4PD4E

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 44
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4pd4E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4pd4E02
3GL2A 4NBCD 2QJYC 5CXMA 1O7MA 2B24A 4NB9D 3C0DA 4H44D 2IBZE 1NU1E 1SQBE 2QPZA 2GBXA 1NTZE 2B1XA 3L72E 3N0QA 4QCKA 1L0LE 2NVEA 2NVFA 4HM0A 2NUKA 3L70E 1RIEA 2ZYLA 2FYUE 2E74D 2BCCE 4D6TE 1VF5D 2E4QA 1BE3E 4EMJB 1PPJE 3H1IE 1BCCE 4NBHD 1VCKA 4NB8D 2I7FA 2E4PA 2JO6A 2DE7D 4HM3A 1SJGA 3L73E 2JZAA 3H1KE 3VMID 4HM2A 1O7NA 1Q90C 2XRXA 1G8JB 4HM5A 4NBED 4QURA 4PD4E 5KKZC 4H13D 2XSOA 2NUMA 2YIUC 3VMGD 3CXHE 3H1HE 2QJPC 1NYKA 2GBWA 2QJKC 3EQQA 2DE6D 3DQYA 1UUWA 3L71E 2BMQA 2XR8A 4OGQD 1WQLA 1KYOE 5AEUA 3BCCE 2NVGA 2DE5D 1SQQE 5AEWA 4HKVA 4HM4A 1O7GA 3CX5E 4P1CH 2BMRA 5BOKA 1EZVE 1SQVE 4QDCA 1JM1A 2HMNA 2NWFA 4QUQA 5KLIC 3AZCA 2YFIA 2D2CD 5HL4A 3CWBE 2HMJA 4U3FE 4HM7A 1SQPE 2XSHA 1P84E 1ULIA 4NBAD 1KB9E 2CKFA 2FYNC 1RFSA 3H1LE 3GL0A 3GOBA 3GKEA 2HMOA 1PP9E 4HM8A 4P1BH 4PV1D 4QDFA 1NDOA 1UUVA 2HMMA 1FQTA 3D89A 1NTKE 3L74E 3H1JE 3FOUA 3VCPA 4HM6A 3GTSA 4AAYB 4AIVA 2HMLA 4HM1A 4QUPA 1O7HA 1L0NE 1BGYE 4NBFD 1ZRTE 3GZYA 2BMOA 3GCEA 1EG9A 2YFLA 2YFJA 3VMHD 2ZT9D 3GZXA 3L75E 2Q3WA 2HMKA 4NBGD 4HJLA 1SQXE 3GTEA 3TGUE 5KLVE 2E76D 2E75D 4QDDA 1ULJA 4QDFB 1O7WA 1VM9A 3EN1A 1NTME 3GB4A 4NBDD 1G8KB 4NBBD 4H0LD 2A06E 3VCAA 1O7PA 2YVJB
chains in the Genus database with same CATH superfamily
1Q2NA 4WY4A 4WB4A 2E42A 3D6ZA 1RQVA 4H0LB 4H0LC 4NB9D 1UIXA 1OMIA 4C7RA 2QJYB 3RBZA 5KLVK 3A5TA 1HGZA 3B4SA 1OXZA 4ASVA 2OQQA 1RF1A 1SQPG 1JY3P 1SJGA 3VMID 3CWBJ 1NHLA 2NZ2A 1X22A 3CCEP 1J1DB 2WSEH 5APXA 1L2PA 2K88A 2WPQA 4KT0J 1PGQA 1VQMP 4I2LC 2HR3A 4RESB 3CC2P 3CX5E 1QX8A 3II6A 1KILB 3Q3DA 4TLFA 4UB6E 1GW4A 1K9MQ 4U3FE 1GK4A 3AEGC 2QEXP 1N73B 4U7JA 2I1KA 3CPWO 1PGJA 1UUVA 2Q1KA 1HWTC 1Q86Q 1EDIA 1M7LA 1KFNA 3NMDA 5K5GB 4C46A 3VMHD 3N7NA 1L4AD 3T97B 4QDDA 1KB9I 1ULJA 3C9IA 4AQRD 4RJTA 2YMKA 1NTMG 2YVJB 3A0HE 2H88C 1FZAA 3CLQA 3H1KD 1RF1C 5CXMA 3AE8C 1SQPJ 3P7KA 5KLVJ 2YKQA 5AW0B 2ZVOB 2LR2A 2V7QJ 1L0LG 4BXLA 3M9BA 1VQ7P 1SFCC 4NBHD 3L73E 4PV1C 4PD4E 4PJ0H 3GHGC 3TGUD 5CJ4A 5DJTB 5BU5A 1Q7YQ 2AEMA 1NYHA 3G3ZA 1LWUC 1OX3A 3I56P 1RY3A 2KSJA 2HPCB 3QH9A 2ZYGA 4Y99C 3L75J 1PGPA 5APWA 3O6QA 3RL0D 5H2FE 1H8AA 3L73D 5B66E 1OW6A 2AEJA 1QL2A 3A0HH 5BU8B 2O01N 4YXWH 2R32A 4JBZA 1SQPE 2GUVA 3RK2C 3H25A 4QDFA 2M3EA 1K05A 1KD1Q 3H1IJ 2A45G 3IAOA 3GCEA 3HUSB 2Q3WA 4HJLA 1KQGB 2JJLA 5AW8B 2QJKB 2WPRA 2G3AA 2YMYA 3CC7P 4N3YB 3CCSP 2QVAA 1GU4A 4OWFA 1JTHB 2HPCA 2C9LY 1SQVJ 2KP8A 3MZWB 4N78E 2NUKA 1RIEA 3AEAC 1BCCE 2OYIB 1JO5A 2ZYAA 3H1IG 2FXOA 2PP6A 3HD7B 3HD7C 1Q81Q 4EI2A 2OTLP 2GBWA 3CL3D 5B5EE 1JMMA 3L71G 1LTIC 1H0TB 3VOPA 4OGQD 1WQLA 3VMAA 1NTKK 4A7PA 2M0BA 1EXJA 2KNCA 3GG2A 2HMNA 4N78D 5AVXB 3PP5A 2O1JA 4ZKUA 1W2EA 1VQKP 1RE3A 5BVZA 3SFEC 3H1LE 3GHGA 2JO1A 3FOUA 3GF7A 1PPJD 2AXTH 1JNMA 1JEKA 2QJPB 3EQ2A 2I1JA 1Y8AA 1NTKJ 1SQXD 2JR8A 2W6BA 4AYCA 1EZVD 1KYOH 1D7MA 3TGUG 2FXPA 1KV4A 4NBBD 3QWOC 3L36A 4NBCD 2YO2A 4W80A 5AVQB 4HB1A 1X8YA 2GBXA 2A45I 2H89C 1L0LE 2R3SA 3U1CA 3AE5C 5APVA 1VF5D 4EMJB 1FAVA 4XFJA 5CCGC 3KXDA 1BE3D 4JQ0D 1O7NA 1OFCX 1GK6A 3OW2O 3CXHD 3CX5H 3H1JG 1VPCA 2YIUB 3HTKA 2NUMA 3FXEA 1AQTA 3AEDC 1ZOYC 2QJKC 2R5BA 2E5YA 2IFMA 3DQYA 2E76B 5L8RJ 2XR8A 3B71A 2KK7A 3L72G 5AEWA 2CPBA 1KILE 3LIEA 3CD6P 4K35A 3BRVB 3AEBC 4JYCA 1QL1A 3WUVA 3G71P 2Y0CA 4DT0A 3V2QA 2ZFCA 1G1JA 4H44C 3O8ZA 2HMLA 3HD7A 1EG9A 3EFGA 2KI7B 3H1KG 5GTIH 3VMXA 2GA1A 1HTLC 5AVYB 1CI6A 1RF0C 2C0WA 4NPEA 2R5DA 1OZHA 1S5LE 1NAYA 1BGYD 4IFFA 2B24A 2C0XA 1T3JA 4H44D 3OJAB 4U3FD 2OARA 3U1AA 3SFDC 1S9KE 1OIPA 3RK3B 2RMZA 1X0TA 1L0NK 3A7OA 5APTA 4LLHA 2I7FA 1JY3N 4NPDA 2Y0DA 4JF7A 5E79E 4BRYA 2M5AA 2KUBA 1LT9A 4H13D 4KJMA 1RE3C 4BWNA 2FYUJ 1Y47A 2XNDH 1SQVK 3G4SP 1P84H 2YNYA 3V2NA 3L72J 2FYNB 2P2UA 1AVYA 1FDIA 2QSIA 2WSCJ 2DE5D 1BGYJ 3HTKB 2IYPA 1VQ4P 1VQ6P 1SQVE 4QDCA 2LXBA 3CX5D 3B5ND 3V6IA 3O6QB 1R5SA 3PRJA 1NTZD 2ZJSE 4R4LA 1P84E 3D71A 2CKFA 1RE4A 1EQ7A 1FBMA 1HJ0A 1PV3A 1VQLP 3KPEA 4LGDE 2XDJA 1FS0E 1URQB 4AAYB 4AIVA 2H43A 4HM1A 3L35A 3H32A 4OGQC 1ZRTE 3S9OA 2P67A 2W6JH 3AEEC 1IFJA 3K5BA 1MUUA 1LTGC 4O9BA 3AE7C 1GU5A 1GD2E 1VQ5P 5AW6B 4L75A 1Z56A 1DEEG 1L4AA 2PFXA 1FDOA 1ZV8A 1JY3O 2HLOA 2BEQD 3L4FA 1IFMA 4U3FG 1N86A 1XTGB 2OTJP 1SQQG 1BSHA 2WPSA 4L73A 4HYTB 5TISE 3RL0B 3RL0g 1KN7A 3H1HE 3LW5H 1FZGA 1NYKA 1QVGO 1OWAA 3MUDC 2KIKA 1HJBA 4AUWA 2FYUD 3H6PA 3L37A 4D6TD 2JWDA 1NU1G 2HG5D 1ZP0C 2L5GB 3L70J 2BMRA 1EZVI 4GODA 4C7NB 4GKGA 1JB0J 3L75D 1SQVG 1GL2D 3MGNA 4NBAD 2H7HA 1KB9E 1KB9H 2MKVA 2YXRB 3FWLA 5AW1B 1N73A 3KHUA 1NTKG 2VRSA 3GKEA 2JKVA 4H44B 1BGYG 4DJGA 4HM6A 2K9YA 1NJIQ 5AW2B 1IFNA 2YFLA 1ZN5A 3L75E 4NPFX 3M06A 3RGUA 4QDFB 1RH5B 1NU1K 3WMM0 3Q5SA 1URQA 2A06G 2AXCA 3WUUA 2WT7A 2NPSA 1O7MA 2IBZE 2LKMA 2QPZA 3V4QA 2Q3IA 3R2PA 1URQC 1SS1A 2ZYLA 3H1JJ 4GIFA 1X9VA 4IL6H 1M56D 1KYOI 4CPGA 1KILD 3RL0C 3B5NB 5GTHE 4TT3H 2QM8A 1USEA 2CPSA 1NTZK 4QMAA 4LC1A 2FFDA 1GL2A 1FZCC 1KTMA 1AA0A 3M0DA 2P10A 1VQ8P 1SQQE 2YKOA 2N1TD 1Q82Q 1NKZB 3I5CA 3FX0A 3H1HD 1N2DC 1VQPP 4HM7A 3PH0A 2K37A 3L71D 4RO0A 2SPZA 5AVWB 1MZ9A 3NFQA 2Q6QA 3HE4A 3VCPA 2OGUA 2XNXA 1M8OB 4MN4C 1BGYE 1DD3A 1LTBC 2KZIA 3AE4C 1L0LJ 2HMKA 1YHQP 1LTSC 1N7SB 2N1TC 4UB8E 1NTMD 2LXCB 1ZLLA 5KLVG 2E76C 2O3JA 3GB4A 4DZOA 1LP1B 1HGVA 1ZXGA 4M3LA 2N9YB 5APSA 2KLVA 5CCGD 3AE6C 1S2EA 4W7ZA 1N73C 3H1LG 4DCKA 1PL5A 3JCUH 3UIAA 1KILC 3RK3C 2B87A 3RBXA 2BCCD 2HODA 3P32A 4WY4C 3W67A 4GDOA 2WSFH 2IBZI 1NU1D 3AE2C 3TNUB 4ASWA 1IJDB 2XSOA 2AXTE 3GMAA 5CCHD 1RF1B 2DE6D 1LP1A 1SQQJ 3G6EP 1OVUA 1NKNA 1TU3F 5AVZB 5CHXA 4ZNCA 2IZ0A 3IN6A 1ZMEC 1LTJA 3M0DC 5AW4B 3MD0A 2NPSB 1NTZJ 2B89A 1MKMA 5KJ7D 3HE4B 1OW8A 1OW7A 4WY4B 2XSHA 2B9BA 1M1JA 1GTWA 1G1IA 2E43A 4ZKPA 2FKWB 3L74D 2HMOA 4HM8A 1SFCB 4Y28J 1BCCJ 4R4MA 1X79B 3PJSK 3D89A 2JDIH 1SQQK 3H1JE 3GTSA 2OTKE 2POHA 5AW9B 4QUPA 1GL2C 3AE9C 1HBWA 4Y99B 4XA4A 1SQXE 3SWYA 1YJ9P 3HD7D 3WU2H 1NTME 3HUSA 2K9JA 1FOSE 2FYNC 1MV8A 1HUCA 2NPSC 1T3UA 2MJZA 3KYQA 4N6JA 4QCKA 2E74B 2NVEA 1NTZG 3BRTB 2GM4A 1T2KD 4D6TE 3TSIA 1FOSF 1E5WA 1SQBJ 3L73G 1VCKA 1BE3G 3M9HA 1BCCG 2IX7C 2JZAA 3VYIA 3H1KE 4NBED 2ZVNB 1J1DC 2WT7B 4IL6X 3A2AA 1EXIA 3IFMA 1LT9C 3BCCG 3L71E 1PIXA 2ZYDA 2N1TB 2J5UA 2NVGA 1HH0A 1ZW0A 3WU2E 3G9RA 3P8CE 5BOKA 1HF9A 3FXDA 1U57A 1YBKA 3MUDA 1YQ4C 2B87B 2KS1A 4PJ0E 2YXQB 3R4YA 1GDTA 1BCCD 2KSEA 3IF4A 3H1JD 3C8VA 1JUNA 3TGUJ 3GLMA 5KJ7C 2N9BA 2P1JA 5KLVE 1JY2N 5M1BA 3VN0A 1N7LA 2OYHB 1SQPD 2PRRA 1VM9A 3EN1A 2QM7A 3VCAA 1O7PA 1Q90D 2A45H 4OVNF 3V2PA 4H13B 3CCRP 1KYOD 2QIWA 4HKZH 1SQBG 3C0DA 1NU1E 2M5AB 1Y9BA 4L74A 5KLIB 3V4WA 1YTZI 4H13C 2W8ZA 1BDCA 5EFWB 2BCCG 3HE5B 2KB7P 2E74D 2Q7CA 4WY4D 1DX7A 3H1HJ 1PPJE 1AJYA 2E4PA 1A02F 3D6YA 3RK3D 3ITKA 4EOTA 3VMGD 1M1JC 3CWBD 2OYOA 3B5NC 1QEXA 3MIWA 2JWAA 1LWUB 3Q2YA 2N1TA 2M3BA 3D70A 3CCLP 3SSUA 2P58A 4HKVA 3RK3E 5B66H 2E5TA 2J59M 2O1KA 3USSA 1AV1A 2UWJE 2IZ1A 3CWBE 2HMJA 2IBZG 1JY2O 1GZLA 2WSFJ 3RK2B 5GTHH 1FZFA 1NGMB 2RKLA 1FQTA 3H1HG 4NBFD 1SFCD 3L72D 3TGUE 3P8MC 5H2FH 1IFDA 1O7WA 3HUSC 3U59A 2Q5UA 4YPCA 3ABVC 3PLNA 1JCCA 3M9QA 3L73J 1USDA 1UIIA 3L72E 5KLVD 2ZT9B 3GW6A 1EDJA 1FC2C 3Q5RA 5CCGA 1L4AB 1S5LX 2FYUE 1YTZT 4IL6E 4NB8D 1CI6B 1PP9J 1P84I 3BVHA 1IK9A 1SFCA 4HM5A 1URQD 3KZIH 1XTCC 1WRGA 2QRXA 2OYHA 1NAFA 3CXHE 1L0LK 2QJPC 3KDPB 5CMZA 1M90Q 3EQQA 3MTUE 1YJWP 3AE1C 5AEUA 4K3AA 1VQNP 1L0NJ 2QG4A 3JC22 1ZRTD 1VDFA 3CXHH 1FZCA 1M57D 1KORA 3E1RA 4BRYB 4WVZA 2XU6A 1SVFA 3F5HA 3CWBG 4U3FJ 2PGDA 1KILA 2XV5A 1NTKD 1SQXJ 3HRNA 4P1BH 1IFPA 1LWUA 1PP9D 1NTMJ 1O7HA 4PV1B 2E75B 3CCJP 1FJKA 1T8ZA 3S1KA 3CC4P 4GOEA 5C39A 5AW5B 1NO4A 5APUA 2Q3EA 3NXSA 3B8EB 2Q9IA 2KZJA 2IYOA 3AE3C 1YITP 2K3RA 1FZEA 3GL2A 1S1CX 2L91A 2Z4EA 3NTNA 1MFTA 3CCUP 2RH0A 2WMMA 2B1XA 3N0QA 3VMZA 1JOCA 2NVFA 1S4XA 2B88A 2IFNA 4JYBA 1MFZA 2V4HA 2E4QA 1LTJB 3EWKA 3VMYA 2YO3A 2W6AA 2Y9YA 5AW3B 2K1AA 1LNQA 1SQQD 3CI9A 1RHZB 1W5CE 4IOIH 3VP9A 1U7JA 1N7SC 1DD4A 3EFFK 1YIJP 5B5EH 1UUWA 5AVSB 2BMQA 1LTAC 1U7MA 2Z5HA 4HM4A 1M1KQ 3L74J 1EZVE 3TYYA 2NWFA 2R3CA 2H8PD 2FYUG 1LT1A 2D2CD 1S9KD 1NH4A 2R44A 1RFSA 1P84D 1KQSO 1WMKA 3TK1A 1NTKE 2GUSA 2WPVB 3L70G 3L74E 1L0NG 3RK2D 3BCCD 1FJPA 1FU1A 2BMOA 5AVVB 1VQ9P 1YJNP 1PFIA 5AW7B 1LGHB 1N7SA 1NOHA 2E75D 1NVOA 2FBWC 1KC8Q 2E75C 1QLED 2WVRA 3VP8A 4OH8B 4UB6H 3CXHI 1KZUB 1WT6A 1H88A 1VL2A 2DW3A 1A02J 1QVFO 2I8DA 2W90A 3GF3A 3L70D 4HM0A 4I1LA 1BDDA 1LJ2A 2D2CC 4KHXA 3H1IE 2JO6A 1YI2P 2WWWA 1SQXG 1GL2B 2KOGA 1VQOP 1K04A 1IZNB 3SWFA 1RQUA 1N7SD 2PAJA 1R5LA 3PHLA 1J2JB 2IBZD 3E1IA 1GW3A 5HL4A 5KTBA 3F89A 2OYIA 5CBNA 1DIPA 3BATA 4PV1D 1OVRA 2HMMA 2FFDC 4WWIA 1L0NE 1KQLA 4OGQB 1AFOA 2FYUK 3BCCJ 1IO4A 3LW5J 5AVUB 3WUTA 4GT1A 1FE6A 3FWNA 1KB9D 2HFED 3H1LD 2FYZA 2RN0A 2ZXEB 4NBDD 1N8RQ 1G8KB 1DH3A 2BEZF 2A06E 1R8EA 3CCMP 3AECC 1JTHA 2KNCB 2XZRA 3MHVA 3KZIE 3I55P 2IPPA 1L4AC 3L74G 3L70E 4RKUJ 1LTTC 2W83C 4B86A 3T97A 1VF5C 4I7ZB 4UB8H 2WTYA 4PD4H 5AVTB 3BASA 3VTPC 4XE5B 5CCHC 2AEFA 5CJ0A 3TF5A 1H0TA 1GMJA 1SP4A 1LT9B 1RE4C 2KLUA 1NWQA 1FZBA 3OA7A 1J1EC 2IDBA 2O01H 5CBOA 3P8CD 1G2CA 1KMIZ 1EZVG 1FDMA 4DOJA 1CSBA 2BASA 2CK3H 2ZT9C 1PPJG 3CCQP 1VF5B 2Z5IA 1ULIA 2KS1B 4EYYQ 1JM0A 2OYIC 1PP9G 3CMEP 3IR9A 3N4XA 2WITA 4I6MC 3GZYA 4WBAA 5KKZB 2C9NY 3CX5I 2YFJA 2WSCH 5DJUB 1CZQA 5TJHA 4NBGD 2ZAEB 3M0AA 4Z1MH 2E76D 2WQYC 3OAKA 5AVRB 4JPZB 1RF0A 4H0LD 2QA4P 3SWKA 2Y9ZA 5KAFE 5KAIH 1H89A 1L0ND 4PD4D 2NRGA 3ZDMA 1HVVA 1SQPK 3V5BA 1T6AA 2KXPB 2WSEJ 3JSVC 2D2CB 5KJ7A 2WZ7A 4EIJA 2Y0EA 2P7JA 4IFMA 2A06D 2ITAA 1NU1J 4L76A 3PTZA 4HM2A 3MP7B 1Q90C 4QURA 1NTMK 2YIUC 4HJGH 1E79H 1SQXK 2KYVA 1SQBK 3H1KJ 2K9JB 1CW5A 4EDFA 1ZR2A 1W2BO 2G8YA 3BCCE 4D6TJ 4P1CH 1PGOA 1EC5A 1EDKA 5KAIE 5KAFH 4QUQA 3AZCA 2YFIA 2E74C 1SQVD 3A3YB 1S72P 1YQ3C 4C7NA 1IK7A 3C1LA 1BSNA 1BE3J 3H1ID 1S5LH 4D6TG 1JMBA 1EDLA 1IC2A 4HH2A 5TISH 4PD4I 1KQFB 3TNUA 1SQBD 3GZXA 3L71J 1K73Q 3LIDA 3Q5PA 2YKPA 4W7YA 2HODB 2QE7H 3AEFC 4IFDK 2M8RA 1J1EB 3FGAD 3S4RA 2QJYC 2FXMA 2J58A 1SQBE 3B5NA 1NTZE 1ZR4A 3JCUE 4I7ZC 2BCCE 3W68A 2JEEA 1BE3E 2WSSH 2DE7D 4YTPC 3L75G 4HM3A 1OVVA 2NPSD 2FY8A 3A0BH 1G8JB 2XRXA 5KKZC 3TDKA 1QGKB 1K8AQ 2BCCJ 5CCHA 2HYNA 3M91A 2OYHC 5APQA 1M1JB 2W27A 3H32B 1KYOE 1YYCA 3A0BE 1SLQA 3Q1MA 2XKMA 1AQ5A 1O7GA 1S3JA 1JCDA 1JM1A 4GOFA 1AVOA 5KLIC 3CMAP 1T2KC 1KFMA 1PZQA 1JY2P 2ZXXA 1DEBA 3GL0A 3GOBA 1LTJC 4YXDC 1PP9E 3CCVP 2FFDB 1NDOA 1IFIA 2V7QH 3V2RA 3GHGB 2ZT9D 3HE5A 2JP3A 2O01J 3KQGA 1L0LD 5GTIE 1G2CB 5APYA 3GTEA 3H1LJ 5E79H 1FZCB 3E7KA 4ZMDA
chains in the Genus database with same CATH topology
3GL2A 4NBCD 2QJYC 5CXMA 1O7MA 2B24A 4NB9D 3C0DA 4H44D 2IBZE 1NU1E 1SQBE 2QPZA 2GBXA 1NTZE 2B1XA 3L72E 3N0QA 4QCKA 1L0LE 2NVEA 2NVFA 4HM0A 2NUKA 3L70E 1RIEA 2ZYLA 2FYUE 2E74D 2BCCE 4D6TE 1VF5D 2E4QA 1BE3E 4EMJB 1PPJE 3H1IE 1BCCE 4NBHD 1VCKA 4NB8D 2I7FA 2E4PA 2JO6A 2DE7D 4HM3A 1SJGA 3L73E 2JZAA 3H1KE 3VMID 4HM2A 1O7NA 1Q90C 2XRXA 1G8JB 4HM5A 4NBED 4QURA 4PD4E 5KKZC 4H13D 2XSOA 2NUMA 2YIUC 3VMGD 3CXHE 3H1HE 2QJPC 1NYKA 2GBWA 2QJKC 3EQQA 2DE6D 3DQYA 1UUWA 3L71E 2BMQA 2XR8A 4OGQD 1WQLA 1KYOE 5AEUA 3BCCE 2NVGA 2DE5D 1SQQE 5AEWA 4HKVA 4HM4A 1O7GA 3CX5E 4P1CH 2BMRA 5BOKA 1EZVE 1SQVE 4QDCA 1JM1A 2HMNA 2NWFA 4QUQA 5KLIC 3AZCA 2YFIA 2D2CD 5HL4A 3CWBE 2HMJA 4U3FE 4HM7A 1SQPE 2XSHA 1P84E 1ULIA 4NBAD 1KB9E 2CKFA 2FYNC 1RFSA 3H1LE 3GL0A 3GOBA 3GKEA 2HMOA 1PP9E 4HM8A 4P1BH 4PV1D 4QDFA 1NDOA 1UUVA 2HMMA 1FQTA 3D89A 1NTKE 3L74E 3H1JE 3FOUA 3VCPA 4HM6A 3GTSA 4AAYB 4AIVA 2HMLA 4HM1A 4QUPA 1O7HA 1L0NE 1BGYE 4NBFD 1ZRTE 3GZYA 2BMOA 3GCEA 1EG9A 2YFLA 2YFJA 3VMHD 2ZT9D 3GZXA 3L75E 2Q3WA 2HMKA 4NBGD 4HJLA 1SQXE 3GTEA 3TGUE 5KLVE 2E76D 2E75D 4QDDA 1ULJA 4QDFB 1O7WA 1VM9A 3EN1A 1NTME 3GB4A 4NBDD 1G8KB 4NBBD 4H0LD 2A06E 3VCAA 1O7PA 2YVJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL2 A;  4NBC D;  2QJY C;  5CXM A;  1O7M A;  2B24 A;  4NB9 D;  3C0D A;  4H44 D;  2IBZ E;  1NU1 E;  1SQB E;  2QPZ A;  2GBX A;  1NTZ E;  2B1X A;  3L72 E;  3N0Q A;  4QCK A;  1L0L E;  2NVE A;  2NVF A;  4HM0 A;  2NUK A;  3L70 E;  1RIE A;  2ZYL A;  2FYU E;  2E74 D;  2BCC E;  4D6T E;  1VF5 D;  2E4Q A;  1BE3 E;  4EMJ B;  1PPJ E;  3H1I E;  1BCC E;  4NBH D;  1VCK A;  4NB8 D;  2I7F A;  2E4P A;  2JO6 A;  2DE7 D;  4HM3 A;  1SJG A;  3L73 E;  2JZA A;  3H1K E;  3VMI D;  4HM2 A;  1O7N A;  1Q90 C;  2XRX A;  1G8J B;  4HM5 A;  4NBE D;  4QUR A;  4PD4 E;  5KKZ C;  4H13 D;  2XSO A;  2NUM A;  2YIU C;  3VMG D;  3CXH E;  3H1H E;  2QJP C;  1NYK A;  2GBW A;  2QJK C;  3EQQ A;  2DE6 D;  3DQY A;  1UUW A;  3L71 E;  2BMQ A;  2XR8 A;  4OGQ D;  1WQL A;  1KYO E;  5AEU A;  3BCC E;  2NVG A;  2DE5 D;  1SQQ E;  5AEW A;  4HKV A;  4HM4 A;  1O7G A;  3CX5 E;  4P1C H;  2BMR A;  5BOK A;  1EZV E;  1SQV E;  4QDC A;  1JM1 A;  2HMN A;  2NWF A;  4QUQ A;  5KLI C;  3AZC A;  2YFI A;  2D2C D;  5HL4 A;  3CWB E;  2HMJ A;  4U3F E;  4HM7 A;  1SQP E;  2XSH A;  1P84 E;  1ULI A;  4NBA D;  1KB9 E;  2CKF A;  2FYN C;  1RFS A;  3H1L E;  3GL0 A;  3GOB A;  3GKE A;  2HMO A;  1PP9 E;  4HM8 A;  4P1B H;  4PV1 D;  4QDF A;  1NDO A;  1UUV A;  2HMM A;  1FQT A;  3D89 A;  1NTK E;  3L74 E;  3H1J E;  3FOU A;  3VCP A;  4HM6 A;  3GTS A;  4AAY B;  4AIV A;  2HML A;  4HM1 A;  4QUP A;  1O7H A;  1L0N E;  1BGY E;  4NBF D;  1ZRT E;  3GZY A;  2BMO A;  3GCE A;  1EG9 A;  2YFL A;  2YFJ A;  3VMH D;  2ZT9 D;  3GZX A;  3L75 E;  2Q3W A;  2HMK A;  4NBG D;  4HJL A;  1SQX E;  3GTE A;  3TGU E;  5KLV E;  2E76 D;  2E75 D;  4QDD A;  1ULJ A;  4QDF B;  1O7W A;  1VM9 A;  3EN1 A;  1NTM E;  3GB4 A;  4NBD D;  1G8K B;  4NBB D;  4H0L D;  2A06 E;  3VCA A;  1O7P A;  2YVJ B; 
#chains in the Genus database with same CATH topology
 1Q2N A;  4WY4 A;  4WB4 A;  2E42 A;  3D6Z A;  1RQV A;  4H0L B;  4H0L C;  4NB9 D;  1UIX A;  1OMI A;  4C7R A;  2QJY B;  3RBZ A;  5KLV K;  3A5T A;  1HGZ A;  3B4S A;  1OXZ A;  4ASV A;  2OQQ A;  1RF1 A;  1SQP G;  1JY3 P;  1SJG A;  3VMI D;  3CWB J;  1NHL A;  2NZ2 A;  1X22 A;  3CCE P;  1J1D B;  2WSE H;  5APX A;  1L2P A;  2K88 A;  2WPQ A;  4KT0 J;  1PGQ A;  1VQM P;  4I2L C;  2HR3 A;  4RES B;  3CC2 P;  3CX5 E;  1QX8 A;  3II6 A;  1KIL B;  3Q3D A;  4TLF A;  4UB6 E;  1GW4 A;  1K9M Q;  4U3F E;  1GK4 A;  3AEG C;  2QEX P;  1N73 B;  4U7J A;  2I1K A;  3CPW O;  1PGJ A;  1UUV A;  2Q1K A;  1HWT C;  1Q86 Q;  1EDI A;  1M7L A;  1KFN A;  3NMD A;  5K5G B;  4C46 A;  3VMH D;  3N7N A;  1L4A D;  3T97 B;  4QDD A;  1KB9 I;  1ULJ A;  3C9I A;  4AQR D;  4RJT A;  2YMK A;  1NTM G;  2YVJ B;  3A0H E;  2H88 C;  1FZA A;  3CLQ A;  3H1K D;  1RF1 C;  5CXM A;  3AE8 C;  1SQP J;  3P7K A;  5KLV J;  2YKQ A;  5AW0 B;  2ZVO B;  2LR2 A;  2V7Q J;  1L0L G;  4BXL A;  3M9B A;  1VQ7 P;  1SFC C;  4NBH D;  3L73 E;  4PV1 C;  4PD4 E;  4PJ0 H;  3GHG C;  3TGU D;  5CJ4 A;  5DJT B;  5BU5 A;  1Q7Y Q;  2AEM A;  1NYH A;  3G3Z A;  1LWU C;  1OX3 A;  3I56 P;  1RY3 A;  2KSJ A;  2HPC B;  3QH9 A;  2ZYG A;  4Y99 C;  3L75 J;  1PGP A;  5APW A;  3O6Q A;  3RL0 D;  5H2F E;  1H8A A;  3L73 D;  5B66 E;  1OW6 A;  2AEJ A;  1QL2 A;  3A0H H;  5BU8 B;  2O01 N;  4YXW H;  2R32 A;  4JBZ A;  1SQP E;  2GUV A;  3RK2 C;  3H25 A;  4QDF A;  2M3E A;  1K05 A;  1KD1 Q;  3H1I J;  2A45 G;  3IAO A;  3GCE A;  3HUS B;  2Q3W A;  4HJL A;  1KQG B;  2JJL A;  5AW8 B;  2QJK B;  2WPR A;  2G3A A;  2YMY A;  3CC7 P;  4N3Y B;  3CCS P;  2QVA A;  1GU4 A;  4OWF A;  1JTH B;  2HPC A;  2C9L Y;  1SQV J;  2KP8 A;  3MZW B;  4N78 E;  2NUK A;  1RIE A;  3AEA C;  1BCC E;  2OYI B;  1JO5 A;  2ZYA A;  3H1I G;  2FXO A;  2PP6 A;  3HD7 B;  3HD7 C;  1Q81 Q;  4EI2 A;  2OTL P;  2GBW A;  3CL3 D;  5B5E E;  1JMM A;  3L71 G;  1LTI C;  1H0T B;  3VOP A;  4OGQ D;  1WQL A;  3VMA A;  1NTK K;  4A7P A;  2M0B A;  1EXJ A;  2KNC A;  3GG2 A;  2HMN A;  4N78 D;  5AVX B;  3PP5 A;  2O1J A;  4ZKU A;  1W2E A;  1VQK P;  1RE3 A;  5BVZ A;  3SFE C;  3H1L E;  3GHG A;  2JO1 A;  3FOU A;  3GF7 A;  1PPJ D;  2AXT H;  1JNM A;  1JEK A;  2QJP B;  3EQ2 A;  2I1J A;  1Y8A A;  1NTK J;  1SQX D;  2JR8 A;  2W6B A;  4AYC A;  1EZV D;  1KYO H;  1D7M A;  3TGU G;  2FXP A;  1KV4 A;  4NBB D;  3QWO C;  3L36 A;  4NBC D;  2YO2 A;  4W80 A;  5AVQ B;  4HB1 A;  1X8Y A;  2GBX A;  2A45 I;  2H89 C;  1L0L E;  2R3S A;  3U1C A;  3AE5 C;  5APV A;  1VF5 D;  4EMJ B;  1FAV A;  4XFJ A;  5CCG C;  3KXD A;  1BE3 D;  4JQ0 D;  1O7N A;  1OFC X;  1GK6 A;  3OW2 O;  3CXH D;  3CX5 H;  3H1J G;  1VPC A;  2YIU B;  3HTK A;  2NUM A;  3FXE A;  1AQT A;  3AED C;  1ZOY C;  2QJK C;  2R5B A;  2E5Y A;  2IFM A;  3DQY A;  2E76 B;  5L8R J;  2XR8 A;  3B71 A;  2KK7 A;  3L72 G;  5AEW A;  2CPB A;  1KIL E;  3LIE A;  3CD6 P;  4K35 A;  3BRV B;  3AEB C;  4JYC A;  1QL1 A;  3WUV A;  3G71 P;  2Y0C A;  4DT0 A;  3V2Q A;  2ZFC A;  1G1J A;  4H44 C;  3O8Z A;  2HML A;  3HD7 A;  1EG9 A;  3EFG A;  2KI7 B;  3H1K G;  5GTI H;  3VMX A;  2GA1 A;  1HTL C;  5AVY B;  1CI6 A;  1RF0 C;  2C0W A;  4NPE A;  2R5D A;  1OZH A;  1S5L E;  1NAY A;  1BGY D;  4IFF A;  2B24 A;  2C0X A;  1T3J A;  4H44 D;  3OJA B;  4U3F D;  2OAR A;  3U1A A;  3SFD C;  1S9K E;  1OIP A;  3RK3 B;  2RMZ A;  1X0T A;  1L0N K;  3A7O A;  5APT A;  4LLH A;  2I7F A;  1JY3 N;  4NPD A;  2Y0D A;  4JF7 A;  5E79 E;  4BRY A;  2M5A A;  2KUB A;  1LT9 A;  4H13 D;  4KJM A;  1RE3 C;  4BWN A;  2FYU J;  1Y47 A;  2XND H;  1SQV K;  3G4S P;  1P84 H;  2YNY A;  3V2N A;  3L72 J;  2FYN B;  2P2U A;  1AVY A;  1FDI A;  2QSI A;  2WSC J;  2DE5 D;  1BGY J;  3HTK B;  2IYP A;  1VQ4 P;  1VQ6 P;  1SQV E;  4QDC A;  2LXB A;  3CX5 D;  3B5N D;  3V6I A;  3O6Q B;  1R5S A;  3PRJ A;  1NTZ D;  2ZJS E;  4R4L A;  1P84 E;  3D71 A;  2CKF A;  1RE4 A;  1EQ7 A;  1FBM A;  1HJ0 A;  1PV3 A;  1VQL P;  3KPE A;  4LGD E;  2XDJ A;  1FS0 E;  1URQ B;  4AAY B;  4AIV A;  2H43 A;  4HM1 A;  3L35 A;  3H32 A;  4OGQ C;  1ZRT E;  3S9O A;  2P67 A;  2W6J H;  3AEE C;  1IFJ A;  3K5B A;  1MUU A;  1LTG C;  4O9B A;  3AE7 C;  1GU5 A;  1GD2 E;  1VQ5 P;  5AW6 B;  4L75 A;  1Z56 A;  1DEE G;  1L4A A;  2PFX A;  1FDO A;  1ZV8 A;  1JY3 O;  2HLO A;  2BEQ D;  3L4F A;  1IFM A;  4U3F G;  1N86 A;  1XTG B;  2OTJ P;  1SQQ G;  1BSH A;  2WPS A;  4L73 A;  4HYT B;  5TIS E;  3RL0 B;  3RL0 g;  1KN7 A;  3H1H E;  3LW5 H;  1FZG A;  1NYK A;  1QVG O;  1OWA A;  3MUD C;  2KIK A;  1HJB A;  4AUW A;  2FYU D;  3H6P A;  3L37 A;  4D6T D;  2JWD A;  1NU1 G;  2HG5 D;  1ZP0 C;  2L5G B;  3L70 J;  2BMR A;  1EZV I;  4GOD A;  4C7N B;  4GKG A;  1JB0 J;  3L75 D;  1SQV G;  1GL2 D;  3MGN A;  4NBA D;  2H7H A;  1KB9 E;  1KB9 H;  2MKV A;  2YXR B;  3FWL A;  5AW1 B;  1N73 A;  3KHU A;  1NTK G;  2VRS A;  3GKE A;  2JKV A;  4H44 B;  1BGY G;  4DJG A;  4HM6 A;  2K9Y A;  1NJI Q;  5AW2 B;  1IFN A;  2YFL A;  1ZN5 A;  3L75 E;  4NPF X;  3M06 A;  3RGU A;  4QDF B;  1RH5 B;  1NU1 K;  3WMM 0;  3Q5S A;  1URQ A;  2A06 G;  2AXC A;  3WUU A;  2WT7 A;  2NPS A;  1O7M A;  2IBZ E;  2LKM A;  2QPZ A;  3V4Q A;  2Q3I A;  3R2P A;  1URQ C;  1SS1 A;  2ZYL A;  3H1J J;  4GIF A;  1X9V A;  4IL6 H;  1M56 D;  1KYO I;  4CPG A;  1KIL D;  3RL0 C;  3B5N B;  5GTH E;  4TT3 H;  2QM8 A;  1USE A;  2CPS A;  1NTZ K;  4QMA A;  4LC1 A;  2FFD A;  1GL2 A;  1FZC C;  1KTM A;  1AA0 A;  3M0D A;  2P10 A;  1VQ8 P;  1SQQ E;  2YKO A;  2N1T D;  1Q82 Q;  1NKZ B;  3I5C A;  3FX0 A;  3H1H D;  1N2D C;  1VQP P;  4HM7 A;  3PH0 A;  2K37 A;  3L71 D;  4RO0 A;  2SPZ A;  5AVW B;  1MZ9 A;  3NFQ A;  2Q6Q A;  3HE4 A;  3VCP A;  2OGU A;  2XNX A;  1M8O B;  4MN4 C;  1BGY E;  1DD3 A;  1LTB C;  2KZI A;  3AE4 C;  1L0L J;  2HMK A;  1YHQ P;  1LTS C;  1N7S B;  2N1T C;  4UB8 E;  1NTM D;  2LXC B;  1ZLL A;  5KLV G;  2E76 C;  2O3J A;  3GB4 A;  4DZO A;  1LP1 B;  1HGV A;  1ZXG A;  4M3L A;  2N9Y B;  5APS A;  2KLV A;  5CCG D;  3AE6 C;  1S2E A;  4W7Z A;  1N73 C;  3H1L G;  4DCK A;  1PL5 A;  3JCU H;  3UIA A;  1KIL C;  3RK3 C;  2B87 A;  3RBX A;  2BCC D;  2HOD A;  3P32 A;  4WY4 C;  3W67 A;  4GDO A;  2WSF H;  2IBZ I;  1NU1 D;  3AE2 C;  3TNU B;  4ASW A;  1IJD B;  2XSO A;  2AXT E;  3GMA A;  5CCH D;  1RF1 B;  2DE6 D;  1LP1 A;  1SQQ J;  3G6E P;  1OVU A;  1NKN A;  1TU3 F;  5AVZ B;  5CHX A;  4ZNC A;  2IZ0 A;  3IN6 A;  1ZME C;  1LTJ A;  3M0D C;  5AW4 B;  3MD0 A;  2NPS B;  1NTZ J;  2B89 A;  1MKM A;  5KJ7 D;  3HE4 B;  1OW8 A;  1OW7 A;  4WY4 B;  2XSH A;  2B9B A;  1M1J A;  1GTW A;  1G1I A;  2E43 A;  4ZKP A;  2FKW B;  3L74 D;  2HMO A;  4HM8 A;  1SFC B;  4Y28 J;  1BCC J;  4R4M A;  1X79 B;  3PJS K;  3D89 A;  2JDI H;  1SQQ K;  3H1J E;  3GTS A;  2OTK E;  2POH A;  5AW9 B;  4QUP A;  1GL2 C;  3AE9 C;  1HBW A;  4Y99 B;  4XA4 A;  1SQX E;  3SWY A;  1YJ9 P;  3HD7 D;  3WU2 H;  1NTM E;  3HUS A;  2K9J A;  1FOS E;  2FYN C;  1MV8 A;  1HUC A;  2NPS C;  1T3U A;  2MJZ A;  3KYQ A;  4N6J A;  4QCK A;  2E74 B;  2NVE A;  1NTZ G;  3BRT B;  2GM4 A;  1T2K D;  4D6T E;  3TSI A;  1FOS F;  1E5W A;  1SQB J;  3L73 G;  1VCK A;  1BE3 G;  3M9H A;  1BCC G;  2IX7 C;  2JZA A;  3VYI A;  3H1K E;  4NBE D;  2ZVN B;  1J1D C;  2WT7 B;  4IL6 X;  3A2A A;  1EXI A;  3IFM A;  1LT9 C;  3BCC G;  3L71 E;  1PIX A;  2ZYD A;  2N1T B;  2J5U A;  2NVG A;  1HH0 A;  1ZW0 A;  3WU2 E;  3G9R A;  3P8C E;  5BOK A;  1HF9 A;  3FXD A;  1U57 A;  1YBK A;  3MUD A;  1YQ4 C;  2B87 B;  2KS1 A;  4PJ0 E;  2YXQ B;  3R4Y A;  1GDT A;  1BCC D;  2KSE A;  3IF4 A;  3H1J D;  3C8V A;  1JUN A;  3TGU J;  3GLM A;  5KJ7 C;  2N9B A;  2P1J A;  5KLV E;  1JY2 N;  5M1B A;  3VN0 A;  1N7L A;  2OYH B;  1SQP D;  2PRR A;  1VM9 A;  3EN1 A;  2QM7 A;  3VCA A;  1O7P A;  1Q90 D;  2A45 H;  4OVN F;  3V2P A;  4H13 B;  3CCR P;  1KYO D;  2QIW A;  4HKZ H;  1SQB G;  3C0D A;  1NU1 E;  2M5A B;  1Y9B A;  4L74 A;  5KLI B;  3V4W A;  1YTZ I;  4H13 C;  2W8Z A;  1BDC A;  5EFW B;  2BCC G;  3HE5 B;  2KB7 P;  2E74 D;  2Q7C A;  4WY4 D;  1DX7 A;  3H1H J;  1PPJ E;  1AJY A;  2E4P A;  1A02 F;  3D6Y A;  3RK3 D;  3ITK A;  4EOT A;  3VMG D;  1M1J C;  3CWB D;  2OYO A;  3B5N C;  1QEX A;  3MIW A;  2JWA A;  1LWU B;  3Q2Y A;  2N1T A;  2M3B A;  3D70 A;  3CCL P;  3SSU A;  2P58 A;  4HKV A;  3RK3 E;  5B66 H;  2E5T A;  2J59 M;  2O1K A;  3USS A;  1AV1 A;  2UWJ E;  2IZ1 A;  3CWB E;  2HMJ A;  2IBZ G;  1JY2 O;  1GZL A;  2WSF J;  3RK2 B;  5GTH H;  1FZF A;  1NGM B;  2RKL A;  1FQT A;  3H1H G;  4NBF D;  1SFC D;  3L72 D;  3TGU E;  3P8M C;  5H2F H;  1IFD A;  1O7W A;  3HUS C;  3U59 A;  2Q5U A;  4YPC A;  3ABV C;  3PLN A;  1JCC A;  3M9Q A;  3L73 J;  1USD A;  1UII A;  3L72 E;  5KLV D;  2ZT9 B;  3GW6 A;  1EDJ A;  1FC2 C;  3Q5R A;  5CCG A;  1L4A B;  1S5L X;  2FYU E;  1YTZ T;  4IL6 E;  4NB8 D;  1CI6 B;  1PP9 J;  1P84 I;  3BVH A;  1IK9 A;  1SFC A;  4HM5 A;  1URQ D;  3KZI H;  1XTC C;  1WRG A;  2QRX A;  2OYH A;  1NAF A;  3CXH E;  1L0L K;  2QJP C;  3KDP B;  5CMZ A;  1M90 Q;  3EQQ A;  3MTU E;  1YJW P;  3AE1 C;  5AEU A;  4K3A A;  1VQN P;  1L0N J;  2QG4 A;  3JC2 2;  1ZRT D;  1VDF A;  3CXH H;  1FZC A;  1M57 D;  1KOR A;  3E1R A;  4BRY B;  4WVZ A;  2XU6 A;  1SVF A;  3F5H A;  3CWB G;  4U3F J;  2PGD A;  1KIL A;  2XV5 A;  1NTK D;  1SQX J;  3HRN A;  4P1B H;  1IFP A;  1LWU A;  1PP9 D;  1NTM J;  1O7H A;  4PV1 B;  2E75 B;  3CCJ P;  1FJK A;  1T8Z A;  3S1K A;  3CC4 P;  4GOE A;  5C39 A;  5AW5 B;  1NO4 A;  5APU A;  2Q3E A;  3NXS A;  3B8E B;  2Q9I A;  2KZJ A;  2IYO A;  3AE3 C;  1YIT P;  2K3R A;  1FZE A;  3GL2 A;  1S1C X;  2L91 A;  2Z4E A;  3NTN A;  1MFT A;  3CCU P;  2RH0 A;  2WMM A;  2B1X A;  3N0Q A;  3VMZ A;  1JOC A;  2NVF A;  1S4X A;  2B88 A;  2IFN A;  4JYB A;  1MFZ A;  2V4H A;  2E4Q A;  1LTJ B;  3EWK A;  3VMY A;  2YO3 A;  2W6A A;  2Y9Y A;  5AW3 B;  2K1A A;  1LNQ A;  1SQQ D;  3CI9 A;  1RHZ B;  1W5C E;  4IOI H;  3VP9 A;  1U7J A;  1N7S C;  1DD4 A;  3EFF K;  1YIJ P;  5B5E H;  1UUW A;  5AVS B;  2BMQ A;  1LTA C;  1U7M A;  2Z5H A;  4HM4 A;  1M1K Q;  3L74 J;  1EZV E;  3TYY A;  2NWF A;  2R3C A;  2H8P D;  2FYU G;  1LT1 A;  2D2C D;  1S9K D;  1NH4 A;  2R44 A;  1RFS A;  1P84 D;  1KQS O;  1WMK A;  3TK1 A;  1NTK E;  2GUS A;  2WPV B;  3L70 G;  3L74 E;  1L0N G;  3RK2 D;  3BCC D;  1FJP A;  1FU1 A;  2BMO A;  5AVV B;  1VQ9 P;  1YJN P;  1PFI A;  5AW7 B;  1LGH B;  1N7S A;  1NOH A;  2E75 D;  1NVO A;  2FBW C;  1KC8 Q;  2E75 C;  1QLE D;  2WVR A;  3VP8 A;  4OH8 B;  4UB6 H;  3CXH I;  1KZU B;  1WT6 A;  1H88 A;  1VL2 A;  2DW3 A;  1A02 J;  1QVF O;  2I8D A;  2W90 A;  3GF3 A;  3L70 D;  4HM0 A;  4I1L A;  1BDD A;  1LJ2 A;  2D2C C;  4KHX A;  3H1I E;  2JO6 A;  1YI2 P;  2WWW A;  1SQX G;  1GL2 B;  2KOG A;  1VQO P;  1K04 A;  1IZN B;  3SWF A;  1RQU A;  1N7S D;  2PAJ A;  1R5L A;  3PHL A;  1J2J B;  2IBZ D;  3E1I A;  1GW3 A;  5HL4 A;  5KTB A;  3F89 A;  2OYI A;  5CBN A;  1DIP A;  3BAT A;  4PV1 D;  1OVR A;  2HMM A;  2FFD C;  4WWI A;  1L0N E;  1KQL A;  4OGQ B;  1AFO A;  2FYU K;  3BCC J;  1IO4 A;  3LW5 J;  5AVU B;  3WUT A;  4GT1 A;  1FE6 A;  3FWN A;  1KB9 D;  2HFE D;  3H1L D;  2FYZ A;  2RN0 A;  2ZXE B;  4NBD D;  1N8R Q;  1G8K B;  1DH3 A;  2BEZ F;  2A06 E;  1R8E A;  3CCM P;  3AEC C;  1JTH A;  2KNC B;  2XZR A;  3MHV A;  3KZI E;  3I55 P;  2IPP A;  1L4A C;  3L74 G;  3L70 E;  4RKU J;  1LTT C;  2W83 C;  4B86 A;  3T97 A;  1VF5 C;  4I7Z B;  4UB8 H;  2WTY A;  4PD4 H;  5AVT B;  3BAS A;  3VTP C;  4XE5 B;  5CCH C;  2AEF A;  5CJ0 A;  3TF5 A;  1H0T A;  1GMJ A;  1SP4 A;  1LT9 B;  1RE4 C;  2KLU A;  1NWQ A;  1FZB A;  3OA7 A;  1J1E C;  2IDB A;  2O01 H;  5CBO A;  3P8C D;  1G2C A;  1KMI Z;  1EZV G;  1FDM A;  4DOJ A;  1CSB A;  2BAS A;  2CK3 H;  2ZT9 C;  1PPJ G;  3CCQ P;  1VF5 B;  2Z5I A;  1ULI A;  2KS1 B;  4EYY Q;  1JM0 A;  2OYI C;  1PP9 G;  3CME P;  3IR9 A;  3N4X A;  2WIT A;  4I6M C;  3GZY A;  4WBA A;  5KKZ B;  2C9N Y;  3CX5 I;  2YFJ A;  2WSC H;  5DJU B;  1CZQ A;  5TJH A;  4NBG D;  2ZAE B;  3M0A A;  4Z1M H;  2E76 D;  2WQY C;  3OAK A;  5AVR B;  4JPZ B;  1RF0 A;  4H0L D;  2QA4 P;  3SWK A;  2Y9Z A;  5KAF E;  5KAI H;  1H89 A;  1L0N D;  4PD4 D;  2NRG A;  3ZDM A;  1HVV A;  1SQP K;  3V5B A;  1T6A A;  2KXP B;  2WSE J;  3JSV C;  2D2C B;  5KJ7 A;  2WZ7 A;  4EIJ A;  2Y0E A;  2P7J A;  4IFM A;  2A06 D;  2ITA A;  1NU1 J;  4L76 A;  3PTZ A;  4HM2 A;  3MP7 B;  1Q90 C;  4QUR A;  1NTM K;  2YIU C;  4HJG H;  1E79 H;  1SQX K;  2KYV A;  1SQB K;  3H1K J;  2K9J B;  1CW5 A;  4EDF A;  1ZR2 A;  1W2B O;  2G8Y A;  3BCC E;  4D6T J;  4P1C H;  1PGO A;  1EC5 A;  1EDK A;  5KAI E;  5KAF H;  4QUQ A;  3AZC A;  2YFI A;  2E74 C;  1SQV D;  3A3Y B;  1S72 P;  1YQ3 C;  4C7N A;  1IK7 A;  3C1L A;  1BSN A;  1BE3 J;  3H1I D;  1S5L H;  4D6T G;  1JMB A;  1EDL A;  1IC2 A;  4HH2 A;  5TIS H;  4PD4 I;  1KQF B;  3TNU A;  1SQB D;  3GZX A;  3L71 J;  1K73 Q;  3LID A;  3Q5P A;  2YKP A;  4W7Y A;  2HOD B;  2QE7 H;  3AEF C;  4IFD K;  2M8R A;  1J1E B;  3FGA D;  3S4R A;  2QJY C;  2FXM A;  2J58 A;  1SQB E;  3B5N A;  1NTZ E;  1ZR4 A;  3JCU E;  4I7Z C;  2BCC E;  3W68 A;  2JEE A;  1BE3 E;  2WSS H;  2DE7 D;  4YTP C;  3L75 G;  4HM3 A;  1OVV A;  2NPS D;  2FY8 A;  3A0B H;  1G8J B;  2XRX A;  5KKZ C;  3TDK A;  1QGK B;  1K8A Q;  2BCC J;  5CCH A;  2HYN A;  3M91 A;  2OYH C;  5APQ A;  1M1J B;  2W27 A;  3H32 B;  1KYO E;  1YYC A;  3A0B E;  1SLQ A;  3Q1M A;  2XKM A;  1AQ5 A;  1O7G A;  1S3J A;  1JCD A;  1JM1 A;  4GOF A;  1AVO A;  5KLI C;  3CMA P;  1T2K C;  1KFM A;  1PZQ A;  1JY2 P;  2ZXX A;  1DEB A;  3GL0 A;  3GOB A;  1LTJ C;  4YXD C;  1PP9 E;  3CCV P;  2FFD B;  1NDO A;  1IFI A;  2V7Q H;  3V2R A;  3GHG B;  2ZT9 D;  3HE5 A;  2JP3 A;  2O01 J;  3KQG A;  1L0L D;  5GTI E;  1G2C B;  5APY A;  3GTE A;  3H1L J;  5E79 H;  1FZC B;  3E7K A;  4ZMD A; 
#chains in the Genus database with same CATH homology
 3GL2 A;  4NBC D;  2QJY C;  5CXM A;  1O7M A;  2B24 A;  4NB9 D;  3C0D A;  4H44 D;  2IBZ E;  1NU1 E;  1SQB E;  2QPZ A;  2GBX A;  1NTZ E;  2B1X A;  3L72 E;  3N0Q A;  4QCK A;  1L0L E;  2NVE A;  2NVF A;  4HM0 A;  2NUK A;  3L70 E;  1RIE A;  2ZYL A;  2FYU E;  2E74 D;  2BCC E;  4D6T E;  1VF5 D;  2E4Q A;  1BE3 E;  4EMJ B;  1PPJ E;  3H1I E;  1BCC E;  4NBH D;  1VCK A;  4NB8 D;  2I7F A;  2E4P A;  2JO6 A;  2DE7 D;  4HM3 A;  1SJG A;  3L73 E;  2JZA A;  3H1K E;  3VMI D;  4HM2 A;  1O7N A;  1Q90 C;  2XRX A;  1G8J B;  4HM5 A;  4NBE D;  4QUR A;  4PD4 E;  5KKZ C;  4H13 D;  2XSO A;  2NUM A;  2YIU C;  3VMG D;  3CXH E;  3H1H E;  2QJP C;  1NYK A;  2GBW A;  2QJK C;  3EQQ A;  2DE6 D;  3DQY A;  1UUW A;  3L71 E;  2BMQ A;  2XR8 A;  4OGQ D;  1WQL A;  1KYO E;  5AEU A;  3BCC E;  2NVG A;  2DE5 D;  1SQQ E;  5AEW A;  4HKV A;  4HM4 A;  1O7G A;  3CX5 E;  4P1C H;  2BMR A;  5BOK A;  1EZV E;  1SQV E;  4QDC A;  1JM1 A;  2HMN A;  2NWF A;  4QUQ A;  5KLI C;  3AZC A;  2YFI A;  2D2C D;  5HL4 A;  3CWB E;  2HMJ A;  4U3F E;  4HM7 A;  1SQP E;  2XSH A;  1P84 E;  1ULI A;  4NBA D;  1KB9 E;  2CKF A;  2FYN C;  1RFS A;  3H1L E;  3GL0 A;  3GOB A;  3GKE A;  2HMO A;  1PP9 E;  4HM8 A;  4P1B H;  4PV1 D;  4QDF A;  1NDO A;  1UUV A;  2HMM A;  1FQT A;  3D89 A;  1NTK E;  3L74 E;  3H1J E;  3FOU A;  3VCP A;  4HM6 A;  3GTS A;  4AAY B;  4AIV A;  2HML A;  4HM1 A;  4QUP A;  1O7H A;  1L0N E;  1BGY E;  4NBF D;  1ZRT E;  3GZY A;  2BMO A;  3GCE A;  1EG9 A;  2YFL A;  2YFJ A;  3VMH D;  2ZT9 D;  3GZX A;  3L75 E;  2Q3W A;  2HMK A;  4NBG D;  4HJL A;  1SQX E;  3GTE A;  3TGU E;  5KLV E;  2E76 D;  2E75 D;  4QDD A;  1ULJ A;  4QDF B;  1O7W A;  1VM9 A;  3EN1 A;  1NTM E;  3GB4 A;  4NBD D;  1G8K B;  4NBB D;  4H0L D;  2A06 E;  3VCA A;  1O7P A;  2YVJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...