4PD4E

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 44
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4pd4E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4pd4E02
2XRXA 2JZAA 4H0LD 4HM0A 2E4PA 3C0DA 3H1IE 1NU1E 3GL2A 1ULIA 2E76D 4QCKA 1ULJA 2YFIA 1VM9A 2I7FA 3L71E 3VMHD 2FYNC 5BOKA 2QJPC 3GKEA 1NDOA 4HM6A 4PV1D 1G8JB 1SQPE 3L73E 3VCAA 5KLIC 5KKZC 2HMKA 4HJLA 1BCCE 4NBGD 1FQTA 3CX5E 3VCPA 1P84E 1L0LE 1SQBE 4QDFB 1KYOE 2HMNA 1NTME 2IBZE 3L72E 2ZT9D 4NB8D 1SJGA 3H1HE 3BCCE 3GB4A 5HL4A 2NUMA 2E4QA 4OGQD 3VMID 1WQLA 2BCCE 3TGUE 4P1BH 3L74E 1JM1A 2Q3WA 4H44D 4QUPA 4HM1A 2NVEA 2XSHA 5CXMA 1BE3E 1L0NE 4HM8A 1VCKA 4EMJB 1ZRTE 2FYUE 4QDDA 2HMLA 4HM3A 1O7HA 4NBFD 5AEUA 4NBHD 4HKVA 3CXHE 2BMOA 2E75D 1O7PA 3GCEA 3H1LE 2D2CD 2GBXA 3GTSA 1KB9E 3N0QA 4NBDD 3EN1A 3D89A 2YVJB 1NYKA 2YIUC 3AZCA 4NBBD 5KLVE 1UUWA 3H1KE 3GL0A 3DQYA 3VMGD 4H13D 4AAYB 2B1XA 2XR8A 2BMQA 4NBCD 2NUKA 1O7WA 2YFLA 1SQQE 3GZYA 1PPJE 3L75E 1NTKE 1RIEA 2BMRA 3GOBA 4QDCA 1RFSA 2XSOA 3EQQA 4HM5A 1O7GA 4QURA 3FOUA 2NVFA 4U3FE 1NTZE 2DE7D 3GTEA 4PD4E 4HM4A 1EZVE 2NVGA 1BGYE 2A06E 3CWBE 2HMJA 4NBED 1O7MA 4HM2A 4NBAD 1PP9E 2B24A 2QPZA 1EG9A 1Q90C 1SQVE 1G8KB 4AIVA 2DE5D 2QJYC 2GBWA 1O7NA 1UUVA 2CKFA 2E74D 2NWFA 2QJKC 4HM7A 5AEWA 2HMMA 1SQXE 4NB9D 3H1JE 2YFJA 2ZYLA 4P1CH 3L70E 2JO6A 2HMOA 3GZXA 4QUQA 4QDFA 1VF5D 2DE6D 4D6TE
chains in the Genus database with same CATH superfamily
5KAFE 1RE4C 2CK3H 3CMEP 4DZOA 2OYHB 2HPCB 3II6A 1SQXG 3M9QA 2WWWA 3F5HA 5BOKA 4ZNCA 4HM6A 2Y9ZA 1PZQA 3VMAA 4GODA 2WSEH 1FDOA 3RL0C 3H1IG 1JUNA 3HD7C 4LGDE 1JCCA 1ZRTD 1FE6A 2YNYA 2HODA 2VRSA 2KSJA 4U3FG 3C8VA 2NPSC 1WQLA 2BCCE 2N1TA 4L74A 2QG4A 4IL6E 3GLMA 2Y9YA 3H1KJ 1A02J 1O7HA 5AEUA 3CX5D 1PP9J 4EOTA 3CCVP 1NTZG 1ZLLA 3AE4C 2E5YA 1FOSE 1NTKG 1VDFA 3O6QB 3RL0B 3GZYA 2W6JH 1DX7A 4DJGA 2LXCB 1KQGB 3T97B 1RFSA 3L35A 3FOUA 2OGUA 2NVFA 1LP1A 1RH5B 3B5NB 2NPSD 2J58A 4PD4E 1LTJC 2WQYC 2YKOA 4LC1A 3HD7D 1KORA 1VQ7P 3H32B 4AIVA 2E74D 3CX5I 3HD7A 3H1JE 3CL3D 3LIEA 2KZJA 1MZ9A 4WY4C 3RBXA 5AW4B 1CI6B 5APVA 3JCUH 1OIPA 4QCKA 3H1ID 3A5TA 3G71P 1WMKA 1J1DB 3Q5PA 3H1IJ 4EYYQ 2AEFA 5CMZA 5KKZC 5AVYB 1P84E 4OVNF 3V2NA 1KYOE 1GL2B 1KFMA 3KHUA 1NGMB 1VQ4P 3S9OA 2UWJE 4PD4D 3P8MC 1SFCA 5AVRB 3H1HD 1L4AD 2N9BA 4QDDA 3C9IA 4HM3A 4GIFA 5APXA 5AW6B 1JTHA 5DJTB 1NTZK 3FWLA 3HTKA 1S5LX 1X9VA 3RL0D 4HYTB 1N7SD 5CJ4A 2B1XA 3AE6C 2YFLA 3L37A 3WU2H 1SQQE 1HGVA 1PV3A 2FXMA 2YMYA 3CWBJ 5AW8B 1X8YA 4BRYA 5AVVB 2XSOA 1PP9D 2QJPB 5AVUB 3HUSB 1PGJA 5KLIB 1NOHA 4NB9D 3FXDA 2ZYLA 1YTZI 2IDBA 2MKVA 4O9BA 1EQ7A 3CI9A 4H0LD 4WY4A 2BASA 1IFNA 3V4WA 2E76D 2OYHC 1JOCA 3D6ZA 3V6IA 2AXCA 3WUTA 1ULJA 1Q82Q 1G1JA 4JQ0D 5GTIE 1S3JA 2E74C 4KJMA 1FZCC 2WSFH 1T2KC 2O01N 5AW3B 1PL5A 2P10A 3H32A 2WZ7A 1GTWA 1RF0A 1FQTA 3CXHD 5B5EH 1LTTC 1UIIA 5KJ7A 2XNDH 1L0NJ 4DCKA 1SJGA 3BRTB 2E74B 1FZCB 3TYYA 4D6TJ 4ZKUA 1NVOA 4HH2A 5CXMA 3H6PA 1G2CA 2E75D 3R4YA 1KILB 3P7KA 4UB6H 3L73J 4PV1C 1Q7YQ 1P84I 1BE3J 3H1LG 2OYOA 4PJ0H 3GL0A 4H13D 1H89A 4AAYB 1NTMJ 3N4XA 3I56P 3RK3C 2M3EA 3PHLA 3IFMA 3TGUD 3FXEA 4XE5B 1S9KD 5H2FE 3HE4B 1RF1C 4NBED 4XFJA 2D2CB 2B24A 2AXTE 3RGUA 3LIDA 1G1IA 3M9BA 2HR3A 2QJKC 4HM7A 4JPZB 5KJ7C 2OYIC 3CPWO 4M3LA 2IBZI 1ZXGA 5CCGC 5AVZB 3P32A 4R4LA 1GK6A 2IBZG 3AEBC 2WSFJ 1NHLA 3H1LD 1AVYA 1HUCA 1PGQA 3L71G 2IZ0A 3GHGA 4IL6H 4Y99B 3IF4A 3I55P 2PFXA 2G3AA 2BEQD 4IFFA 1SQBE 1LTIC 1OVRA 3Q2YA 3L72E 3CCLP 1EZVD 2HFED 3UIAA 1LTJA 1N2DC 1FOSF 4P1BH 2FYUK 3CLQA 2QIWA 1JCDA 2K1AA 1K73Q 1GD2E 3HTKB 1KC8Q 1PIXA 1JY3O 4PJ0E 2OQQA 2JEEA 3MZWB 1KB9E 4JF7A 5B66E 3D89A 4UB6E 5KAFH 5KLVE 2D2CC 2ZT9B 1OVVA 1ZR2A 1KILE 2HYNA 1FC2C 4Y99C 1PFIA 2ZAEB 1ZV8A 3RL0g 5AVSB 1NAFA 1ZOYC 3RK2C 2C9LY 1HJ0A 2KP8A 4JYCA 1JM0A 1AFOA 1W2BO 1T8ZA 2LXBA 3BCCD 2NWFA 1GZLA 4MN4C 2HMOA 3IN6A 1L0LD 2BCCJ 3T97A 4DOJA 1J2JB 5CCGA 3BVHA 1NKNA 3MGNA 1VQKP 1J1EB 2NZ2A 3JC22 1KB9D 3O6QA 3GKEA 4PD4I 3CD6P 3MP7B 3G4SP 3VCAA 4B86A 2P67A 1LT9A 4UB8E 1LP1B 1AQ5A 3VCPA 3TDKA 4QDFB 3VP8A 1NTME 1KFNA 5TJHA 1EZVG 1BE3D 4W7YA 1PPJG 1OXZA 1KILC 1LTBC 1H0TA 1OZHA 2QE7H 1KILA 1N7SC 1RF0C 2J59M 2ZXEB 3GCEA 2Q5UA 1M1JA 1JB0J 4RJTA 3HE4A 2R32A 3QWOC 3DQYA 1IC2A 2XR8A 5M1BA 1IFMA 2FFDA 3IAOA 1NU1J 3SSUA 1FZFA 2BMRA 3U1CA 3LW5J 3BCCG 1M1JB 1EC5A 4H0LB 2R3CA 1D7MA 5L8RJ 2FFDB 1H88A 2NPSB 2KZIA 2JO6A 3GZXA 3HD7B 2Q3IA 4OH8B 4TT3H 4NPFX 3N7NA 3Q3DA 1JY3N 3GL2A 4H44B 3MTUE 3OAKA 1R8EA 1PGPA 4YXDC 1YJNP 1HF9A 1FZAA 3U1AA 1DH3A 1W5CE 1SQPG 1KZUB 1NU1D 4OWFA 2E42A 1BDDA 2WT7B 1L0LE 3EQ2A 2P7JA 1KQFB 4L75A 4GKGA 1GW3A 4GDOA 2O1JA 2ZT9D 2JWAA 3VMYA 5HL4A 4OGQD 1PP9G 3LW5H 4NPEA 3PJSK 4H44D 4K3AA 3AE8C 3H1KG 2XSHA 1L0NE 1SQQG 4HM8A 1BGYG 3L71D 5KLVD 5AW5B 1SFCB 3AZCA 1BCCJ 1RHZB 1ZN5A 3MUDA 3CCUP 1K04A 2JKVA 4ZKPA 1OWAA 1SQXD 1OMIA 2KLUA 1JTHB 1QGKB 2JR8A 4YTPC 4N78E 1X0TA 2PAJA 2B9BA 5BVZA 2KS1B 2ZFCA 1N73B 2BCCD 1T6AA 2H7HA 1L0LK 3R2PA 2GBWA 1UUVA 2Z4EA 5APWA 1GL2D 3V2RA 1JNMA 5KLVJ 1VQ8P 1EDJA 2RKLA 4D6TE 1HWTC 1GU5A 4ASWA 1JO5A 2HODB 1DD4A 2XU6A 4HB1A 4IFMA 1USDA 1S2EA 1M56D 2YKQA 2CPSA 1RE3C 3L73E 4PD4H 3MD0A 3CCRP 2HMNA 4XA4A 3HUSC 2IBZE 1NTZD 1X79B 4PV1B 1EDKA 1RE3A 3TGUE 3L74E 1Q86Q 1YJWP 1ZRTE 1YHQP 4IOIH 1SQPD 1GK4A 1QEXA 3L75D 5E79E 2O1KA 2QJYB 3JSVC 2P2UA 1N7SB 4U3FE 1Q90D 1BGYD 1QVFO 1Y47A 1BGYE 1O7MA 1EG9A 1JMBA 1G8KB 1K8AQ 1BCCG 3EFGA 2QVAA 3M0AA 1URQA 1Z56A 1IFDA 1S4XA 2Y0CA 2B87B 2W8ZA 5KLIC 1EXJA 3H1HG 2JZAA 1SQQK 3C0DA 1NU1E 5KAIH 1T3JA 4CPGA 4KT0J 1SLQA 3CCMP 3AEGC 4PV1D 1SQVG 3FWNA 1SQPE 3AECC 1BDCA 2E75C 1X22A 1FZGA 3HE5B 3CXHI 2HMKA 1LTAC 3CCSP 1HH0A 1RF1B 1UIXA 4I2LC 1N86A 2YO2A 1K05A 2KLVA 1RY3A 2JDIH 5GTHH 1JM1A 3CCJP 1URQC 2NVEA 4W7ZA 1RQUA 3P8CD 3JCUE 2IBZD 1JY2P 1OX3A 5B66H 1HVVA 3A7OA 2A06G 1QL2A 3MIWA 3W67A 2YXRB 1M57D 5DJUB 1P84H 2BMQA 1AQTA 1AV1A 1VQ9P 4IL6X 2O01H 1PPJE 3EQQA 1LWUA 1M8OB 1O7GA 1VF5C 3K5BA 3PTZA 2N1TC 1VQPP 4NPDA 3FX0A 5AVTB 2QM7A 1P84D 3RK2D 2QJYC 2ZJSE 2WSCJ 3S4RA 3AEFC 2SPZA 1OVUA 2H88C 3NXSA 3AEAC 3B5NC 1MFTA 2FYNC 3Q5RA 3V4QA 1Q81Q 1G8JB 3D6YA 2H89C 1GU4A 3D71A 1FJPA 1OW8A 3VN0A 2GUVA 2WPSA 2B87A 1LTSC 1LT9B 5GTIH 5APQA 3H1JD 4UB8H 2KUBA 2Z5IA 3L70G 4RO0A 1VF5B 3H1LJ 2ZYAA 1LWUC 2KS1A 3KXDA 2JO1A 3KDPB 2K3RA 4ZMDA 3H1HJ 2HMLA 1IK7A 1SS1A 4NBHD 5KLVK 3AEDC 3CXHE 3G9RA 2P58A 2QRXA 4K35A 1QX8A 5EFWB 5AW0B 3EN1A 1LT1A 2A45H 4R4MA 2H43A 2ZVOB 2IZ1A 1N73C 1SQPK 1LT9C 1JY2O 2KXPB 1JMMA 1NTKK 2KB7P 5K5GB 3P8CE 4KHXA 1JY2N 1U57A 1URQB 3TGUJ 3MUDC 2RN0A 4HM5A 3B5NA 4HKZH 1N7LA 3FGAD 3VMZA 1RE4A 2A06D 3GTEA 1SQXJ 3SWFA 3L72D 2A06E 2ZT9C 2HMJA 1SQBD 3TSIA 1O7NA 3O8ZA 4AQRD 2LR2A 3L72G 2QA4P 1PGOA 3KZIE 4BXLA 1SQQD 4H13C 1NH4A 2I7FA 3L70J 1JY3P 1S1CX 4D6TD 2M3BA 2DW3A 2W83C 2WTYA 3SFDC 1L0ND 1BCCE 4NBGD 2IYPA 4N6JA 2ZYGA 3CXHH 1FDIA 1S5LE 2J5UA 1LTJB 3VP9A 1NU1G 1FBMA 1NJIQ 1SFCC 1N8RQ 3H1HE 1K9MQ 4EDFA 4LLHA 1FJKA 2Y0DA 2K9JA 2IYOA 3AE7C 1KMIZ 4HM1A 3GF3A 2KNCA 3E1RA 1R5SA 4DT0A 1HTLC 3CC7P 1QL1A 4NBFD 3NFQA 2BMOA 2OTJP 3GTSA 1E79H 2QJKB 3L75J 5APSA 5CJ0A 2Q3EA 2M5AA 1LGHB 3VMGD 3MHVA 4JYBA 1EXIA 2ZXXA 5CCHD 3B8EB 1KQSO 3GMAA 4WB4A 3HE5A 4QDCA 1G2CB 4I1LA 3I5CA 5APYA 1GW4A 2FYUG 2YXQB 1WT6A 2E76B 3G6EP 3V2PA 3WMM0 3L73G 1OFCX 3L74G 3L70E 3M0DC 1S5LH 1RF1A 2FFDC 1GL2A 2IPPA 4YPCA 4HM0A 1SQQJ 1SVFA 4A7PA 1VM9A 3PP5A 1N73A 4D6TG 1KN7A 1ZP0C 2O3JA 2R5DA 2YMKA 3A0BH 3OJAB 4GOFA 1N7SA 3CX5E 3VTPC 5APUA 4YXWH 4BRYB 1USEA 2OYIB 1ZMEC 2WSSH 2NUMA 2C0XA 4I7ZB 1QVGO 1EDIA 2N9YB 3RBZA 5AVXB 1FZCA 4QUPA 1J1EC 2H8PD 3TK1A 5CBNA 1VCKA 2ZYDA 5KTBA 3E7KA 2YO3A 3EWKA 1O7PA 2FYZA 3KPEA 1BCCD 2D2CD 2YIUB 2JWDA 2NRGA 3SWYA 3SFEC 2FYUJ 2XDJA 2C9NY 1OW6A 2A45I 1Y9BA 1HJBA 3RK2B 1RIEA 5KAIE 2KK7A 4QURA 2RMZA 1XTCC 3USSA 3AE5C 2Q9IA 3AE9C 5AVWB 2DE7D 1KB9H 3CWBE 4BWNA 1AVOA 2WITA 1NU1K 3PRJA 3D70A 2DE5D 1WRGA 1KILD 3PH0A 1L4AB 2DE6D 1NTKD 1AJYA 1T3UA 1LJ2A 1ZW0A 1U7MA 2Q7CA 4HJGH 1DIPA 1YITP 1SQVK 2CPBA 1NDOA 1XTGB 3EFFK 5CCGD 1A02F 3L36A 1GL2C 5E79H 1YBKA 2K37A 2PP6A 1M7LA 2AEJA 5CCHA 5AW9B 3AE1C 2ITAA 3GB4A 3GG2A 3W68A 1J1DC 4ASVA 2WPVB 2MJZA 2M5AB 2Q3WA 4GOEA 1MV8A 3RK3D 2R5BA 4EMJB 1SFCD 2FYUE 2KIKA 2YKPA 3VMXA 2FXPA 1BSNA 3L74J 2GBXA 2GA1A 3N0QA 1L2PA 1NYKA 4NBBD 2GUSA 3AE2C 1SP4A 4NBCD 2NUKA 3B71A 3ABVC 2P1JA 4OGQB 4AUWA 1FS0E 1NTKE 5APTA 1HGZA 1IJDB 3M9HA 5AVQB 3RK3B 3VOPA 1NTZE 3C1LA 1U7JA 1EZVE 5TISH 2NVGA 2HLOA 1YQ4C 1HBWA 3OA7A 3CX5H 2OARA 4EI2A 5GTHE 2K9YA 1CW5A 2PGDA 2CKFA 4N3YB 1SQXE 1T2KD 1VQNP 2XNXA 1IFPA 1NYHA 2B88A 2OYIA 2JP3A 2YFIA 1KV4A 3VMHD 4L73A 1L0LJ 4JBZA 5B5EE 4TLFA 2KSEA 1IFJA 3CC2P 4Y28J 5CBOA 3A3YB 3OW2O 4WY4B 3CWBG 2IFMA 2IX7C 1EDLA 3G3ZA 3L75G 2I1JA 4C7NA 1SQBJ 3H1JG 3M91A 2AXTH 1NTMK 4OGQC 2N1TD 3L72J 5H2FH 4HKVA 1NKZB 1FU1A 4W80A 2WT7A 5KLVG 2V7QJ 3TNUA 1NO4A 2YVJB 3A0HH 3GW6A 1KYOI 3CCEP 4QMAA 3U59A 1VL2A 2E76C 3B5ND 5AW7B 3L75E 1KD1Q 4Z1MH 1RQVA 5AW2B 4C46A 2GM4A 1SQVD 1LNQA 1L4AA 1VQOP 3CWBD 2K9JB 2L5GB 4HM2A 1PP9E 3KQGA 5AEWA 1DEEG 4WWIA 2QEXP 1H0TB 1Q2NA 1M1KQ 1TU3F 4RESB 4QDFA 3KYQA 1VF5D 2XRXA 2FKWB 1NWQA 1SQXK 5TISE 1MUUA 4GT1A 2BEZF 2Z5HA 1W2EA 2W6BA 3E1IA 3VYIA 2V4HA 4WVZA 4WY4D 2W90A 2R44A 2FYNB 2PRRA 1M90Q 3NMDA 1NAYA 1IK9A 4HJLA 2AEMA 3S1KA 3M06A 2WSCH 2WVRA 5BU5A 3L4FA 4H0LC 1VQMP 4NB8D 2HPCA 2E4QA 3GHGC 3AE3C 1YIJP 2E43A 3HRNA 4H13B 1NTMD 3Q1MA 2XV5A 3H1LE 2O01J 5CCHC 3L73D 2RH0A 3WU2E 2V7QH 2E5TA 3Q5SA 1IFIA 3A2AA 3IR9A 2Q1KA 5KJ7D 3AEEC 2OTLP 2JJLA 5C39A 5KKZB 1IZNB 2QSIA 3L70D 3RK3E 1QLED 1MFZA 1E5WA 3NTNA 3WUVA 3H25A 1SQVE 1AA0A 2XZRA 1L4AC 1GMJA 1YQ3C 2M0BA 3CCQP 1S9KE 2B89A 1SQBG 5CHXA 1KYOH 3H1IE 1ULIA 3SWKA 1VPCA 3L71E 1FZEA 2OYHA 3GF7A 4AYCA 2R3SA 3ZDMA 5AW1B 2ZVNB 1VQ6P 4H44C 2KOGA 2FBWC 3BASA 2A45G 3BCCE 3VMID 2XKMA 4I6MC 3L74D 2NPSA 2I8DA 1KQLA 3A0HE 1CZQA 2OTKE 1M1JC 1BGYJ 3WUUA 2W6AA 3V5BA 4I7ZC 2W27A 1PPJD 3KZIH 1YI2P 3HUSA 3H1JJ 2Q6QA 2WPRA 3ITKA 1IO4A 1L0NK 1O7WA 2L91A 2KI7B 3TGUG 1L0NG 3A0BE 4L76A 3CC4P 3TF5A 2K88A 2M8RA 4EIJA 1SQVJ 1CSBA 1SQPJ 2QM8A 1H8AA 1S72P 4C7RA 4HM4A 1BE3G 1KB9I 1NTKJ 1Y8AA 1L0LG 4NBAD 5BU8B 1FZBA 1NTZJ 2HG5D 2YFJA 1SQBK 1OW7A 3F89A 4N78D 2HMMA 2E4PA 3BATA 3PLNA 3TNUB 2N1TB 2WPQA 2QJPC 2LKMA 1ZR4A 1EZVI 3V2QA 4RKUJ 4U3FJ 1JEKA 4U7JA 1GDTA 3BRVB 2KNCB 3BCCJ 1KTMA 1LTGC 1FDMA 2WMMA 3M0DA 1MKMA 1URQD 2FYUD 4U3FD 1KYOD 2I1KA 2FY8A 4IFDK 2G8YA 1BE3E 2FXOA 2KYVA 3B4SA 4NBDD 2YIUC 1VQ5P 4WBAA 3QH9A 1VQLP 1UUWA 3H1KE 4C7NB 3H1KD 1YYCA 1YTZT 1LWUB 2E75B 3L71J 3GOBA 2Y0EA 1BSHA 1YJ9P 1CI6A 2POHA 1R5LA 1NTMG 1DD3A 2QPZA 1Q90C 3GHGB 2C0WA 2IFNA 2WSEJ 3CMAP 1DEBA 4P1CH 1FAVA 2BCCG 4QUQA
chains in the Genus database with same CATH topology
2XRXA 2JZAA 4H0LD 4HM0A 2E4PA 3C0DA 3H1IE 1NU1E 3GL2A 1ULIA 2E76D 4QCKA 1ULJA 2YFIA 1VM9A 2I7FA 3L71E 3VMHD 2FYNC 5BOKA 2QJPC 3GKEA 1NDOA 4HM6A 4PV1D 1G8JB 1SQPE 3L73E 3VCAA 5KLIC 5KKZC 2HMKA 4HJLA 1BCCE 4NBGD 1FQTA 3CX5E 3VCPA 1P84E 1L0LE 1SQBE 4QDFB 1KYOE 2HMNA 1NTME 2IBZE 3L72E 2ZT9D 4NB8D 1SJGA 3H1HE 3BCCE 3GB4A 5HL4A 2NUMA 2E4QA 4OGQD 3VMID 1WQLA 2BCCE 3TGUE 4P1BH 3L74E 1JM1A 2Q3WA 4H44D 4QUPA 4HM1A 2NVEA 2XSHA 5CXMA 1BE3E 1L0NE 4HM8A 1VCKA 4EMJB 1ZRTE 2FYUE 4QDDA 2HMLA 4HM3A 1O7HA 4NBFD 5AEUA 4NBHD 4HKVA 3CXHE 2BMOA 2E75D 1O7PA 3GCEA 3H1LE 2D2CD 2GBXA 3GTSA 1KB9E 3N0QA 4NBDD 3EN1A 3D89A 2YVJB 1NYKA 2YIUC 3AZCA 4NBBD 5KLVE 1UUWA 3H1KE 3GL0A 3DQYA 3VMGD 4H13D 4AAYB 2B1XA 2XR8A 2BMQA 4NBCD 2NUKA 1O7WA 2YFLA 1SQQE 3GZYA 1PPJE 3L75E 1NTKE 1RIEA 2BMRA 3GOBA 4QDCA 1RFSA 2XSOA 3EQQA 4HM5A 1O7GA 4QURA 3FOUA 2NVFA 4U3FE 1NTZE 2DE7D 3GTEA 4PD4E 4HM4A 1EZVE 2NVGA 1BGYE 2A06E 3CWBE 2HMJA 4NBED 1O7MA 4HM2A 4NBAD 1PP9E 2B24A 2QPZA 1EG9A 1Q90C 1SQVE 1G8KB 4AIVA 2DE5D 2QJYC 2GBWA 1O7NA 1UUVA 2CKFA 2E74D 2NWFA 2QJKC 4HM7A 5AEWA 2HMMA 1SQXE 4NB9D 3H1JE 2YFJA 2ZYLA 4P1CH 3L70E 2JO6A 2HMOA 3GZXA 4QUQA 4QDFA 1VF5D 2DE6D 4D6TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRX A;  2JZA A;  4H0L D;  4HM0 A;  2E4P A;  3C0D A;  3H1I E;  1NU1 E;  3GL2 A;  1ULI A;  2E76 D;  4QCK A;  1ULJ A;  2YFI A;  1VM9 A;  2I7F A;  3L71 E;  3VMH D;  2FYN C;  5BOK A;  2QJP C;  3GKE A;  1NDO A;  4HM6 A;  4PV1 D;  1G8J B;  1SQP E;  3L73 E;  3VCA A;  5KLI C;  5KKZ C;  2HMK A;  4HJL A;  1BCC E;  4NBG D;  1FQT A;  3CX5 E;  3VCP A;  1P84 E;  1L0L E;  1SQB E;  4QDF B;  1KYO E;  2HMN A;  1NTM E;  2IBZ E;  3L72 E;  2ZT9 D;  4NB8 D;  1SJG A;  3H1H E;  3BCC E;  3GB4 A;  5HL4 A;  2NUM A;  2E4Q A;  4OGQ D;  3VMI D;  1WQL A;  2BCC E;  3TGU E;  4P1B H;  3L74 E;  1JM1 A;  2Q3W A;  4H44 D;  4QUP A;  4HM1 A;  2NVE A;  2XSH A;  5CXM A;  1BE3 E;  1L0N E;  4HM8 A;  1VCK A;  4EMJ B;  1ZRT E;  2FYU E;  4QDD A;  2HML A;  4HM3 A;  1O7H A;  4NBF D;  5AEU A;  4NBH D;  4HKV A;  3CXH E;  2BMO A;  2E75 D;  1O7P A;  3GCE A;  3H1L E;  2D2C D;  2GBX A;  3GTS A;  1KB9 E;  3N0Q A;  4NBD D;  3EN1 A;  3D89 A;  2YVJ B;  1NYK A;  2YIU C;  3AZC A;  4NBB D;  5KLV E;  1UUW A;  3H1K E;  3GL0 A;  3DQY A;  3VMG D;  4H13 D;  4AAY B;  2B1X A;  2XR8 A;  2BMQ A;  4NBC D;  2NUK A;  1O7W A;  2YFL A;  1SQQ E;  3GZY A;  1PPJ E;  3L75 E;  1NTK E;  1RIE A;  2BMR A;  3GOB A;  4QDC A;  1RFS A;  2XSO A;  3EQQ A;  4HM5 A;  1O7G A;  4QUR A;  3FOU A;  2NVF A;  4U3F E;  1NTZ E;  2DE7 D;  3GTE A;  4PD4 E;  4HM4 A;  1EZV E;  2NVG A;  1BGY E;  2A06 E;  3CWB E;  2HMJ A;  4NBE D;  1O7M A;  4HM2 A;  4NBA D;  1PP9 E;  2B24 A;  2QPZ A;  1EG9 A;  1Q90 C;  1SQV E;  1G8K B;  4AIV A;  2DE5 D;  2QJY C;  2GBW A;  1O7N A;  1UUV A;  2CKF A;  2E74 D;  2NWF A;  2QJK C;  4HM7 A;  5AEW A;  2HMM A;  1SQX E;  4NB9 D;  3H1J E;  2YFJ A;  2ZYL A;  4P1C H;  3L70 E;  2JO6 A;  2HMO A;  3GZX A;  4QUQ A;  4QDF A;  1VF5 D;  2DE6 D;  4D6T E; 
#chains in the Genus database with same CATH topology
 5KAF E;  1RE4 C;  2CK3 H;  3CME P;  4DZO A;  2OYH B;  2HPC B;  3II6 A;  1SQX G;  3M9Q A;  2WWW A;  3F5H A;  5BOK A;  4ZNC A;  4HM6 A;  2Y9Z A;  1PZQ A;  3VMA A;  4GOD A;  2WSE H;  1FDO A;  3RL0 C;  3H1I G;  1JUN A;  3HD7 C;  4LGD E;  1JCC A;  1ZRT D;  1FE6 A;  2YNY A;  2HOD A;  2VRS A;  2KSJ A;  4U3F G;  3C8V A;  2NPS C;  1WQL A;  2BCC E;  2N1T A;  4L74 A;  2QG4 A;  4IL6 E;  3GLM A;  2Y9Y A;  3H1K J;  1A02 J;  1O7H A;  5AEU A;  3CX5 D;  1PP9 J;  4EOT A;  3CCV P;  1NTZ G;  1ZLL A;  3AE4 C;  2E5Y A;  1FOS E;  1NTK G;  1VDF A;  3O6Q B;  3RL0 B;  3GZY A;  2W6J H;  1DX7 A;  4DJG A;  2LXC B;  1KQG B;  3T97 B;  1RFS A;  3L35 A;  3FOU A;  2OGU A;  2NVF A;  1LP1 A;  1RH5 B;  3B5N B;  2NPS D;  2J58 A;  4PD4 E;  1LTJ C;  2WQY C;  2YKO A;  4LC1 A;  3HD7 D;  1KOR A;  1VQ7 P;  3H32 B;  4AIV A;  2E74 D;  3CX5 I;  3HD7 A;  3H1J E;  3CL3 D;  3LIE A;  2KZJ A;  1MZ9 A;  4WY4 C;  3RBX A;  5AW4 B;  1CI6 B;  5APV A;  3JCU H;  1OIP A;  4QCK A;  3H1I D;  3A5T A;  3G71 P;  1WMK A;  1J1D B;  3Q5P A;  3H1I J;  4EYY Q;  2AEF A;  5CMZ A;  5KKZ C;  5AVY B;  1P84 E;  4OVN F;  3V2N A;  1KYO E;  1GL2 B;  1KFM A;  3KHU A;  1NGM B;  1VQ4 P;  3S9O A;  2UWJ E;  4PD4 D;  3P8M C;  1SFC A;  5AVR B;  3H1H D;  1L4A D;  2N9B A;  4QDD A;  3C9I A;  4HM3 A;  4GIF A;  5APX A;  5AW6 B;  1JTH A;  5DJT B;  1NTZ K;  3FWL A;  3HTK A;  1S5L X;  1X9V A;  3RL0 D;  4HYT B;  1N7S D;  5CJ4 A;  2B1X A;  3AE6 C;  2YFL A;  3L37 A;  3WU2 H;  1SQQ E;  1HGV A;  1PV3 A;  2FXM A;  2YMY A;  3CWB J;  5AW8 B;  1X8Y A;  4BRY A;  5AVV B;  2XSO A;  1PP9 D;  2QJP B;  5AVU B;  3HUS B;  1PGJ A;  5KLI B;  1NOH A;  4NB9 D;  3FXD A;  2ZYL A;  1YTZ I;  2IDB A;  2MKV A;  4O9B A;  1EQ7 A;  3CI9 A;  4H0L D;  4WY4 A;  2BAS A;  1IFN A;  3V4W A;  2E76 D;  2OYH C;  1JOC A;  3D6Z A;  3V6I A;  2AXC A;  3WUT A;  1ULJ A;  1Q82 Q;  1G1J A;  4JQ0 D;  5GTI E;  1S3J A;  2E74 C;  4KJM A;  1FZC C;  2WSF H;  1T2K C;  2O01 N;  5AW3 B;  1PL5 A;  2P10 A;  3H32 A;  2WZ7 A;  1GTW A;  1RF0 A;  1FQT A;  3CXH D;  5B5E H;  1LTT C;  1UII A;  5KJ7 A;  2XND H;  1L0N J;  4DCK A;  1SJG A;  3BRT B;  2E74 B;  1FZC B;  3TYY A;  4D6T J;  4ZKU A;  1NVO A;  4HH2 A;  5CXM A;  3H6P A;  1G2C A;  2E75 D;  3R4Y A;  1KIL B;  3P7K A;  4UB6 H;  3L73 J;  4PV1 C;  1Q7Y Q;  1P84 I;  1BE3 J;  3H1L G;  2OYO A;  4PJ0 H;  3GL0 A;  4H13 D;  1H89 A;  4AAY B;  1NTM J;  3N4X A;  3I56 P;  3RK3 C;  2M3E A;  3PHL A;  3IFM A;  3TGU D;  3FXE A;  4XE5 B;  1S9K D;  5H2F E;  3HE4 B;  1RF1 C;  4NBE D;  4XFJ A;  2D2C B;  2B24 A;  2AXT E;  3RGU A;  3LID A;  1G1I A;  3M9B A;  2HR3 A;  2QJK C;  4HM7 A;  4JPZ B;  5KJ7 C;  2OYI C;  3CPW O;  4M3L A;  2IBZ I;  1ZXG A;  5CCG C;  5AVZ B;  3P32 A;  4R4L A;  1GK6 A;  2IBZ G;  3AEB C;  2WSF J;  1NHL A;  3H1L D;  1AVY A;  1HUC A;  1PGQ A;  3L71 G;  2IZ0 A;  3GHG A;  4IL6 H;  4Y99 B;  3IF4 A;  3I55 P;  2PFX A;  2G3A A;  2BEQ D;  4IFF A;  1SQB E;  1LTI C;  1OVR A;  3Q2Y A;  3L72 E;  3CCL P;  1EZV D;  2HFE D;  3UIA A;  1LTJ A;  1N2D C;  1FOS F;  4P1B H;  2FYU K;  3CLQ A;  2QIW A;  1JCD A;  2K1A A;  1K73 Q;  1GD2 E;  3HTK B;  1KC8 Q;  1PIX A;  1JY3 O;  4PJ0 E;  2OQQ A;  2JEE A;  3MZW B;  1KB9 E;  4JF7 A;  5B66 E;  3D89 A;  4UB6 E;  5KAF H;  5KLV E;  2D2C C;  2ZT9 B;  1OVV A;  1ZR2 A;  1KIL E;  2HYN A;  1FC2 C;  4Y99 C;  1PFI A;  2ZAE B;  1ZV8 A;  3RL0 g;  5AVS B;  1NAF A;  1ZOY C;  3RK2 C;  2C9L Y;  1HJ0 A;  2KP8 A;  4JYC A;  1JM0 A;  1AFO A;  1W2B O;  1T8Z A;  2LXB A;  3BCC D;  2NWF A;  1GZL A;  4MN4 C;  2HMO A;  3IN6 A;  1L0L D;  2BCC J;  3T97 A;  4DOJ A;  1J2J B;  5CCG A;  3BVH A;  1NKN A;  3MGN A;  1VQK P;  1J1E B;  2NZ2 A;  3JC2 2;  1KB9 D;  3O6Q A;  3GKE A;  4PD4 I;  3CD6 P;  3MP7 B;  3G4S P;  3VCA A;  4B86 A;  2P67 A;  1LT9 A;  4UB8 E;  1LP1 B;  1AQ5 A;  3VCP A;  3TDK A;  4QDF B;  3VP8 A;  1NTM E;  1KFN A;  5TJH A;  1EZV G;  1BE3 D;  4W7Y A;  1PPJ G;  1OXZ A;  1KIL C;  1LTB C;  1H0T A;  1OZH A;  2QE7 H;  1KIL A;  1N7S C;  1RF0 C;  2J59 M;  2ZXE B;  3GCE A;  2Q5U A;  1M1J A;  1JB0 J;  4RJT A;  3HE4 A;  2R32 A;  3QWO C;  3DQY A;  1IC2 A;  2XR8 A;  5M1B A;  1IFM A;  2FFD A;  3IAO A;  1NU1 J;  3SSU A;  1FZF A;  2BMR A;  3U1C A;  3LW5 J;  3BCC G;  1M1J B;  1EC5 A;  4H0L B;  2R3C A;  1D7M A;  5L8R J;  2FFD B;  1H88 A;  2NPS B;  2KZI A;  2JO6 A;  3GZX A;  3HD7 B;  2Q3I A;  4OH8 B;  4TT3 H;  4NPF X;  3N7N A;  3Q3D A;  1JY3 N;  3GL2 A;  4H44 B;  3MTU E;  3OAK A;  1R8E A;  1PGP A;  4YXD C;  1YJN P;  1HF9 A;  1FZA A;  3U1A A;  1DH3 A;  1W5C E;  1SQP G;  1KZU B;  1NU1 D;  4OWF A;  2E42 A;  1BDD A;  2WT7 B;  1L0L E;  3EQ2 A;  2P7J A;  1KQF B;  4L75 A;  4GKG A;  1GW3 A;  4GDO A;  2O1J A;  2ZT9 D;  2JWA A;  3VMY A;  5HL4 A;  4OGQ D;  1PP9 G;  3LW5 H;  4NPE A;  3PJS K;  4H44 D;  4K3A A;  3AE8 C;  3H1K G;  2XSH A;  1L0N E;  1SQQ G;  4HM8 A;  1BGY G;  3L71 D;  5KLV D;  5AW5 B;  1SFC B;  3AZC A;  1BCC J;  1RHZ B;  1ZN5 A;  3MUD A;  3CCU P;  1K04 A;  2JKV A;  4ZKP A;  1OWA A;  1SQX D;  1OMI A;  2KLU A;  1JTH B;  1QGK B;  2JR8 A;  4YTP C;  4N78 E;  1X0T A;  2PAJ A;  2B9B A;  5BVZ A;  2KS1 B;  2ZFC A;  1N73 B;  2BCC D;  1T6A A;  2H7H A;  1L0L K;  3R2P A;  2GBW A;  1UUV A;  2Z4E A;  5APW A;  1GL2 D;  3V2R A;  1JNM A;  5KLV J;  1VQ8 P;  1EDJ A;  2RKL A;  4D6T E;  1HWT C;  1GU5 A;  4ASW A;  1JO5 A;  2HOD B;  1DD4 A;  2XU6 A;  4HB1 A;  4IFM A;  1USD A;  1S2E A;  1M56 D;  2YKQ A;  2CPS A;  1RE3 C;  3L73 E;  4PD4 H;  3MD0 A;  3CCR P;  2HMN A;  4XA4 A;  3HUS C;  2IBZ E;  1NTZ D;  1X79 B;  4PV1 B;  1EDK A;  1RE3 A;  3TGU E;  3L74 E;  1Q86 Q;  1YJW P;  1ZRT E;  1YHQ P;  4IOI H;  1SQP D;  1GK4 A;  1QEX A;  3L75 D;  5E79 E;  2O1K A;  2QJY B;  3JSV C;  2P2U A;  1N7S B;  4U3F E;  1Q90 D;  1BGY D;  1QVF O;  1Y47 A;  1BGY E;  1O7M A;  1EG9 A;  1JMB A;  1G8K B;  1K8A Q;  1BCC G;  3EFG A;  2QVA A;  3M0A A;  1URQ A;  1Z56 A;  1IFD A;  1S4X A;  2Y0C A;  2B87 B;  2W8Z A;  5KLI C;  1EXJ A;  3H1H G;  2JZA A;  1SQQ K;  3C0D A;  1NU1 E;  5KAI H;  1T3J A;  4CPG A;  4KT0 J;  1SLQ A;  3CCM P;  3AEG C;  4PV1 D;  1SQV G;  3FWN A;  1SQP E;  3AEC C;  1BDC A;  2E75 C;  1X22 A;  1FZG A;  3HE5 B;  3CXH I;  2HMK A;  1LTA C;  3CCS P;  1HH0 A;  1RF1 B;  1UIX A;  4I2L C;  1N86 A;  2YO2 A;  1K05 A;  2KLV A;  1RY3 A;  2JDI H;  5GTH H;  1JM1 A;  3CCJ P;  1URQ C;  2NVE A;  4W7Z A;  1RQU A;  3P8C D;  3JCU E;  2IBZ D;  1JY2 P;  1OX3 A;  5B66 H;  1HVV A;  3A7O A;  2A06 G;  1QL2 A;  3MIW A;  3W67 A;  2YXR B;  1M57 D;  5DJU B;  1P84 H;  2BMQ A;  1AQT A;  1AV1 A;  1VQ9 P;  4IL6 X;  2O01 H;  1PPJ E;  3EQQ A;  1LWU A;  1M8O B;  1O7G A;  1VF5 C;  3K5B A;  3PTZ A;  2N1T C;  1VQP P;  4NPD A;  3FX0 A;  5AVT B;  2QM7 A;  1P84 D;  3RK2 D;  2QJY C;  2ZJS E;  2WSC J;  3S4R A;  3AEF C;  2SPZ A;  1OVU A;  2H88 C;  3NXS A;  3AEA C;  3B5N C;  1MFT A;  2FYN C;  3Q5R A;  3V4Q A;  1Q81 Q;  1G8J B;  3D6Y A;  2H89 C;  1GU4 A;  3D71 A;  1FJP A;  1OW8 A;  3VN0 A;  2GUV A;  2WPS A;  2B87 A;  1LTS C;  1LT9 B;  5GTI H;  5APQ A;  3H1J D;  4UB8 H;  2KUB A;  2Z5I A;  3L70 G;  4RO0 A;  1VF5 B;  3H1L J;  2ZYA A;  1LWU C;  2KS1 A;  3KXD A;  2JO1 A;  3KDP B;  2K3R A;  4ZMD A;  3H1H J;  2HML A;  1IK7 A;  1SS1 A;  4NBH D;  5KLV K;  3AED C;  3CXH E;  3G9R A;  2P58 A;  2QRX A;  4K35 A;  1QX8 A;  5EFW B;  5AW0 B;  3EN1 A;  1LT1 A;  2A45 H;  4R4M A;  2H43 A;  2ZVO B;  2IZ1 A;  1N73 C;  1SQP K;  1LT9 C;  1JY2 O;  2KXP B;  1JMM A;  1NTK K;  2KB7 P;  5K5G B;  3P8C E;  4KHX A;  1JY2 N;  1U57 A;  1URQ B;  3TGU J;  3MUD C;  2RN0 A;  4HM5 A;  3B5N A;  4HKZ H;  1N7L A;  3FGA D;  3VMZ A;  1RE4 A;  2A06 D;  3GTE A;  1SQX J;  3SWF A;  3L72 D;  2A06 E;  2ZT9 C;  2HMJ A;  1SQB D;  3TSI A;  1O7N A;  3O8Z A;  4AQR D;  2LR2 A;  3L72 G;  2QA4 P;  1PGO A;  3KZI E;  4BXL A;  1SQQ D;  4H13 C;  1NH4 A;  2I7F A;  3L70 J;  1JY3 P;  1S1C X;  4D6T D;  2M3B A;  2DW3 A;  2W83 C;  2WTY A;  3SFD C;  1L0N D;  1BCC E;  4NBG D;  2IYP A;  4N6J A;  2ZYG A;  3CXH H;  1FDI A;  1S5L E;  2J5U A;  1LTJ B;  3VP9 A;  1NU1 G;  1FBM A;  1NJI Q;  1SFC C;  1N8R Q;  3H1H E;  1K9M Q;  4EDF A;  4LLH A;  1FJK A;  2Y0D A;  2K9J A;  2IYO A;  3AE7 C;  1KMI Z;  4HM1 A;  3GF3 A;  2KNC A;  3E1R A;  1R5S A;  4DT0 A;  1HTL C;  3CC7 P;  1QL1 A;  4NBF D;  3NFQ A;  2BMO A;  2OTJ P;  3GTS A;  1E79 H;  2QJK B;  3L75 J;  5APS A;  5CJ0 A;  2Q3E A;  2M5A A;  1LGH B;  3VMG D;  3MHV A;  4JYB A;  1EXI A;  2ZXX A;  5CCH D;  3B8E B;  1KQS O;  3GMA A;  4WB4 A;  3HE5 A;  4QDC A;  1G2C B;  4I1L A;  3I5C A;  5APY A;  1GW4 A;  2FYU G;  2YXQ B;  1WT6 A;  2E76 B;  3G6E P;  3V2P A;  3WMM 0;  3L73 G;  1OFC X;  3L74 G;  3L70 E;  3M0D C;  1S5L H;  1RF1 A;  2FFD C;  1GL2 A;  2IPP A;  4YPC A;  4HM0 A;  1SQQ J;  1SVF A;  4A7P A;  1VM9 A;  3PP5 A;  1N73 A;  4D6T G;  1KN7 A;  1ZP0 C;  2O3J A;  2R5D A;  2YMK A;  3A0B H;  3OJA B;  4GOF A;  1N7S A;  3CX5 E;  3VTP C;  5APU A;  4YXW H;  4BRY B;  1USE A;  2OYI B;  1ZME C;  2WSS H;  2NUM A;  2C0X A;  4I7Z B;  1QVG O;  1EDI A;  2N9Y B;  3RBZ A;  5AVX B;  1FZC A;  4QUP A;  1J1E C;  2H8P D;  3TK1 A;  5CBN A;  1VCK A;  2ZYD A;  5KTB A;  3E7K A;  2YO3 A;  3EWK A;  1O7P A;  2FYZ A;  3KPE A;  1BCC D;  2D2C D;  2YIU B;  2JWD A;  2NRG A;  3SWY A;  3SFE C;  2FYU J;  2XDJ A;  2C9N Y;  1OW6 A;  2A45 I;  1Y9B A;  1HJB A;  3RK2 B;  1RIE A;  5KAI E;  2KK7 A;  4QUR A;  2RMZ A;  1XTC C;  3USS A;  3AE5 C;  2Q9I A;  3AE9 C;  5AVW B;  2DE7 D;  1KB9 H;  3CWB E;  4BWN A;  1AVO A;  2WIT A;  1NU1 K;  3PRJ A;  3D70 A;  2DE5 D;  1WRG A;  1KIL D;  3PH0 A;  1L4A B;  2DE6 D;  1NTK D;  1AJY A;  1T3U A;  1LJ2 A;  1ZW0 A;  1U7M A;  2Q7C A;  4HJG H;  1DIP A;  1YIT P;  1SQV K;  2CPB A;  1NDO A;  1XTG B;  3EFF K;  5CCG D;  1A02 F;  3L36 A;  1GL2 C;  5E79 H;  1YBK A;  2K37 A;  2PP6 A;  1M7L A;  2AEJ A;  5CCH A;  5AW9 B;  3AE1 C;  2ITA A;  3GB4 A;  3GG2 A;  3W68 A;  1J1D C;  4ASV A;  2WPV B;  2MJZ A;  2M5A B;  2Q3W A;  4GOE A;  1MV8 A;  3RK3 D;  2R5B A;  4EMJ B;  1SFC D;  2FYU E;  2KIK A;  2YKP A;  3VMX A;  2FXP A;  1BSN A;  3L74 J;  2GBX A;  2GA1 A;  3N0Q A;  1L2P A;  1NYK A;  4NBB D;  2GUS A;  3AE2 C;  1SP4 A;  4NBC D;  2NUK A;  3B71 A;  3ABV C;  2P1J A;  4OGQ B;  4AUW A;  1FS0 E;  1NTK E;  5APT A;  1HGZ A;  1IJD B;  3M9H A;  5AVQ B;  3RK3 B;  3VOP A;  1NTZ E;  3C1L A;  1U7J A;  1EZV E;  5TIS H;  2NVG A;  2HLO A;  1YQ4 C;  1HBW A;  3OA7 A;  3CX5 H;  2OAR A;  4EI2 A;  5GTH E;  2K9Y A;  1CW5 A;  2PGD A;  2CKF A;  4N3Y B;  1SQX E;  1T2K D;  1VQN P;  2XNX A;  1IFP A;  1NYH A;  2B88 A;  2OYI A;  2JP3 A;  2YFI A;  1KV4 A;  3VMH D;  4L73 A;  1L0L J;  4JBZ A;  5B5E E;  4TLF A;  2KSE A;  1IFJ A;  3CC2 P;  4Y28 J;  5CBO A;  3A3Y B;  3OW2 O;  4WY4 B;  3CWB G;  2IFM A;  2IX7 C;  1EDL A;  3G3Z A;  3L75 G;  2I1J A;  4C7N A;  1SQB J;  3H1J G;  3M91 A;  2AXT H;  1NTM K;  4OGQ C;  2N1T D;  3L72 J;  5H2F H;  4HKV A;  1NKZ B;  1FU1 A;  4W80 A;  2WT7 A;  5KLV G;  2V7Q J;  3TNU A;  1NO4 A;  2YVJ B;  3A0H H;  3GW6 A;  1KYO I;  3CCE P;  4QMA A;  3U59 A;  1VL2 A;  2E76 C;  3B5N D;  5AW7 B;  3L75 E;  1KD1 Q;  4Z1M H;  1RQV A;  5AW2 B;  4C46 A;  2GM4 A;  1SQV D;  1LNQ A;  1L4A A;  1VQO P;  3CWB D;  2K9J B;  2L5G B;  4HM2 A;  1PP9 E;  3KQG A;  5AEW A;  1DEE G;  4WWI A;  2QEX P;  1H0T B;  1Q2N A;  1M1K Q;  1TU3 F;  4RES B;  4QDF A;  3KYQ A;  1VF5 D;  2XRX A;  2FKW B;  1NWQ A;  1SQX K;  5TIS E;  1MUU A;  4GT1 A;  2BEZ F;  2Z5H A;  1W2E A;  2W6B A;  3E1I A;  3VYI A;  2V4H A;  4WVZ A;  4WY4 D;  2W90 A;  2R44 A;  2FYN B;  2PRR A;  1M90 Q;  3NMD A;  1NAY A;  1IK9 A;  4HJL A;  2AEM A;  3S1K A;  3M06 A;  2WSC H;  2WVR A;  5BU5 A;  3L4F A;  4H0L C;  1VQM P;  4NB8 D;  2HPC A;  2E4Q A;  3GHG C;  3AE3 C;  1YIJ P;  2E43 A;  3HRN A;  4H13 B;  1NTM D;  3Q1M A;  2XV5 A;  3H1L E;  2O01 J;  5CCH C;  3L73 D;  2RH0 A;  3WU2 E;  2V7Q H;  2E5T A;  3Q5S A;  1IFI A;  3A2A A;  3IR9 A;  2Q1K A;  5KJ7 D;  3AEE C;  2OTL P;  2JJL A;  5C39 A;  5KKZ B;  1IZN B;  2QSI A;  3L70 D;  3RK3 E;  1QLE D;  1MFZ A;  1E5W A;  3NTN A;  3WUV A;  3H25 A;  1SQV E;  1AA0 A;  2XZR A;  1L4A C;  1GMJ A;  1YQ3 C;  2M0B A;  3CCQ P;  1S9K E;  2B89 A;  1SQB G;  5CHX A;  1KYO H;  3H1I E;  1ULI A;  3SWK A;  1VPC A;  3L71 E;  1FZE A;  2OYH A;  3GF7 A;  4AYC A;  2R3S A;  3ZDM A;  5AW1 B;  2ZVN B;  1VQ6 P;  4H44 C;  2KOG A;  2FBW C;  3BAS A;  2A45 G;  3BCC E;  3VMI D;  2XKM A;  4I6M C;  3L74 D;  2NPS A;  2I8D A;  1KQL A;  3A0H E;  1CZQ A;  2OTK E;  1M1J C;  1BGY J;  3WUU A;  2W6A A;  3V5B A;  4I7Z C;  2W27 A;  1PPJ D;  3KZI H;  1YI2 P;  3HUS A;  3H1J J;  2Q6Q A;  2WPR A;  3ITK A;  1IO4 A;  1L0N K;  1O7W A;  2L91 A;  2KI7 B;  3TGU G;  1L0N G;  3A0B E;  4L76 A;  3CC4 P;  3TF5 A;  2K88 A;  2M8R A;  4EIJ A;  1SQV J;  1CSB A;  1SQP J;  2QM8 A;  1H8A A;  1S72 P;  4C7R A;  4HM4 A;  1BE3 G;  1KB9 I;  1NTK J;  1Y8A A;  1L0L G;  4NBA D;  5BU8 B;  1FZB A;  1NTZ J;  2HG5 D;  2YFJ A;  1SQB K;  1OW7 A;  3F89 A;  4N78 D;  2HMM A;  2E4P A;  3BAT A;  3PLN A;  3TNU B;  2N1T B;  2WPQ A;  2QJP C;  2LKM A;  1ZR4 A;  1EZV I;  3V2Q A;  4RKU J;  4U3F J;  1JEK A;  4U7J A;  1GDT A;  3BRV B;  2KNC B;  3BCC J;  1KTM A;  1LTG C;  1FDM A;  2WMM A;  3M0D A;  1MKM A;  1URQ D;  2FYU D;  4U3F D;  1KYO D;  2I1K A;  2FY8 A;  4IFD K;  2G8Y A;  1BE3 E;  2FXO A;  2KYV A;  3B4S A;  4NBD D;  2YIU C;  1VQ5 P;  4WBA A;  3QH9 A;  1VQL P;  1UUW A;  3H1K E;  4C7N B;  3H1K D;  1YYC A;  1YTZ T;  1LWU B;  2E75 B;  3L71 J;  3GOB A;  2Y0E A;  1BSH A;  1YJ9 P;  1CI6 A;  2POH A;  1R5L A;  1NTM G;  1DD3 A;  2QPZ A;  1Q90 C;  3GHG B;  2C0W A;  2IFN A;  2WSE J;  3CMA P;  1DEB A;  4P1C H;  1FAV A;  2BCC G;  4QUQ A; 
#chains in the Genus database with same CATH homology
 2XRX A;  2JZA A;  4H0L D;  4HM0 A;  2E4P A;  3C0D A;  3H1I E;  1NU1 E;  3GL2 A;  1ULI A;  2E76 D;  4QCK A;  1ULJ A;  2YFI A;  1VM9 A;  2I7F A;  3L71 E;  3VMH D;  2FYN C;  5BOK A;  2QJP C;  3GKE A;  1NDO A;  4HM6 A;  4PV1 D;  1G8J B;  1SQP E;  3L73 E;  3VCA A;  5KLI C;  5KKZ C;  2HMK A;  4HJL A;  1BCC E;  4NBG D;  1FQT A;  3CX5 E;  3VCP A;  1P84 E;  1L0L E;  1SQB E;  4QDF B;  1KYO E;  2HMN A;  1NTM E;  2IBZ E;  3L72 E;  2ZT9 D;  4NB8 D;  1SJG A;  3H1H E;  3BCC E;  3GB4 A;  5HL4 A;  2NUM A;  2E4Q A;  4OGQ D;  3VMI D;  1WQL A;  2BCC E;  3TGU E;  4P1B H;  3L74 E;  1JM1 A;  2Q3W A;  4H44 D;  4QUP A;  4HM1 A;  2NVE A;  2XSH A;  5CXM A;  1BE3 E;  1L0N E;  4HM8 A;  1VCK A;  4EMJ B;  1ZRT E;  2FYU E;  4QDD A;  2HML A;  4HM3 A;  1O7H A;  4NBF D;  5AEU A;  4NBH D;  4HKV A;  3CXH E;  2BMO A;  2E75 D;  1O7P A;  3GCE A;  3H1L E;  2D2C D;  2GBX A;  3GTS A;  1KB9 E;  3N0Q A;  4NBD D;  3EN1 A;  3D89 A;  2YVJ B;  1NYK A;  2YIU C;  3AZC A;  4NBB D;  5KLV E;  1UUW A;  3H1K E;  3GL0 A;  3DQY A;  3VMG D;  4H13 D;  4AAY B;  2B1X A;  2XR8 A;  2BMQ A;  4NBC D;  2NUK A;  1O7W A;  2YFL A;  1SQQ E;  3GZY A;  1PPJ E;  3L75 E;  1NTK E;  1RIE A;  2BMR A;  3GOB A;  4QDC A;  1RFS A;  2XSO A;  3EQQ A;  4HM5 A;  1O7G A;  4QUR A;  3FOU A;  2NVF A;  4U3F E;  1NTZ E;  2DE7 D;  3GTE A;  4PD4 E;  4HM4 A;  1EZV E;  2NVG A;  1BGY E;  2A06 E;  3CWB E;  2HMJ A;  4NBE D;  1O7M A;  4HM2 A;  4NBA D;  1PP9 E;  2B24 A;  2QPZ A;  1EG9 A;  1Q90 C;  1SQV E;  1G8K B;  4AIV A;  2DE5 D;  2QJY C;  2GBW A;  1O7N A;  1UUV A;  2CKF A;  2E74 D;  2NWF A;  2QJK C;  4HM7 A;  5AEW A;  2HMM A;  1SQX E;  4NB9 D;  3H1J E;  2YFJ A;  2ZYL A;  4P1C H;  3L70 E;  2JO6 A;  2HMO A;  3GZX A;  4QUQ A;  4QDF A;  1VF5 D;  2DE6 D;  4D6T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...