3VCAA

Quaternary ammonium oxidative demethylation: x-ray crystallographic, resonance raman and uv-visible spectroscopic analysis of a rieske-type demethylase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
401
structure length
397
Chain Sequence
TSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ring-hydroxylating dioxygenase
publication title Quaternary Ammonium Oxidative Demethylation: X-ray Crystallographic, Resonance Raman, and UV-Visible Spectroscopic Analysis of a Rieske-Type Demethylase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 124
structure length 397
sequence length 401
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3vcaA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 3vcaA01
3VMHA 3L71E 2QPZA 1O7MA 2NUMA 3FOUA 3L75E 2YIUC 4EMJB 2IBZE 3CX5E 2NUKA 2DE7D 1PPJE 2E4QA 1SQBE 2HMOA 3DQYA 4HM4A 5BOKA 4PD4E 4NBEA 4QURA 3L73E 4OGQD 1O7WA 4QUQA 1Z02A 3VMGD 5AEUA 3GL2A 1RFSA 3VMID 5CXMA 5KLIC 2DE7A 2DE5A 1Z03A 2NWFA 4AAYB 1SJGA 1SQQE 2DE6A 5KLVE 4NBAD 3VMGA 2I7FA 3BCCE 1O7NA 3GKEA 1VM9A 2YVJB 2JO6A 3GTEA 3L74E 2BMRA 2JZAA 1NDOA 3H1HE 4QDCA 2QJYC 5AEWA 4HM6A 4QUPA 1ULIA 2GBWA 4NB8D 2B24A 2DE5D 4NBAA 2YFLA 1G8JB 4NBCD 1O7HA 4HM2A 4HJLA 1L0LE 1ULJA 2DE6D 2HMLA 2XR8A 2XSHA 4P1BH 5KKZC 3TGUE 1ZRTE 2BMOA 2XRXA 1EG9A 3C0DA 1L0NE 1VCKA 3CXHE 2BCCE 1SQXE 1Z01A 1KYOE 4NB8A 1FQTA 1P84E 4HM5A 4NBCA 4PV1D 4HM0A 1BE3E 1VF5D 1KB9E 4NBGD 4QDFA 1O7PA 4HM7A 4HM8A 1NU1E 2E4PA 4QCKA 2QJKC 3L70E 2FYNC 1NTME 2YFJA 2XSOA 3N0QA 2GBXA 1NYKA 1WQLA 2E74D 4NBGA 3H1IE 2HMMA 1NTKE 2Q3WA 4QDDA 3EQQA 2HMJA 2E76D 3H1LE 1RIEA 4NBFA 3GKQA 3GZXA 1EZVE 3GZYA 2D2CD 3H1JE 4QDFB 2QJPC 1SQPE 4H44D 3AZCA 3EN1A 4AIVA 3GCFA 4P1CH 5HL4A 3GTSA 3VCAA 4NBDD 3D89A 4NBBA 1UUVA 2CKFA 1O7GA 1SQVE 4H0LD 3L72E 1NTZE 1WW9A 1BCCE 2NVFA 4H13D 4NB9A 3GL0A 1PP9E 2NVGA 3GOBA 3CWBE 4NBDA 3H1KE 2A06E 2ZYLA 3VCPA 4HM3A 4NBHD 2B1XA 4NBED 1G8KB 2E75D 3VMHD 4NBFD 4NBBD 4U3FE 4HKVA 2HMKA 2ZT9D 2HMNA 2NVEA 1Q90C 3GCEA 1JM1A 3GB4A 4NB9D 3VMIA 4NBHA 2YFIA 1UUWA 2BMQA 4HM1A 2FYUE
chains in the Genus database with same CATH superfamily
3VMHA 3L71E 2QPZA 1O7MA 2NUMA 3FOUA 3L75E 2YIUC 4EMJB 2IBZE 3CX5E 2NUKA 2DE7D 1PPJE 2E4QA 1SQBE 2HMOA 3DQYA 4HM4A 5BOKA 4PD4E 4NBEA 4QURA 3L73E 4OGQD 1O7WA 4QUQA 1Z02A 3VMGD 5AEUA 3GL2A 1RFSA 3VMID 5CXMA 5KLIC 2DE7A 2DE5A 1Z03A 2NWFA 4AAYB 1SJGA 1SQQE 2DE6A 5KLVE 4NBAD 3VMGA 2I7FA 3BCCE 1O7NA 3GKEA 1VM9A 2YVJB 2JO6A 3GTEA 3L74E 2BMRA 2JZAA 1NDOA 3H1HE 4QDCA 2QJYC 5AEWA 4HM6A 4QUPA 1ULIA 2GBWA 4NB8D 2B24A 2DE5D 4NBAA 2YFLA 1G8JB 4NBCD 1O7HA 4HM2A 4HJLA 1L0LE 1ULJA 2DE6D 2HMLA 2XR8A 2XSHA 4P1BH 5KKZC 3TGUE 1ZRTE 2BMOA 2XRXA 1EG9A 3C0DA 1L0NE 1VCKA 3CXHE 2BCCE 1SQXE 1Z01A 1KYOE 4NB8A 1FQTA 1P84E 4HM5A 4NBCA 4PV1D 4HM0A 1BE3E 1VF5D 1KB9E 4NBGD 4QDFA 1O7PA 4HM7A 4HM8A 1NU1E 2E4PA 4QCKA 2QJKC 3L70E 2FYNC 1NTME 2YFJA 2XSOA 3N0QA 2GBXA 1NYKA 1WQLA 2E74D 4NBGA 3H1IE 2HMMA 1NTKE 2Q3WA 4QDDA 3EQQA 2HMJA 2E76D 3H1LE 1RIEA 4NBFA 3GKQA 3GZXA 1EZVE 3GZYA 2D2CD 3H1JE 4QDFB 2QJPC 1SQPE 4H44D 3AZCA 3EN1A 4AIVA 3GCFA 4P1CH 5HL4A 3GTSA 3VCAA 4NBDD 3D89A 4NBBA 1UUVA 2CKFA 1O7GA 1SQVE 4H0LD 3L72E 1NTZE 1WW9A 1BCCE 2NVFA 4H13D 4NB9A 3GL0A 1PP9E 2NVGA 3GOBA 3CWBE 4NBDA 3H1KE 2A06E 2ZYLA 3VCPA 4HM3A 4NBHD 2B1XA 4NBED 1G8KB 2E75D 3VMHD 4NBFD 4NBBD 4U3FE 4HKVA 2HMKA 2ZT9D 2HMNA 2NVEA 1Q90C 3GCEA 1JM1A 3GB4A 4NB9D 3VMIA 4NBHA 2YFIA 1UUWA 2BMQA 4HM1A 2FYUE
chains in the Genus database with same CATH topology
3VMHA 3L71E 2QPZA 1O7MA 2NUMA 3FOUA 3L75E 2YIUC 4EMJB 2IBZE 3CX5E 2NUKA 2DE7D 1PPJE 2E4QA 1SQBE 2HMOA 3DQYA 4HM4A 5BOKA 4PD4E 4NBEA 4QURA 3L73E 4OGQD 1O7WA 4QUQA 1Z02A 3VMGD 5AEUA 3GL2A 1RFSA 3VMID 5CXMA 5KLIC 2DE7A 2DE5A 1Z03A 2NWFA 4AAYB 1SJGA 1SQQE 2DE6A 5KLVE 4NBAD 3VMGA 2I7FA 3BCCE 1O7NA 3GKEA 1VM9A 2YVJB 2JO6A 3GTEA 3L74E 2BMRA 2JZAA 1NDOA 3H1HE 4QDCA 2QJYC 5AEWA 4HM6A 4QUPA 1ULIA 2GBWA 4NB8D 2B24A 2DE5D 4NBAA 2YFLA 1G8JB 4NBCD 1O7HA 4HM2A 4HJLA 1L0LE 1ULJA 2DE6D 2HMLA 2XR8A 2XSHA 4P1BH 5KKZC 3TGUE 1ZRTE 2BMOA 2XRXA 1EG9A 3C0DA 1L0NE 1VCKA 3CXHE 2BCCE 1SQXE 1Z01A 1KYOE 4NB8A 1FQTA 1P84E 4HM5A 4NBCA 4PV1D 4HM0A 1BE3E 1VF5D 1KB9E 4NBGD 4QDFA 1O7PA 4HM7A 4HM8A 1NU1E 2E4PA 4QCKA 2QJKC 3L70E 2FYNC 1NTME 2YFJA 2XSOA 3N0QA 2GBXA 1NYKA 1WQLA 2E74D 4NBGA 3H1IE 2HMMA 1NTKE 2Q3WA 4QDDA 3EQQA 2HMJA 2E76D 3H1LE 1RIEA 4NBFA 3GKQA 3GZXA 1EZVE 3GZYA 2D2CD 3H1JE 4QDFB 2QJPC 1SQPE 4H44D 3AZCA 3EN1A 4AIVA 3GCFA 4P1CH 5HL4A 3GTSA 3VCAA 4NBDD 3D89A 4NBBA 1UUVA 2CKFA 1O7GA 1SQVE 4H0LD 3L72E 1NTZE 1WW9A 1BCCE 2NVFA 4H13D 4NB9A 3GL0A 1PP9E 2NVGA 3GOBA 3CWBE 4NBDA 3H1KE 2A06E 2ZYLA 3VCPA 4HM3A 4NBHD 2B1XA 4NBED 1G8KB 2E75D 3VMHD 4NBFD 4NBBD 4U3FE 4HKVA 2HMKA 2ZT9D 2HMNA 2NVEA 1Q90C 3GCEA 1JM1A 3GB4A 4NB9D 3VMIA 4NBHA 2YFIA 1UUWA 2BMQA 4HM1A 2FYUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMH A;  3L71 E;  2QPZ A;  1O7M A;  2NUM A;  3FOU A;  3L75 E;  2YIU C;  4EMJ B;  2IBZ E;  3CX5 E;  2NUK A;  2DE7 D;  1PPJ E;  2E4Q A;  1SQB E;  2HMO A;  3DQY A;  4HM4 A;  5BOK A;  4PD4 E;  4NBE A;  4QUR A;  3L73 E;  4OGQ D;  1O7W A;  4QUQ A;  1Z02 A;  3VMG D;  5AEU A;  3GL2 A;  1RFS A;  3VMI D;  5CXM A;  5KLI C;  2DE7 A;  2DE5 A;  1Z03 A;  2NWF A;  4AAY B;  1SJG A;  1SQQ E;  2DE6 A;  5KLV E;  4NBA D;  3VMG A;  2I7F A;  3BCC E;  1O7N A;  3GKE A;  1VM9 A;  2YVJ B;  2JO6 A;  3GTE A;  3L74 E;  2BMR A;  2JZA A;  1NDO A;  3H1H E;  4QDC A;  2QJY C;  5AEW A;  4HM6 A;  4QUP A;  1ULI A;  2GBW A;  4NB8 D;  2B24 A;  2DE5 D;  4NBA A;  2YFL A;  1G8J B;  4NBC D;  1O7H A;  4HM2 A;  4HJL A;  1L0L E;  1ULJ A;  2DE6 D;  2HML A;  2XR8 A;  2XSH A;  4P1B H;  5KKZ C;  3TGU E;  1ZRT E;  2BMO A;  2XRX A;  1EG9 A;  3C0D A;  1L0N E;  1VCK A;  3CXH E;  2BCC E;  1SQX E;  1Z01 A;  1KYO E;  4NB8 A;  1FQT A;  1P84 E;  4HM5 A;  4NBC A;  4PV1 D;  4HM0 A;  1BE3 E;  1VF5 D;  1KB9 E;  4NBG D;  4QDF A;  1O7P A;  4HM7 A;  4HM8 A;  1NU1 E;  2E4P A;  4QCK A;  2QJK C;  3L70 E;  2FYN C;  1NTM E;  2YFJ A;  2XSO A;  3N0Q A;  2GBX A;  1NYK A;  1WQL A;  2E74 D;  4NBG A;  3H1I E;  2HMM A;  1NTK E;  2Q3W A;  4QDD A;  3EQQ A;  2HMJ A;  2E76 D;  3H1L E;  1RIE A;  4NBF A;  3GKQ A;  3GZX A;  1EZV E;  3GZY A;  2D2C D;  3H1J E;  4QDF B;  2QJP C;  1SQP E;  4H44 D;  3AZC A;  3EN1 A;  4AIV A;  3GCF A;  4P1C H;  5HL4 A;  3GTS A;  3VCA A;  4NBD D;  3D89 A;  4NBB A;  1UUV A;  2CKF A;  1O7G A;  1SQV E;  4H0L D;  3L72 E;  1NTZ E;  1WW9 A;  1BCC E;  2NVF A;  4H13 D;  4NB9 A;  3GL0 A;  1PP9 E;  2NVG A;  3GOB A;  3CWB E;  4NBD A;  3H1K E;  2A06 E;  2ZYL A;  3VCP A;  4HM3 A;  4NBH D;  2B1X A;  4NBE D;  1G8K B;  2E75 D;  3VMH D;  4NBF D;  4NBB D;  4U3F E;  4HKV A;  2HMK A;  2ZT9 D;  2HMN A;  2NVE A;  1Q90 C;  3GCE A;  1JM1 A;  3GB4 A;  4NB9 D;  3VMI A;  4NBH A;  2YFI A;  1UUW A;  2BMQ A;  4HM1 A;  2FYU E; 
#chains in the Genus database with same CATH topology
 3VMH A;  3L71 E;  2QPZ A;  1O7M A;  2NUM A;  3FOU A;  3L75 E;  2YIU C;  4EMJ B;  2IBZ E;  3CX5 E;  2NUK A;  2DE7 D;  1PPJ E;  2E4Q A;  1SQB E;  2HMO A;  3DQY A;  4HM4 A;  5BOK A;  4PD4 E;  4NBE A;  4QUR A;  3L73 E;  4OGQ D;  1O7W A;  4QUQ A;  1Z02 A;  3VMG D;  5AEU A;  3GL2 A;  1RFS A;  3VMI D;  5CXM A;  5KLI C;  2DE7 A;  2DE5 A;  1Z03 A;  2NWF A;  4AAY B;  1SJG A;  1SQQ E;  2DE6 A;  5KLV E;  4NBA D;  3VMG A;  2I7F A;  3BCC E;  1O7N A;  3GKE A;  1VM9 A;  2YVJ B;  2JO6 A;  3GTE A;  3L74 E;  2BMR A;  2JZA A;  1NDO A;  3H1H E;  4QDC A;  2QJY C;  5AEW A;  4HM6 A;  4QUP A;  1ULI A;  2GBW A;  4NB8 D;  2B24 A;  2DE5 D;  4NBA A;  2YFL A;  1G8J B;  4NBC D;  1O7H A;  4HM2 A;  4HJL A;  1L0L E;  1ULJ A;  2DE6 D;  2HML A;  2XR8 A;  2XSH A;  4P1B H;  5KKZ C;  3TGU E;  1ZRT E;  2BMO A;  2XRX A;  1EG9 A;  3C0D A;  1L0N E;  1VCK A;  3CXH E;  2BCC E;  1SQX E;  1Z01 A;  1KYO E;  4NB8 A;  1FQT A;  1P84 E;  4HM5 A;  4NBC A;  4PV1 D;  4HM0 A;  1BE3 E;  1VF5 D;  1KB9 E;  4NBG D;  4QDF A;  1O7P A;  4HM7 A;  4HM8 A;  1NU1 E;  2E4P A;  4QCK A;  2QJK C;  3L70 E;  2FYN C;  1NTM E;  2YFJ A;  2XSO A;  3N0Q A;  2GBX A;  1NYK A;  1WQL A;  2E74 D;  4NBG A;  3H1I E;  2HMM A;  1NTK E;  2Q3W A;  4QDD A;  3EQQ A;  2HMJ A;  2E76 D;  3H1L E;  1RIE A;  4NBF A;  3GKQ A;  3GZX A;  1EZV E;  3GZY A;  2D2C D;  3H1J E;  4QDF B;  2QJP C;  1SQP E;  4H44 D;  3AZC A;  3EN1 A;  4AIV A;  3GCF A;  4P1C H;  5HL4 A;  3GTS A;  3VCA A;  4NBD D;  3D89 A;  4NBB A;  1UUV A;  2CKF A;  1O7G A;  1SQV E;  4H0L D;  3L72 E;  1NTZ E;  1WW9 A;  1BCC E;  2NVF A;  4H13 D;  4NB9 A;  3GL0 A;  1PP9 E;  2NVG A;  3GOB A;  3CWB E;  4NBD A;  3H1K E;  2A06 E;  2ZYL A;  3VCP A;  4HM3 A;  4NBH D;  2B1X A;  4NBE D;  1G8K B;  2E75 D;  3VMH D;  4NBF D;  4NBB D;  4U3F E;  4HKV A;  2HMK A;  2ZT9 D;  2HMN A;  2NVE A;  1Q90 C;  3GCE A;  1JM1 A;  3GB4 A;  4NB9 D;  3VMI A;  4NBH A;  2YFI A;  1UUW A;  2BMQ A;  4HM1 A;  2FYU E; 
#chains in the Genus database with same CATH homology
 3VMH A;  3L71 E;  2QPZ A;  1O7M A;  2NUM A;  3FOU A;  3L75 E;  2YIU C;  4EMJ B;  2IBZ E;  3CX5 E;  2NUK A;  2DE7 D;  1PPJ E;  2E4Q A;  1SQB E;  2HMO A;  3DQY A;  4HM4 A;  5BOK A;  4PD4 E;  4NBE A;  4QUR A;  3L73 E;  4OGQ D;  1O7W A;  4QUQ A;  1Z02 A;  3VMG D;  5AEU A;  3GL2 A;  1RFS A;  3VMI D;  5CXM A;  5KLI C;  2DE7 A;  2DE5 A;  1Z03 A;  2NWF A;  4AAY B;  1SJG A;  1SQQ E;  2DE6 A;  5KLV E;  4NBA D;  3VMG A;  2I7F A;  3BCC E;  1O7N A;  3GKE A;  1VM9 A;  2YVJ B;  2JO6 A;  3GTE A;  3L74 E;  2BMR A;  2JZA A;  1NDO A;  3H1H E;  4QDC A;  2QJY C;  5AEW A;  4HM6 A;  4QUP A;  1ULI A;  2GBW A;  4NB8 D;  2B24 A;  2DE5 D;  4NBA A;  2YFL A;  1G8J B;  4NBC D;  1O7H A;  4HM2 A;  4HJL A;  1L0L E;  1ULJ A;  2DE6 D;  2HML A;  2XR8 A;  2XSH A;  4P1B H;  5KKZ C;  3TGU E;  1ZRT E;  2BMO A;  2XRX A;  1EG9 A;  3C0D A;  1L0N E;  1VCK A;  3CXH E;  2BCC E;  1SQX E;  1Z01 A;  1KYO E;  4NB8 A;  1FQT A;  1P84 E;  4HM5 A;  4NBC A;  4PV1 D;  4HM0 A;  1BE3 E;  1VF5 D;  1KB9 E;  4NBG D;  4QDF A;  1O7P A;  4HM7 A;  4HM8 A;  1NU1 E;  2E4P A;  4QCK A;  2QJK C;  3L70 E;  2FYN C;  1NTM E;  2YFJ A;  2XSO A;  3N0Q A;  2GBX A;  1NYK A;  1WQL A;  2E74 D;  4NBG A;  3H1I E;  2HMM A;  1NTK E;  2Q3W A;  4QDD A;  3EQQ A;  2HMJ A;  2E76 D;  3H1L E;  1RIE A;  4NBF A;  3GKQ A;  3GZX A;  1EZV E;  3GZY A;  2D2C D;  3H1J E;  4QDF B;  2QJP C;  1SQP E;  4H44 D;  3AZC A;  3EN1 A;  4AIV A;  3GCF A;  4P1C H;  5HL4 A;  3GTS A;  3VCA A;  4NBD D;  3D89 A;  4NBB A;  1UUV A;  2CKF A;  1O7G A;  1SQV E;  4H0L D;  3L72 E;  1NTZ E;  1WW9 A;  1BCC E;  2NVF A;  4H13 D;  4NB9 A;  3GL0 A;  1PP9 E;  2NVG A;  3GOB A;  3CWB E;  4NBD A;  3H1K E;  2A06 E;  2ZYL A;  3VCP A;  4HM3 A;  4NBH D;  2B1X A;  4NBE D;  1G8K B;  2E75 D;  3VMH D;  4NBF D;  4NBB D;  4U3F E;  4HKV A;  2HMK A;  2ZT9 D;  2HMN A;  2NVE A;  1Q90 C;  3GCE A;  1JM1 A;  3GB4 A;  4NB9 D;  3VMI A;  4NBH A;  2YFI A;  1UUW A;  2BMQ A;  4HM1 A;  2FYU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...