5HL4A

Acoustic injectors for drop-on-demand serial femtosecond crystallography
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
401
structure length
397
Chain Sequence
TSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-hydroxylating dioxygenase
publication title Acoustic Injectors for Drop-On-Demand Serial Femtosecond Crystallography.
pubmed doi rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
total genus 108
structure length 397
sequence length 401
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5hl4A02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 5hl4A01
1EG9A 1KYOE 4NBHD 2ZT9D 4QDDA 3GCEA 1SQQE 2GBWA 5AEWA 4NBFD 4NBHA 3D89A 1VF5D 1PPJE 2YFJA 3GTSA 1G8KB 5KLIC 1Q90C 3EQQA 3L70E 4H44D 2NVGA 3VCAA 3GOBA 2BMQA 1FQTA 4NBAA 2E4QA 4NBGD 2E74D 4NBDD 2B24A 2DE7D 2JZAA 3VMGD 1SQVE 4NBGA 3FOUA 1VCKA 1BE3E 3GKEA 2DE7A 5KKZC 3VMGA 1NDOA 4PV1D 1UUVA 4NBED 2FYUE 4PD4E 1NYKA 3GZYA 1NU1E 1UUWA 1SQBE 4HM7A 3AZCA 4NBEA 1Z01A 2HMKA 1VM9A 2QPZA 4NB9D 2DE6D 3CXHE 4HM6A 1WW9A 4H13D 2NVEA 1O7HA 2ZYLA 3GL2A 1SJGA 5BOKA 1JM1A 1G8JB 2DE6A 1EZVE 2HMNA 2YFLA 2D2CD 1P84E 5HL4A 3GL0A 3H1KE 2CKFA 1NTZE 3TGUE 1PP9E 4HM8A 4NBFA 4QCKA 4H0LD 3GZXA 4HJLA 4HM5A 1NTKE 2HMMA 4HM4A 3C0DA 4NBCD 2XR8A 2JO6A 1O7PA 1L0LE 1ULJA 4QUQA 1SQPE 4U3FE 3VMHD 4QDFB 1SQXE 4NBDA 1O7GA 2YVJB 3H1LE 3VCPA 1O7NA 2NWFA 1NTME 2QJPC 3CX5E 1WQLA 1O7MA 2FYNC 3H1JE 4NB9A 2QJKC 2HMJA 4QUPA 4NBBD 2BMRA 1ZRTE 4QDCA 5AEUA 3BCCE 4P1BH 4NBBA 2GBXA 1RFSA 3L72E 2A06E 4NBCA 4HKVA 3GTEA 2NUKA 1L0NE 2BMOA 3VMHA 2HMOA 2YIUC 2B1XA 2E4PA 4OGQD 2BCCE 3EN1A 2E76D 1RIEA 3GCFA 2E75D 1Z03A 4AIVA 1ULIA 5KLVE 3N0QA 2QJYC 3L75E 3H1IE 3VMID 4NBAD 4HM1A 4AAYB 2NUMA 2Q3WA 3DQYA 3VMIA 4HM3A 2XSOA 5CXMA 2IBZE 1Z02A 3GB4A 3H1HE 1KB9E 3L74E 4NB8D 1BCCE 2NVFA 4EMJB 2I7FA 4NB8A 3GKQA 2XSHA 3CWBE 4HM0A 2DE5D 2HMLA 2XRXA 3L73E 4HM2A 3L71E 4QURA 4P1CH 1O7WA 4QDFA 2DE5A 2YFIA
chains in the Genus database with same CATH superfamily
1EG9A 1KYOE 4NBHD 2ZT9D 4QDDA 3GCEA 1SQQE 2GBWA 5AEWA 4NBFD 4NBHA 3D89A 1VF5D 1PPJE 2YFJA 3GTSA 1G8KB 5KLIC 1Q90C 3EQQA 3L70E 4H44D 2NVGA 3VCAA 3GOBA 2BMQA 1FQTA 4NBAA 2E4QA 4NBGD 2E74D 4NBDD 2B24A 2DE7D 2JZAA 3VMGD 1SQVE 4NBGA 3FOUA 1VCKA 1BE3E 3GKEA 2DE7A 5KKZC 3VMGA 1NDOA 4PV1D 1UUVA 4NBED 2FYUE 4PD4E 1NYKA 3GZYA 1NU1E 1UUWA 1SQBE 4HM7A 3AZCA 4NBEA 1Z01A 2HMKA 1VM9A 2QPZA 4NB9D 2DE6D 3CXHE 4HM6A 1WW9A 4H13D 2NVEA 1O7HA 2ZYLA 3GL2A 1SJGA 5BOKA 1JM1A 1G8JB 2DE6A 1EZVE 2HMNA 2YFLA 2D2CD 1P84E 5HL4A 3GL0A 3H1KE 2CKFA 1NTZE 3TGUE 1PP9E 4HM8A 4NBFA 4QCKA 4H0LD 3GZXA 4HJLA 4HM5A 1NTKE 2HMMA 4HM4A 3C0DA 4NBCD 2XR8A 2JO6A 1O7PA 1L0LE 1ULJA 4QUQA 1SQPE 4U3FE 3VMHD 4QDFB 1SQXE 4NBDA 1O7GA 2YVJB 3H1LE 3VCPA 1O7NA 2NWFA 1NTME 2QJPC 3CX5E 1WQLA 1O7MA 2FYNC 3H1JE 4NB9A 2QJKC 2HMJA 4QUPA 4NBBD 2BMRA 1ZRTE 4QDCA 5AEUA 3BCCE 4P1BH 4NBBA 2GBXA 1RFSA 3L72E 2A06E 4NBCA 4HKVA 3GTEA 2NUKA 1L0NE 2BMOA 3VMHA 2HMOA 2YIUC 2B1XA 2E4PA 4OGQD 2BCCE 3EN1A 2E76D 1RIEA 3GCFA 2E75D 1Z03A 4AIVA 1ULIA 5KLVE 3N0QA 2QJYC 3L75E 3H1IE 3VMID 4NBAD 4HM1A 4AAYB 2NUMA 2Q3WA 3DQYA 3VMIA 4HM3A 2XSOA 5CXMA 2IBZE 1Z02A 3GB4A 3H1HE 1KB9E 3L74E 4NB8D 1BCCE 2NVFA 4EMJB 2I7FA 4NB8A 3GKQA 2XSHA 3CWBE 4HM0A 2DE5D 2HMLA 2XRXA 3L73E 4HM2A 3L71E 4QURA 4P1CH 1O7WA 4QDFA 2DE5A 2YFIA
chains in the Genus database with same CATH topology
1EG9A 1KYOE 4NBHD 2ZT9D 4QDDA 3GCEA 1SQQE 2GBWA 5AEWA 4NBFD 4NBHA 3D89A 1VF5D 1PPJE 2YFJA 3GTSA 1G8KB 5KLIC 1Q90C 3EQQA 3L70E 4H44D 2NVGA 3VCAA 3GOBA 2BMQA 1FQTA 4NBAA 2E4QA 4NBGD 2E74D 4NBDD 2B24A 2DE7D 2JZAA 3VMGD 1SQVE 4NBGA 3FOUA 1VCKA 1BE3E 3GKEA 2DE7A 5KKZC 3VMGA 1NDOA 4PV1D 1UUVA 4NBED 2FYUE 4PD4E 1NYKA 3GZYA 1NU1E 1UUWA 1SQBE 4HM7A 3AZCA 4NBEA 1Z01A 2HMKA 1VM9A 2QPZA 4NB9D 2DE6D 3CXHE 4HM6A 1WW9A 4H13D 2NVEA 1O7HA 2ZYLA 3GL2A 1SJGA 5BOKA 1JM1A 1G8JB 2DE6A 1EZVE 2HMNA 2YFLA 2D2CD 1P84E 5HL4A 3GL0A 3H1KE 2CKFA 1NTZE 3TGUE 1PP9E 4HM8A 4NBFA 4QCKA 4H0LD 3GZXA 4HJLA 4HM5A 1NTKE 2HMMA 4HM4A 3C0DA 4NBCD 2XR8A 2JO6A 1O7PA 1L0LE 1ULJA 4QUQA 1SQPE 4U3FE 3VMHD 4QDFB 1SQXE 4NBDA 1O7GA 2YVJB 3H1LE 3VCPA 1O7NA 2NWFA 1NTME 2QJPC 3CX5E 1WQLA 1O7MA 2FYNC 3H1JE 4NB9A 2QJKC 2HMJA 4QUPA 4NBBD 2BMRA 1ZRTE 4QDCA 5AEUA 3BCCE 4P1BH 4NBBA 2GBXA 1RFSA 3L72E 2A06E 4NBCA 4HKVA 3GTEA 2NUKA 1L0NE 2BMOA 3VMHA 2HMOA 2YIUC 2B1XA 2E4PA 4OGQD 2BCCE 3EN1A 2E76D 1RIEA 3GCFA 2E75D 1Z03A 4AIVA 1ULIA 5KLVE 3N0QA 2QJYC 3L75E 3H1IE 3VMID 4NBAD 4HM1A 4AAYB 2NUMA 2Q3WA 3DQYA 3VMIA 4HM3A 2XSOA 5CXMA 2IBZE 1Z02A 3GB4A 3H1HE 1KB9E 3L74E 4NB8D 1BCCE 2NVFA 4EMJB 2I7FA 4NB8A 3GKQA 2XSHA 3CWBE 4HM0A 2DE5D 2HMLA 2XRXA 3L73E 4HM2A 3L71E 4QURA 4P1CH 1O7WA 4QDFA 2DE5A 2YFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG9 A;  1KYO E;  4NBH D;  2ZT9 D;  4QDD A;  3GCE A;  1SQQ E;  2GBW A;  5AEW A;  4NBF D;  4NBH A;  3D89 A;  1VF5 D;  1PPJ E;  2YFJ A;  3GTS A;  1G8K B;  5KLI C;  1Q90 C;  3EQQ A;  3L70 E;  4H44 D;  2NVG A;  3VCA A;  3GOB A;  2BMQ A;  1FQT A;  4NBA A;  2E4Q A;  4NBG D;  2E74 D;  4NBD D;  2B24 A;  2DE7 D;  2JZA A;  3VMG D;  1SQV E;  4NBG A;  3FOU A;  1VCK A;  1BE3 E;  3GKE A;  2DE7 A;  5KKZ C;  3VMG A;  1NDO A;  4PV1 D;  1UUV A;  4NBE D;  2FYU E;  4PD4 E;  1NYK A;  3GZY A;  1NU1 E;  1UUW A;  1SQB E;  4HM7 A;  3AZC A;  4NBE A;  1Z01 A;  2HMK A;  1VM9 A;  2QPZ A;  4NB9 D;  2DE6 D;  3CXH E;  4HM6 A;  1WW9 A;  4H13 D;  2NVE A;  1O7H A;  2ZYL A;  3GL2 A;  1SJG A;  5BOK A;  1JM1 A;  1G8J B;  2DE6 A;  1EZV E;  2HMN A;  2YFL A;  2D2C D;  1P84 E;  5HL4 A;  3GL0 A;  3H1K E;  2CKF A;  1NTZ E;  3TGU E;  1PP9 E;  4HM8 A;  4NBF A;  4QCK A;  4H0L D;  3GZX A;  4HJL A;  4HM5 A;  1NTK E;  2HMM A;  4HM4 A;  3C0D A;  4NBC D;  2XR8 A;  2JO6 A;  1O7P A;  1L0L E;  1ULJ A;  4QUQ A;  1SQP E;  4U3F E;  3VMH D;  4QDF B;  1SQX E;  4NBD A;  1O7G A;  2YVJ B;  3H1L E;  3VCP A;  1O7N A;  2NWF A;  1NTM E;  2QJP C;  3CX5 E;  1WQL A;  1O7M A;  2FYN C;  3H1J E;  4NB9 A;  2QJK C;  2HMJ A;  4QUP A;  4NBB D;  2BMR A;  1ZRT E;  4QDC A;  5AEU A;  3BCC E;  4P1B H;  4NBB A;  2GBX A;  1RFS A;  3L72 E;  2A06 E;  4NBC A;  4HKV A;  3GTE A;  2NUK A;  1L0N E;  2BMO A;  3VMH A;  2HMO A;  2YIU C;  2B1X A;  2E4P A;  4OGQ D;  2BCC E;  3EN1 A;  2E76 D;  1RIE A;  3GCF A;  2E75 D;  1Z03 A;  4AIV A;  1ULI A;  5KLV E;  3N0Q A;  2QJY C;  3L75 E;  3H1I E;  3VMI D;  4NBA D;  4HM1 A;  4AAY B;  2NUM A;  2Q3W A;  3DQY A;  3VMI A;  4HM3 A;  2XSO A;  5CXM A;  2IBZ E;  1Z02 A;  3GB4 A;  3H1H E;  1KB9 E;  3L74 E;  4NB8 D;  1BCC E;  2NVF A;  4EMJ B;  2I7F A;  4NB8 A;  3GKQ A;  2XSH A;  3CWB E;  4HM0 A;  2DE5 D;  2HML A;  2XRX A;  3L73 E;  4HM2 A;  3L71 E;  4QUR A;  4P1C H;  1O7W A;  4QDF A;  2DE5 A;  2YFI A; 
#chains in the Genus database with same CATH topology
 1EG9 A;  1KYO E;  4NBH D;  2ZT9 D;  4QDD A;  3GCE A;  1SQQ E;  2GBW A;  5AEW A;  4NBF D;  4NBH A;  3D89 A;  1VF5 D;  1PPJ E;  2YFJ A;  3GTS A;  1G8K B;  5KLI C;  1Q90 C;  3EQQ A;  3L70 E;  4H44 D;  2NVG A;  3VCA A;  3GOB A;  2BMQ A;  1FQT A;  4NBA A;  2E4Q A;  4NBG D;  2E74 D;  4NBD D;  2B24 A;  2DE7 D;  2JZA A;  3VMG D;  1SQV E;  4NBG A;  3FOU A;  1VCK A;  1BE3 E;  3GKE A;  2DE7 A;  5KKZ C;  3VMG A;  1NDO A;  4PV1 D;  1UUV A;  4NBE D;  2FYU E;  4PD4 E;  1NYK A;  3GZY A;  1NU1 E;  1UUW A;  1SQB E;  4HM7 A;  3AZC A;  4NBE A;  1Z01 A;  2HMK A;  1VM9 A;  2QPZ A;  4NB9 D;  2DE6 D;  3CXH E;  4HM6 A;  1WW9 A;  4H13 D;  2NVE A;  1O7H A;  2ZYL A;  3GL2 A;  1SJG A;  5BOK A;  1JM1 A;  1G8J B;  2DE6 A;  1EZV E;  2HMN A;  2YFL A;  2D2C D;  1P84 E;  5HL4 A;  3GL0 A;  3H1K E;  2CKF A;  1NTZ E;  3TGU E;  1PP9 E;  4HM8 A;  4NBF A;  4QCK A;  4H0L D;  3GZX A;  4HJL A;  4HM5 A;  1NTK E;  2HMM A;  4HM4 A;  3C0D A;  4NBC D;  2XR8 A;  2JO6 A;  1O7P A;  1L0L E;  1ULJ A;  4QUQ A;  1SQP E;  4U3F E;  3VMH D;  4QDF B;  1SQX E;  4NBD A;  1O7G A;  2YVJ B;  3H1L E;  3VCP A;  1O7N A;  2NWF A;  1NTM E;  2QJP C;  3CX5 E;  1WQL A;  1O7M A;  2FYN C;  3H1J E;  4NB9 A;  2QJK C;  2HMJ A;  4QUP A;  4NBB D;  2BMR A;  1ZRT E;  4QDC A;  5AEU A;  3BCC E;  4P1B H;  4NBB A;  2GBX A;  1RFS A;  3L72 E;  2A06 E;  4NBC A;  4HKV A;  3GTE A;  2NUK A;  1L0N E;  2BMO A;  3VMH A;  2HMO A;  2YIU C;  2B1X A;  2E4P A;  4OGQ D;  2BCC E;  3EN1 A;  2E76 D;  1RIE A;  3GCF A;  2E75 D;  1Z03 A;  4AIV A;  1ULI A;  5KLV E;  3N0Q A;  2QJY C;  3L75 E;  3H1I E;  3VMI D;  4NBA D;  4HM1 A;  4AAY B;  2NUM A;  2Q3W A;  3DQY A;  3VMI A;  4HM3 A;  2XSO A;  5CXM A;  2IBZ E;  1Z02 A;  3GB4 A;  3H1H E;  1KB9 E;  3L74 E;  4NB8 D;  1BCC E;  2NVF A;  4EMJ B;  2I7F A;  4NB8 A;  3GKQ A;  2XSH A;  3CWB E;  4HM0 A;  2DE5 D;  2HML A;  2XRX A;  3L73 E;  4HM2 A;  3L71 E;  4QUR A;  4P1C H;  1O7W A;  4QDF A;  2DE5 A;  2YFI A; 
#chains in the Genus database with same CATH homology
 1EG9 A;  1KYO E;  4NBH D;  2ZT9 D;  4QDD A;  3GCE A;  1SQQ E;  2GBW A;  5AEW A;  4NBF D;  4NBH A;  3D89 A;  1VF5 D;  1PPJ E;  2YFJ A;  3GTS A;  1G8K B;  5KLI C;  1Q90 C;  3EQQ A;  3L70 E;  4H44 D;  2NVG A;  3VCA A;  3GOB A;  2BMQ A;  1FQT A;  4NBA A;  2E4Q A;  4NBG D;  2E74 D;  4NBD D;  2B24 A;  2DE7 D;  2JZA A;  3VMG D;  1SQV E;  4NBG A;  3FOU A;  1VCK A;  1BE3 E;  3GKE A;  2DE7 A;  5KKZ C;  3VMG A;  1NDO A;  4PV1 D;  1UUV A;  4NBE D;  2FYU E;  4PD4 E;  1NYK A;  3GZY A;  1NU1 E;  1UUW A;  1SQB E;  4HM7 A;  3AZC A;  4NBE A;  1Z01 A;  2HMK A;  1VM9 A;  2QPZ A;  4NB9 D;  2DE6 D;  3CXH E;  4HM6 A;  1WW9 A;  4H13 D;  2NVE A;  1O7H A;  2ZYL A;  3GL2 A;  1SJG A;  5BOK A;  1JM1 A;  1G8J B;  2DE6 A;  1EZV E;  2HMN A;  2YFL A;  2D2C D;  1P84 E;  5HL4 A;  3GL0 A;  3H1K E;  2CKF A;  1NTZ E;  3TGU E;  1PP9 E;  4HM8 A;  4NBF A;  4QCK A;  4H0L D;  3GZX A;  4HJL A;  4HM5 A;  1NTK E;  2HMM A;  4HM4 A;  3C0D A;  4NBC D;  2XR8 A;  2JO6 A;  1O7P A;  1L0L E;  1ULJ A;  4QUQ A;  1SQP E;  4U3F E;  3VMH D;  4QDF B;  1SQX E;  4NBD A;  1O7G A;  2YVJ B;  3H1L E;  3VCP A;  1O7N A;  2NWF A;  1NTM E;  2QJP C;  3CX5 E;  1WQL A;  1O7M A;  2FYN C;  3H1J E;  4NB9 A;  2QJK C;  2HMJ A;  4QUP A;  4NBB D;  2BMR A;  1ZRT E;  4QDC A;  5AEU A;  3BCC E;  4P1B H;  4NBB A;  2GBX A;  1RFS A;  3L72 E;  2A06 E;  4NBC A;  4HKV A;  3GTE A;  2NUK A;  1L0N E;  2BMO A;  3VMH A;  2HMO A;  2YIU C;  2B1X A;  2E4P A;  4OGQ D;  2BCC E;  3EN1 A;  2E76 D;  1RIE A;  3GCF A;  2E75 D;  1Z03 A;  4AIV A;  1ULI A;  5KLV E;  3N0Q A;  2QJY C;  3L75 E;  3H1I E;  3VMI D;  4NBA D;  4HM1 A;  4AAY B;  2NUM A;  2Q3W A;  3DQY A;  3VMI A;  4HM3 A;  2XSO A;  5CXM A;  2IBZ E;  1Z02 A;  3GB4 A;  3H1H E;  1KB9 E;  3L74 E;  4NB8 D;  1BCC E;  2NVF A;  4EMJ B;  2I7F A;  4NB8 A;  3GKQ A;  2XSH A;  3CWB E;  4HM0 A;  2DE5 D;  2HML A;  2XRX A;  3L73 E;  4HM2 A;  3L71 E;  4QUR A;  4P1C H;  1O7W A;  4QDF A;  2DE5 A;  2YFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...