2HMKA 3GCEA 1NTME 3L71E 1NTKE 1G8KB 1O7MA 2BMRA 1KYOE 3L73E 1BE3E 1FQTA 2JZAA 4NBBD 4QCKA 2NVGA 2FYNC 3DQYA 1L0LE 4NBED 4NBDD 1SQXE 2D2CD 2GBXA 2YFJA 2FYUE 3FOUA 1PPJE 2E4PA 1JM1A 1EZVE 1NDOA 4NBFD 3C0DA 3TGUE 2E76D 3GKEA 4PD4E 2QJPC 4H44D 3L70E 4HM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG9 A;  2E75 D;  1UUV A;  4QDD A;  2XRX A;  1SJG A;  4EMJ B;  3EQQ A;  3GL2 A;  1KB9 E;  2XR8 A;  1ULI A;  3L75 E;  3GZX A;  4H0L D;  2XSH A;  4QUP A;  4P1B H;  2B1X A;  3CX5 E;  1SQQ E;  3GOB A;  4QUR A;  4HJL A;  4HM1 A;  1VCK A;  3VMH D;  3GTS A;  1ULJ A;  2HML A;  4NBC D;  4HM7 A;  4P1C H;  2NWF A;  1G8J B;  2YIU C;  1O7W A;  3D89 A;  2IBZ E;  2B24 A;  3CXH E;  2JO6 A;  2NVF A;  4NB9 D;  2HMN A;  3H1L E;  4QDF B;  3H1H E;  2YVJ B;  3AZC A;  2HMM A;  2NUK A;  3CWB E;  3H1J E;  1P84 E;  4NBG D;  2Q3W A;  4D6T E;  3N0Q A;  2DE6 D;  1O7H A;  4NB8 D;  2DE5 D;  4AAY B;  2YFL A;  2A06 E;  1BGY E;  4HKV A;  2QJK C;  2I7F A;  3H1K E;  1SQB E;  5KLI C;  3GL0 A;  4HM8 A;  4QUQ A;  1VM9 A;  1SQV E;  1WQL A;  1SQP E;  4HM5 A;  3L74 E;  1O7P A;  4HM4 A;  2CKF A;  3VMG D;  4NBH D;  5AEW A;  1UUW A;  2BCC E;  2BMO A;  1BCC E;  3L72 E;  1Q90 C;  2BMQ A;  4QDC A;  5KLV E;  1VF5 D;  3GZY A;  1NTZ E;  5AEU A;  2E74 D;  1ZRT E;  3H1I E;  2ZT9 D;  3VMI D;  2YFI A;  2DE7 D;  2NVE A;  3GTE A;  4HM0 A;  2ZYL A;  3VCA A;  4QDF A;  4NBA D;  1PP9 E;  3GB4 A;  2GBW A;  1O7N A;  2QPZ A;  2HMJ A;  1NYK A;  4AIV A;  2HMO A;  5BOK A;  4HM3 A;  5HL4 A;  1NU1 E;  2NUM A;  4HM2 A;  3EN1 A;  5KKZ C;  1O7G A;  3BCC E;  4U3F E;  1RIE A;  1L0N E;  2XSO A;  4PV1 D;  4OGQ D;  5CXM A;  2QJY C;  4H13 D;  3VCP A;  2E4Q A;  1RFS A;  2HMK A;  3GCE A;  1NTM E;  3L71 E;  1NTK E;  1G8K B;  1O7M A;  2BMR A;  1KYO E;  3L73 E;  1BE3 E;  1FQT A;  2JZA A;  4NBB D;  4QCK A;  2NVG A;  2FYN C;  3DQY A;  1L0L E;  4NBE D;  4NBD D;  1SQX E;  2D2C D;  2GBX A;  2YFJ A;  2FYU E;  3FOU A;  1PPJ E;  2E4P A;  1JM1 A;  1EZV E;  1NDO A;  4NBF D;  3C0D A;  3TGU E;  2E76 D;  3GKE A;  4PD4 E;  2QJP C;  4H44 D;  3L70 E;  4HM6 A; 
#chains in the Genus database with same CATH topology
 3FWL A;  3UIA A;  1EG9 A;  2XRX A;  3GL2 A;  3Q5S A;  3GW6 A;  4DJG A;  2H43 A;  3EFF K;  4H0L B;  2QG4 A;  3H1K G;  4PJ0 H;  3N4X A;  1VCK A;  4UB8 H;  2OTJ P;  4JYC A;  1HWT C;  1AJY A;  1DIP A;  5E79 H;  1MV8 A;  2M5A B;  2FYU K;  1PP9 D;  3Q5R A;  4NB8 D;  2RN0 A;  1PP9 G;  1T2K D;  3CX5 H;  1KIL B;  1ZXG A;  4GOE A;  1SQB E;  3RK3 E;  3I56 P;  3AEG C;  1L4A C;  3L74 E;  1O7P A;  1E79 H;  2BCC E;  1GU5 A;  1JCD A;  1SQQ K;  1VQL P;  3IAO A;  2KIK A;  3WU2 H;  2R3C A;  1RH5 B;  4EIJ A;  1L0L D;  3VMI D;  1SFC D;  4A7P A;  1EQ7 A;  1L0L G;  1G1I A;  2AXT H;  2CPS A;  4PD4 D;  3HTK A;  2YKO A;  1U7M A;  1NTM E;  1G8K B;  1IK7 A;  3KZI H;  3PJS K;  3T97 A;  3CWB J;  2XZR A;  3MP7 B;  4Y99 B;  2OTL P;  5KLV K;  2IFN A;  4IL6 X;  3H1L D;  1S9K E;  2FYZ A;  3FWN A;  3D71 A;  5CCG C;  3H1L G;  1EZV E;  2B89 A;  4O9B A;  3S4R A;  1OIP A;  1SQV J;  1SQX K;  4DT0 A;  4QDD A;  1KB9 E;  1LP1 A;  1ULI A;  4H0L D;  2XND H;  5AVV B;  1L0N K;  4ZMD A;  1JY2 N;  2AEJ A;  3H32 B;  1R5L A;  4HJL A;  3V6I A;  1ULJ A;  4NBC D;  4HM7 A;  4KHX A;  1QVG O;  4PD4 I;  3F89 A;  4N78 E;  2B24 A;  3ITK A;  4TLF A;  3A5T A;  4QDF B;  3VP8 A;  1QL2 A;  2R32 A;  1P84 E;  3A0B E;  3S1K A;  2C9L Y;  2DE6 D;  1M57 D;  4KJM A;  4XFJ A;  1KIL D;  1BGY E;  3E7K A;  2IZ1 A;  1LT9 A;  4UB6 H;  1N73 A;  3P8M C;  1KTM A;  3BCC D;  2OYI B;  3AEB C;  3BCC G;  4EI2 A;  4HM5 A;  1Q81 Q;  5KJ7 D;  2OAR A;  5DJU B;  2XKM A;  2B87 B;  3LID A;  4HYT B;  1LT1 A;  3CC2 P;  3LW5 J;  1N86 A;  1DD4 A;  1QVF O;  1ZOY C;  2J59 M;  5M1B A;  1GDT A;  3GF7 A;  3L71 D;  4WVZ A;  1KYO D;  3L71 G;  1JMM A;  2PRR A;  3L73 E;  2IYP A;  4W80 A;  3NMD A;  1EXJ A;  3B5N D;  1IFI A;  1CI6 A;  2ZAE B;  4JQ0 D;  4NPF X;  1HH0 A;  1SLQ A;  5BVZ A;  1FBM A;  1UUV A;  3B4S A;  4PV1 B;  4K3A A;  3O6Q B;  1BCC J;  2XSH A;  1NTZ J;  1MFT A;  2JO1 A;  2WSE J;  3M9Q A;  5APX A;  4HJG H;  2QIW A;  2OYH C;  1NO4 A;  2E74 C;  1CW5 A;  4EDF A;  2P2U A;  1KYO I;  4DCK A;  2PP6 A;  4U3F J;  2K9J A;  3TK1 A;  1HJ0 A;  1EXI A;  4HKV A;  3L71 J;  4L76 A;  2YNY A;  1OW6 A;  1LT9 C;  1N73 C;  1SQP E;  3VMZ A;  2V7Q H;  3GHG A;  1MFZ A;  1Y8A A;  1FZC B;  2WT7 A;  1EDJ A;  1YQ3 C;  1IJD B;  2DE7 D;  3QH9 A;  2J58 A;  2D2C C;  5APU A;  1R5S A;  4XA4 A;  3M9B A;  1G1J A;  4AIV A;  2IZ0 A;  1X0T A;  3JCU H;  1NU1 E;  5B5E H;  1PZQ A;  2H8P D;  1JTH A;  4OGQ D;  1LTA C;  1M90 Q;  1BSN A;  4NBB D;  2FYU D;  2L5G B;  1NAY A;  2FFD A;  3KYQ A;  1H89 A;  3MGN A;  3TGU E;  5AW0 B;  4BRY A;  1JUN A;  3BRT B;  5EFW B;  2XR8 A;  1YI2 P;  4P1B H;  5GTH E;  2P67 A;  3L4F A;  5KAF H;  3L72 D;  5APW A;  4YTP C;  3L72 G;  1H0T A;  2IBZ E;  3CLQ A;  3HE4 B;  5TIS E;  4C7N A;  1NVO A;  3H1J E;  1N8R Q;  4L73 A;  1Y47 A;  1O7H A;  2KS1 A;  1RE3 C;  3TNU A;  1RE4 A;  1M1J C;  3HD7 C;  3A0H H;  4OH8 B;  1OZH A;  1PGJ A;  4MN4 C;  3AEE C;  5AVS B;  5AVX B;  1URQ A;  2FYU J;  2B88 A;  2KNC A;  3H1I E;  2N1T B;  2ZXE B;  1SQX D;  3GTE A;  1SQX G;  1Z56 A;  2BEQ D;  3MTU E;  4OVN F;  1QX8 A;  1NYH A;  4I6M C;  4ZNC A;  1SQQ J;  1GL2 A;  1RIE A;  5CBO A;  2E75 C;  2I8D A;  1RFS A;  2Z5I A;  3GCE A;  1YHQ P;  4H13 B;  3VYI A;  2ZYG A;  2R5B A;  1JM0 A;  4WY4 B;  4ZKU A;  4PJ0 E;  3CME P;  4NBD D;  1FZB A;  2WSF J;  4WWI A;  2K9Y A;  1N7S A;  2KB7 P;  3C0D A;  3N7N A;  3Q5P A;  1VF5 C;  2FFD C;  5E79 E;  2P10 A;  1SQB D;  1VQ6 P;  5KLV J;  3CX5 E;  1SQB G;  2W27 A;  2UWJ E;  3EFG A;  1KC8 Q;  3L74 D;  1LTJ B;  1GW3 A;  3M0D C;  2WWW A;  2IDB A;  3L74 G;  1WT6 A;  2BCC D;  5TJH A;  3TSI A;  2NWF A;  3H1H D;  2BCC G;  1SQX J;  1PIX A;  1K04 A;  3H1H G;  3KHU A;  3WU2 E;  2NUK A;  2IFM A;  1NGM B;  2YMY A;  1JY3 P;  5KKZ B;  1L0N J;  3LW5 H;  2R5D A;  4K35 A;  2JKV A;  3G4S P;  2NZ2 A;  1ZLL A;  2QE7 H;  1JY3 O;  2WIT A;  3O8Z A;  2AXT E;  1RE4 C;  2NPS B;  1LTI C;  3D6Z A;  1T6A A;  1AQ5 A;  4Z1M H;  1NTM D;  1NTM G;  2DW3 A;  1ZME C;  4W7Z A;  1LWU B;  5CJ4 A;  2N1T D;  3WUU A;  3KZI E;  1VQN P;  1URQ C;  1S9K D;  2PGD A;  3B71 A;  3V2P A;  4NBA D;  3GB4 A;  1EZV D;  1IFP A;  1EZV G;  2O1K A;  2QM8 A;  5AVT B;  5L8R J;  4JYB A;  1J2J B;  4HM2 A;  1KB9 D;  1S4X A;  3A2A A;  4H13 D;  1GL2 C;  5AVZ B;  1NTK E;  4WY4 D;  1RF1 B;  1T2K C;  2E42 A;  3H1H J;  2WSE H;  3E1I A;  3DQY A;  3C1L A;  1JNM A;  1PV3 A;  1X22 A;  1NKN A;  1ZR4 A;  3FOU A;  2FXP A;  1PPJ E;  1JM1 A;  1NDO A;  1P84 D;  4HM6 A;  3AEA C;  4IFM A;  2L91 A;  3RL0 B;  1SFC C;  2JEE A;  2PFX A;  4H44 B;  1BGY D;  2J5U A;  2V7Q J;  1BGY G;  1KYO H;  1W2E A;  4QUP A;  3NFQ A;  5AVR B;  5AW8 B;  2QM7 A;  4UB6 E;  1VDF A;  5CCG A;  3CI9 A;  1EZV I;  5GTI E;  2XU6 A;  1W5C E;  2HMN A;  4JPZ B;  1KB9 I;  3S9O A;  2GUV A;  4D6T E;  3H1K D;  2HPC A;  5AW2 B;  1IC2 A;  2NPS D;  3K5B A;  5K5G B;  1VM9 A;  2R3S A;  1WQL A;  3QWO C;  2FYN B;  1P84 I;  1FZE A;  1HGZ A;  4H0L C;  2AEF A;  4I7Z B;  1YIJ P;  3NTN A;  3Q3D A;  1RY3 A;  5AW5 B;  5CCH C;  4QDF A;  2Q3I A;  2K37 A;  1RQV A;  3FGA D;  4WBA A;  2AEM A;  3AE3 C;  2POH A;  3CCQ P;  2KK7 A;  2QPZ A;  2RMZ A;  4HM3 A;  3EN1 A;  4RJT A;  2IX7 C;  4TT3 H;  1VL2 A;  2OYI A;  1HBW A;  4HH2 A;  1KIL C;  2WTY A;  2ITA A;  1FZG A;  3FXD A;  1FZA A;  2LXC B;  2QSI A;  2E4P A;  1G2C A;  5KJ7 C;  3H1K J;  2N9B A;  2QEX P;  2CPB A;  3V2N A;  3RL0 D;  4JBZ A;  4H44 D;  2GA1 A;  1HJB A;  2E76 B;  3L36 A;  1SJG A;  1AFO A;  3I5C A;  3SWY A;  1LTG C;  1IO4 A;  3RL0 g;  1FU1 A;  1HUC A;  5DJT B;  1SQP D;  2N9Y B;  3RGU A;  3PP5 A;  3VMH D;  1SQP G;  3SFE C;  1S5L H;  1O7W A;  1A02 J;  1PP9 J;  3USS A;  3B5N B;  1LGH B;  1Q2N A;  1RF0 C;  3ABV C;  4Y99 C;  4DZO A;  2NRG A;  3AEC C;  1QLE D;  2Q7C A;  2KUB A;  3O6Q A;  4HM8 A;  2PAJ A;  3WUV A;  1L0L J;  5B5E E;  2OYH A;  1OW7 A;  3CXH H;  1AVY A;  3AE5 C;  2HLO A;  2QJP B;  3G3Z A;  1VQO P;  2H88 C;  2WSF H;  4I2L C;  3TGU D;  3BVH A;  3TGU G;  3H25 A;  1AQT A;  2OTK E;  1M1K Q;  1L4A D;  2KLU A;  2JWD A;  3MZW B;  1SQB K;  2HMK A;  4OWF A;  2ZFC A;  2XNX A;  1O7M A;  3H1L J;  1H8A A;  2OYI C;  2HYN A;  3AE8 C;  5KAF E;  2IBZ G;  3TYY A;  3A3Y B;  4IFD K;  4GT1 A;  3R2P A;  4DOJ A;  2E76 D;  3GKE A;  3CC4 P;  1FOS F;  3EQQ A;  4OGQ B;  3WMM 0;  3GZX A;  3IFM A;  2A45 G;  3CL3 D;  4I1L A;  3HTK B;  1NTM K;  1VQ8 P;  3T97 B;  3PHL A;  5CCG D;  4U7J A;  3H1I D;  5CMZ A;  2HMM A;  3H1I G;  3CWB E;  5B66 H;  3BCC J;  5CHX A;  4YXW H;  5AVU B;  2YFL A;  2JDI H;  4Y28 J;  2QA4 P;  3PH0 A;  1LP1 B;  1SQV E;  3ZDM A;  4PV1 C;  1J1D B;  2O01 J;  1YTZ I;  3VOP A;  1NJI Q;  4ASV A;  4QDC A;  4L74 A;  1RE3 A;  2OGU A;  1ZRT E;  1M1J A;  2E74 B;  3HD7 A;  4HM0 A;  2ZYL A;  2A45 I;  5H2F H;  3JSV C;  1EDI A;  1NHL A;  1KN7 A;  3SWF A;  2AXC A;  3CMA P;  3E1R A;  1IFJ A;  5AVY B;  3G6E P;  4M3L A;  1O7G A;  3G9R A;  2JWA A;  1S5L X;  3V4W A;  1N73 B;  1S1C X;  2YIU B;  3U1A A;  1NAF A;  3BRV B;  1VQM P;  1BE3 E;  3C9I A;  3TF5 A;  2O1J A;  1K05 A;  3F5H A;  3MD0 A;  4JF7 A;  1DX7 A;  1K8A Q;  3KXD A;  5C39 A;  2KXP B;  2GBX A;  1FZC C;  4NBF D;  5KLI B;  4GIF A;  3L70 E;  1FDI A;  2JJL A;  3L75 E;  3V2R A;  1MZ9 A;  2Q5U A;  1VQ9 P;  1EDL A;  1IFN A;  3GTS A;  2HML A;  3P7K A;  4L75 A;  3EWK A;  2JO6 A;  2O01 N;  1CI6 B;  3N0Q A;  1M8O B;  3HUS B;  3KPE A;  1PGP A;  2KYV A;  4IL6 E;  3M0D A;  1KD1 Q;  1FDM A;  3RK3 B;  1W2B O;  4YXD C;  1JOC A;  1LTS C;  1A02 F;  2FXM A;  4NBH D;  3II6 A;  3W67 A;  1Q82 Q;  1BCC E;  2R44 A;  3P32 A;  3RK2 B;  1NTK G;  3M0A A;  1VQ4 P;  1NTZ E;  1U57 A;  2E74 D;  1MKM A;  2QRX A;  4LLH A;  3SFD C;  1DEB A;  2W6J H;  3AE7 C;  2K88 A;  2XV5 A;  1VQ5 P;  1ZW0 A;  1PPJ D;  3OJA B;  2QVA A;  3HE5 A;  1PPJ G;  4N3Y B;  1L2P A;  3GMA A;  2WPR A;  4NPD A;  2NUM A;  4U3F E;  4RKU J;  5CXM A;  1OX3 A;  3MHV A;  3VCP A;  1SP4 A;  3L71 E;  2Y0D A;  1J1E B;  1KYO E;  1SQP K;  5APV A;  3GHG B;  1QGK B;  1LWU A;  2WVR A;  2WT7 B;  1N2D C;  2D2C D;  2YO3 A;  1LTT C;  3P8C E;  1GZL A;  4D6T D;  2N1T C;  2KLV A;  4AUW A;  4D6T G;  2OQQ A;  1TU3 F;  4EMJ B;  2ZYA A;  4EOT A;  3L72 J;  2RH0 A;  3CCL P;  1YBK A;  1NU1 K;  2MJZ A;  1Q7Y Q;  1JY3 N;  2YKQ A;  1JTH B;  4W7Y A;  4GKG A;  1GK4 A;  2KP8 A;  3R4Y A;  2E5T A;  4P1C H;  4UB8 E;  1NWQ A;  1Q86 Q;  2I1J A;  3IN6 A;  3Q2Y A;  1X79 B;  1SFC A;  4PD4 H;  4WY4 C;  3AZC A;  2ZT9 C;  1FS0 E;  2Q3W A;  3CPW O;  2KI7 B;  2FFD B;  3RK3 D;  4BRY B;  2QJK C;  2YXR B;  1UIX A;  1KFN A;  4QUQ A;  3RK2 D;  3VMG D;  1X9V A;  5AEW A;  3JC2 2;  1Q90 C;  1GW4 A;  3W68 A;  2Y0C A;  4NPE A;  4AQR D;  3KDP B;  1LTJ C;  1KZU B;  1OMI A;  4IOI H;  1H0T B;  5BU8 B;  4QMA A;  1FC2 C;  3LIE A;  2GBW A;  5KTB A;  3IR9 A;  1NYK A;  2Z4E A;  2KS1 B;  5KKZ C;  2HOD B;  1AV1 A;  3TNU B;  1CSB A;  2W6B A;  5APS A;  5CCH A;  1WMK A;  2HG5 D;  1FE6 A;  1H88 A;  1URQ B;  2M5A A;  2KNC B;  1LWU C;  2FYU E;  1SQB J;  3H6P A;  1KIL A;  2E75 D;  3L74 J;  1KQF B;  1KV4 A;  5AW6 B;  2BCC J;  3V2Q A;  1YIT P;  3D6Y A;  1SQQ E;  4N78 D;  2O01 H;  5KJ7 A;  1OW8 A;  2Q6Q A;  1G8J B;  2P1J A;  4LC1 A;  2B9B A;  1RF1 C;  5TIS H;  3CXH E;  3CCE P;  3CCR P;  1FDO A;  1XTC C;  2W6A A;  1JMB A;  2QJY B;  1N7S B;  3MIW A;  4ZKP A;  1NTM J;  1HF9 A;  3GF3 A;  4C7R A;  2IYO A;  1PL5 A;  3KQG A;  1CZQ A;  3RL0 C;  4H44 C;  1UUW A;  1RF0 A;  2SPZ A;  1K9M Q;  1T8Z A;  5KLV E;  3GZY A;  1GMJ A;  3PTZ A;  2I1K A;  1ZR2 A;  4EYY Q;  1LNQ A;  1BDC A;  2HMO A;  1N7L A;  1L0N E;  3L73 D;  3V4Q A;  3H32 A;  4B86 A;  2W83 C;  3L73 G;  1URQ D;  4ASW A;  2FYN C;  1AVO A;  3OAK A;  1BGY J;  2YFJ A;  3CCV P;  5KAI H;  4I7Z C;  3CWB D;  1RQU A;  3CWB G;  5B66 E;  1L4A B;  2E43 A;  2FXO A;  1GL2 D;  2XDJ A;  1PFI A;  2B1X A;  1VQK P;  2W90 A;  2WQY C;  2YO2 A;  1SQV D;  2E5Y A;  2WPS A;  1SQV G;  1NTK K;  2B87 A;  4RO0 A;  3U59 A;  1FOS E;  2FKW B;  2HR3 A;  1ZRT D;  3H1H E;  1N7S D;  2P58 A;  3TDK A;  5H2F E;  2A06 E;  5AW9 B;  1VQ7 P;  1QL1 A;  3L73 J;  2E76 C;  3IF4 A;  3U1C A;  4HM4 A;  3GG2 A;  2CKF A;  1T3J A;  1BE3 D;  1T3U A;  1BE3 G;  5AEU A;  1YJN P;  2WSC J;  1WRG A;  1EDK A;  3B5N C;  2K1A A;  2LKM A;  1NU1 D;  3L70 D;  1NU1 G;  1DEE G;  2Y0E A;  3L70 G;  3JCU E;  5CJ0 A;  2XSO A;  3L75 D;  2HPC B;  3RBX A;  3L75 G;  4HKZ H;  4KT0 J;  1VPC A;  2O3J A;  2Q3E A;  3WUT A;  4WB4 A;  3FXE A;  2JZA A;  1FAV A;  1QEX A;  5CCH D;  3CCU P;  4LGD E;  4NBE D;  3B8E B;  2C0X A;  1NOH A;  3Q1M A;  4CPG A;  2QJP C;  2GM4 A;  1YTZ T;  1SQP J;  3AE6 C;  2WPV B;  3AED C;  1BE3 J;  1YYC A;  1FZC A;  4HM1 A;  2Y9Z A;  2IBZ D;  5GTI H;  1BCC D;  1KFM A;  1AA0 A;  1BCC G;  2CK3 H;  3L35 A;  1NTZ D;  3H1J D;  4NB9 D;  1NTZ G;  3H1J G;  2G8Y A;  2W8Z A;  2H7H A;  4YPC A;  3PLN A;  1NU1 J;  3L70 J;  1KQL A;  1YQ4 C;  1JY2 P;  4GDO A;  1HTL C;  1G2C B;  4AAY B;  2HFE D;  1BSH A;  3L75 J;  4BWN A;  3H1K E;  4U3F D;  1JY2 O;  3A0H E;  3VN0 A;  4U3F G;  1USD A;  1LJ2 A;  4OGQ C;  1M56 D;  1JB0 J;  2BMO A;  1S72 P;  2C0W A;  4GOD A;  1PGO A;  3TGU J;  1U7J A;  2G3A A;  2YFI A;  3VCA A;  2WSS H;  1RHZ B;  2Z5H A;  1PP9 E;  4IFF A;  3P8C D;  3VTP C;  3HUS A;  2VRS A;  2IBZ I;  3PRJ A;  5AW4 B;  1GK6 A;  1M7L A;  1OWA A;  2OYH B;  3H1J J;  3HE4 A;  1GD2 E;  2WZ7 A;  1J1D C;  1L0L E;  5AW3 B;  3M9H A;  1ZV8 A;  1KMI Z;  4PD4 E;  1HGV A;  1LT9 B;  2P7J A;  3OA7 A;  3CX5 D;  3I55 P;  1GTW A;  3AEF C;  2YMK A;  3GOB A;  3H1I J;  3MUD A;  2WMM A;  3AE2 C;  1HVV A;  2C9N Y;  1OVU A;  2YIU C;  2N1T A;  3D89 A;  2D2C B;  3H1L E;  4NBG D;  3A7O A;  1KB9 H;  1NH4 A;  3RBZ A;  1OVR A;  3VMX A;  5KLI C;  1ZP0 C;  4WY4 A;  3D70 A;  2BEZ F;  1KOR A;  1KQG B;  2FBW C;  1P84 H;  2M8R A;  3A0B H;  4XE5 B;  3CX5 I;  5APQ A;  3AE9 C;  2LR2 A;  2ZJS E;  2MKV A;  2FYU G;  3BAT A;  1KIL E;  2HMJ A;  3AE4 C;  5BOK A;  5HL4 A;  3BCC E;  2YKP A;  3HUS C;  3M91 A;  1NTK D;  4PV1 D;  1LTJ A;  1SVF A;  2K3R A;  3C8V A;  3RK3 C;  1SQQ D;  2H89 C;  1SQV K;  3FX0 A;  1SQQ G;  1FQT A;  4QCK A;  2NVG A;  1EC5 A;  3CXH D;  3HRN A;  3RK2 C;  1JO5 A;  2K9J B;  1M1J B;  3VMA A;  3HD7 B;  1L0L K;  2M3E A;  1NKZ B;  2NPS A;  3OW2 O;  3GLM A;  2HOD A;  5AVW B;  2GUS A;  4QUR A;  1XTG B;  4N6J A;  2ZYD A;  5APY A;  3MUD C;  4HB1 A;  3BAS A;  1FJK A;  5KLV D;  1J1E C;  5KLV G;  2M3B A;  2WSC H;  3GHG C;  4R4L A;  3NXS A;  2E75 B;  1R8E A;  3CC7 P;  2V4H A;  1NTK J;  1FZF A;  2ZVO B;  1LTB C;  5AW1 B;  1X8Y A;  1OFC X;  3GL0 A;  2KOG A;  1L0N D;  3M06 A;  1RF1 A;  3CXH I;  1L0N G;  1JEK A;  4H13 C;  4BXL A;  2BMQ A;  5AVQ B;  1BDD A;  3CD6 P;  2ZXX A;  2JR8 A;  1VF5 B;  4R4M A;  2ZT9 B;  3V5B A;  1K73 Q;  3CCM P;  1S3J A;  1VQP P;  2Q9I A;  1O7N A;  2QJK B;  5KAI E;  2FY8 A;  3CCS P;  2YXQ B;  2ZVN B;  2RKL A;  1E5W A;  4D6T J;  1OXZ A;  5APT A;  1FJP A;  4C7N B;  1NTZ K;  2M0B A;  3HD7 D;  2JP3 A;  4C46 A;  1MUU A;  1OVV A;  2A06 D;  3HE5 B;  3G71 P;  3VP9 A;  2A06 G;  2OYO A;  3SWK A;  2NPS C;  2IPP A;  2KSJ A;  2Q1K A;  1S5L E;  2NVF A;  2BAS A;  1YJ9 P;  2YVJ B;  1PGQ A;  2DE5 D;  5GTH H;  1GL2 B;  4IL6 H;  1USE A;  2I7F A;  1L4A A;  1IFM A;  4GOF A;  3AE1 C;  3SSU A;  1KQS O;  3L72 E;  1IZN B;  3CCJ P;  2LXB A;  1VF5 D;  5AW7 B;  2ZT9 D;  1DD3 A;  2NVE A;  3EQ2 A;  1SFC B;  1Y9B A;  1YJW P;  2Y9Y A;  1IFD A;  2A45 H;  1UII A;  4RES B;  2WPQ A;  3VMY A;  5CBN A;  1D7M A;  1JCC A;  1IK9 A;  2QJY C;  2E4Q A;  2KZJ A;  1N7S C;  2KZI A;  1Q90 D;  2BMR A;  1ZN5 A;  3L37 A;  5BU5 A;  1DH3 A;  3B5N A;  1S2E A;  1SQX E;  4AYC A;  2KSE A;  1SS1 A;  1GU4 A; 
#chains in the Genus database with same CATH homology
 1EG9 A;  2E75 D;  1UUV A;  4QDD A;  2XRX A;  1SJG A;  4EMJ B;  3EQQ A;  3GL2 A;  1KB9 E;  2XR8 A;  1ULI A;  3L75 E;  3GZX A;  4H0L D;  2XSH A;  4QUP A;  4P1B H;  2B1X A;  3CX5 E;  1SQQ E;  3GOB A;  4QUR A;  4HJL A;  4HM1 A;  1VCK A;  3VMH D;  3GTS A;  1ULJ A;  2HML A;  4NBC D;  4HM7 A;  4P1C H;  2NWF A;  1G8J B;  2YIU C;  1O7W A;  3D89 A;  2IBZ E;  2B24 A;  3CXH E;  2JO6 A;  2NVF A;  4NB9 D;  2HMN A;  3H1L E;  4QDF B;  3H1H E;  2YVJ B;  3AZC A;  2HMM A;  2NUK A;  3CWB E;  3H1J E;  1P84 E;  4NBG D;  2Q3W A;  4D6T E;  3N0Q A;  2DE6 D;  1O7H A;  4NB8 D;  2DE5 D;  4AAY B;  2YFL A;  2A06 E;  1BGY E;  4HKV A;  2QJK C;  2I7F A;  3H1K E;  1SQB E;  5KLI C;  3GL0 A;  4HM8 A;  4QUQ A;  1VM9 A;  1SQV E;  1WQL A;  1SQP E;  4HM5 A;  3L74 E;  1O7P A;  4HM4 A;  2CKF A;  3VMG D;  4NBH D;  5AEW A;  1UUW A;  2BCC E;  2BMO A;  1BCC E;  3L72 E;  1Q90 C;  2BMQ A;  4QDC A;  5KLV E;  1VF5 D;  3GZY A;  1NTZ E;  5AEU A;  2E74 D;  1ZRT E;  3H1I E;  2ZT9 D;  3VMI D;  2YFI A;  2DE7 D;  2NVE A;  3GTE A;  4HM0 A;  2ZYL A;  3VCA A;  4QDF A;  4NBA D;  1PP9 E;  3GB4 A;  2GBW A;  1O7N A;  2QPZ A;  2HMJ A;  1NYK A;  4AIV A;  2HMO A;  5BOK A;  4HM3 A;  5HL4 A;  1NU1 E;  2NUM A;  4HM2 A;  3EN1 A;  5KKZ C;  1O7G A;  3BCC E;  4U3F E;  1RIE A;  1L0N E;  2XSO A;  4PV1 D;  4OGQ D;  5CXM A;  2QJY C;  4H13 D;  3VCP A;  2E4Q A;  1RFS A;  2HMK A;  3GCE A;  1NTM E;  3L71 E;  1NTK E;  1G8K B;  1O7M A;  2BMR A;  1KYO E;  3L73 E;  1BE3 E;  1FQT A;  2JZA A;  4NBB D;  4QCK A;  2NVG A;  2FYN C;  3DQY A;  1L0L E;  4NBE D;  4NBD D;  1SQX E;  2D2C D;  2GBX A;  2YFJ A;  2FYU E;  3FOU A;  1PPJ E;  2E4P A;  1JM1 A;  1EZV E;  1NDO A;  4NBF D;  3C0D A;  3TGU E;  2E76 D;  3GKE A;  4PD4 E;  2QJP C;  4H44 D;  3L70 E;  4HM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...