3VCAA

Quaternary ammonium oxidative demethylation: x-ray crystallographic, resonance raman and uv-visible spectroscopic analysis of a rieske-type demethylase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
401
structure length
397
Chain Sequence
b'TSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-hydroxylating dioxygenase
publication title Quaternary Ammonium Oxidative Demethylation: X-ray Crystallographic, Resonance Raman, and UV-Visible Spectroscopic Analysis of a Rieske-Type Demethylase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 124
structure length 397
sequence length 401
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3vcaA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 3vcaA01
4NBAD 5KLIC 4NBGD 1RFSA 3H1KE 1UUWA 1RIEA 4QDFA 5HL4A 5AEWA 3CX5E 2HMOA 1VM9A 4OGQD 3DQYA 4QURA 3VCPA 2HMLA 3VCAA 2E4PA 3H1LE 3GZYA 4QUQA 4HM2A 3EN1A 4NBDA 4QCKA 4QDFB 1KB9E 4HM0A 4NBCD 4NB8A 1NDOA 1Z03A 2ZYLA 2DE5A 4EMJB 3VMHA 3H1HE 2BMOA 2B1XA 2NWFA 1FQTA 1SJGA 1SQVE 2NUMA 2BCCE 2B24A 2QJPC 4H44D 1WW9A 2A06E 2QJYC 1O7HA 3N0QA 2HMJA 2I7FA 4HM5A 4QDCA 3GCFA 4HM3A 4P1BH 2YFJA 1O7PA 4NBFA 1G8KB 2IBZE 4PD4E 2YFLA 3D89A 1L0NE 1P84E 4NBDD 3BCCE 1NYKA 4NBBA 4PV1D 1O7MA 1SQBE 2Q3WA 2XRXA 4HM4A 3CXHE 2XSHA 2DE5D 2FYNC 5AEUA 4HM6A 1L0LE 3GOBA 4HKVA 1VCKA 2NVGA 2CKFA 1NTZE 3GTSA 3GB4A 2XR8A 4NBFD 1WQLA 1NTME 3VMGA 2JO6A 2E76D 1EZVE 2GBXA 4U3FE 2HMMA 4NB9A 2E75D 2JZAA 4AIVA 1UUVA 1JM1A 2XSOA 2YFIA 3GL0A 1Q90C 4H13D 2E74D 4H0LD 3GKQA 4NBEA 3GCEA 5CXMA 3GZXA 1BCCE 4NB8D 3L73E 3L75E 1SQXE 3VMIA 1Z01A 4NBHA 3VMHD 3FOUA 5KLVE 2YVJB 4QDDA 2HMKA 4AAYB 3CWBE 2FYUE 1NTKE 2NUKA 1SQQE 4P1CH 3AZCA 1ULIA 2NVEA 3L71E 1ZRTE 2DE7A 4NBCA 3L72E 3H1JE 5KKZC 4NB9D 2BMQA 3GL2A 1SQPE 2NVFA 2DE6A 2D2CD 2GBWA 3GTEA 1NU1E 1G8JB 1O7WA 1PPJE 1ULJA 1KYOE 4NBED 4NBBD 4HJLA 4NBAA 4NBGA 2BMRA 3L70E 3TGUE 3VMID 2ZT9D 4NBHD 3L74E 2HMNA 3C0DA 1O7NA 2QPZA 1BE3E 1VF5D 2DE7D 2QJKC 4HM1A 5BOKA 3EQQA 4HM7A 1PP9E 4HM8A 4QUPA 3GKEA 1O7GA 1EG9A 2DE6D 3H1IE 3VMGD 1Z02A 2E4QA 2YIUC
chains in the Genus database with same CATH superfamily
4NBAD 5KLIC 4NBGD 1RFSA 3H1KE 1UUWA 1RIEA 4QDFA 5HL4A 5AEWA 3CX5E 2HMOA 1VM9A 4OGQD 3DQYA 4QURA 3VCPA 2HMLA 3VCAA 2E4PA 3H1LE 3GZYA 4QUQA 4HM2A 3EN1A 4NBDA 4QCKA 4QDFB 1KB9E 4HM0A 4NBCD 4NB8A 1NDOA 1Z03A 2ZYLA 2DE5A 4EMJB 3VMHA 3H1HE 2BMOA 2B1XA 2NWFA 1FQTA 1SJGA 1SQVE 2NUMA 2BCCE 2B24A 2QJPC 4H44D 1WW9A 2A06E 2QJYC 1O7HA 3N0QA 2HMJA 2I7FA 4HM5A 4QDCA 3GCFA 4HM3A 4P1BH 2YFJA 1O7PA 4NBFA 1G8KB 2IBZE 4PD4E 2YFLA 3D89A 1L0NE 1P84E 4NBDD 3BCCE 1NYKA 4NBBA 4PV1D 1O7MA 1SQBE 2Q3WA 2XRXA 4HM4A 3CXHE 2XSHA 2DE5D 2FYNC 5AEUA 4HM6A 1L0LE 3GOBA 4HKVA 1VCKA 2NVGA 2CKFA 1NTZE 3GTSA 3GB4A 2XR8A 4NBFD 1WQLA 1NTME 3VMGA 2JO6A 2E76D 1EZVE 2GBXA 4U3FE 2HMMA 4NB9A 2E75D 2JZAA 4AIVA 1UUVA 1JM1A 2XSOA 2YFIA 3GL0A 1Q90C 4H13D 2E74D 4H0LD 3GKQA 4NBEA 3GCEA 5CXMA 3GZXA 1BCCE 4NB8D 3L73E 3L75E 1SQXE 3VMIA 1Z01A 4NBHA 3VMHD 3FOUA 5KLVE 2YVJB 4QDDA 2HMKA 4AAYB 3CWBE 2FYUE 1NTKE 2NUKA 1SQQE 4P1CH 3AZCA 1ULIA 2NVEA 3L71E 1ZRTE 2DE7A 4NBCA 3L72E 3H1JE 5KKZC 4NB9D 2BMQA 3GL2A 1SQPE 2NVFA 2DE6A 2D2CD 2GBWA 3GTEA 1NU1E 1G8JB 1O7WA 1PPJE 1ULJA 1KYOE 4NBED 4NBBD 4HJLA 4NBAA 4NBGA 2BMRA 3L70E 3TGUE 3VMID 2ZT9D 4NBHD 3L74E 2HMNA 3C0DA 1O7NA 2QPZA 1BE3E 1VF5D 2DE7D 2QJKC 4HM1A 5BOKA 3EQQA 4HM7A 1PP9E 4HM8A 4QUPA 3GKEA 1O7GA 1EG9A 2DE6D 3H1IE 3VMGD 1Z02A 2E4QA 2YIUC
chains in the Genus database with same CATH topology
4NBAD 5KLIC 4NBGD 1RFSA 3H1KE 1UUWA 1RIEA 4QDFA 5HL4A 5AEWA 3CX5E 2HMOA 1VM9A 4OGQD 3DQYA 4QURA 3VCPA 2HMLA 3VCAA 2E4PA 3H1LE 3GZYA 4QUQA 4HM2A 3EN1A 4NBDA 4QCKA 4QDFB 1KB9E 4HM0A 4NBCD 4NB8A 1NDOA 1Z03A 2ZYLA 2DE5A 4EMJB 3VMHA 3H1HE 2BMOA 2B1XA 2NWFA 1FQTA 1SJGA 1SQVE 2NUMA 2BCCE 2B24A 2QJPC 4H44D 1WW9A 2A06E 2QJYC 1O7HA 3N0QA 2HMJA 2I7FA 4HM5A 4QDCA 3GCFA 4HM3A 4P1BH 2YFJA 1O7PA 4NBFA 1G8KB 2IBZE 4PD4E 2YFLA 3D89A 1L0NE 1P84E 4NBDD 3BCCE 1NYKA 4NBBA 4PV1D 1O7MA 1SQBE 2Q3WA 2XRXA 4HM4A 3CXHE 2XSHA 2DE5D 2FYNC 5AEUA 4HM6A 1L0LE 3GOBA 4HKVA 1VCKA 2NVGA 2CKFA 1NTZE 3GTSA 3GB4A 2XR8A 4NBFD 1WQLA 1NTME 3VMGA 2JO6A 2E76D 1EZVE 2GBXA 4U3FE 2HMMA 4NB9A 2E75D 2JZAA 4AIVA 1UUVA 1JM1A 2XSOA 2YFIA 3GL0A 1Q90C 4H13D 2E74D 4H0LD 3GKQA 4NBEA 3GCEA 5CXMA 3GZXA 1BCCE 4NB8D 3L73E 3L75E 1SQXE 3VMIA 1Z01A 4NBHA 3VMHD 3FOUA 5KLVE 2YVJB 4QDDA 2HMKA 4AAYB 3CWBE 2FYUE 1NTKE 2NUKA 1SQQE 4P1CH 3AZCA 1ULIA 2NVEA 3L71E 1ZRTE 2DE7A 4NBCA 3L72E 3H1JE 5KKZC 4NB9D 2BMQA 3GL2A 1SQPE 2NVFA 2DE6A 2D2CD 2GBWA 3GTEA 1NU1E 1G8JB 1O7WA 1PPJE 1ULJA 1KYOE 4NBED 4NBBD 4HJLA 4NBAA 4NBGA 2BMRA 3L70E 3TGUE 3VMID 2ZT9D 4NBHD 3L74E 2HMNA 3C0DA 1O7NA 2QPZA 1BE3E 1VF5D 2DE7D 2QJKC 4HM1A 5BOKA 3EQQA 4HM7A 1PP9E 4HM8A 4QUPA 3GKEA 1O7GA 1EG9A 2DE6D 3H1IE 3VMGD 1Z02A 2E4QA 2YIUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBA D;  5KLI C;  4NBG D;  1RFS A;  3H1K E;  1UUW A;  1RIE A;  4QDF A;  5HL4 A;  5AEW A;  3CX5 E;  2HMO A;  1VM9 A;  4OGQ D;  3DQY A;  4QUR A;  3VCP A;  2HML A;  3VCA A;  2E4P A;  3H1L E;  3GZY A;  4QUQ A;  4HM2 A;  3EN1 A;  4NBD A;  4QCK A;  4QDF B;  1KB9 E;  4HM0 A;  4NBC D;  4NB8 A;  1NDO A;  1Z03 A;  2ZYL A;  2DE5 A;  4EMJ B;  3VMH A;  3H1H E;  2BMO A;  2B1X A;  2NWF A;  1FQT A;  1SJG A;  1SQV E;  2NUM A;  2BCC E;  2B24 A;  2QJP C;  4H44 D;  1WW9 A;  2A06 E;  2QJY C;  1O7H A;  3N0Q A;  2HMJ A;  2I7F A;  4HM5 A;  4QDC A;  3GCF A;  4HM3 A;  4P1B H;  2YFJ A;  1O7P A;  4NBF A;  1G8K B;  2IBZ E;  4PD4 E;  2YFL A;  3D89 A;  1L0N E;  1P84 E;  4NBD D;  3BCC E;  1NYK A;  4NBB A;  4PV1 D;  1O7M A;  1SQB E;  2Q3W A;  2XRX A;  4HM4 A;  3CXH E;  2XSH A;  2DE5 D;  2FYN C;  5AEU A;  4HM6 A;  1L0L E;  3GOB A;  4HKV A;  1VCK A;  2NVG A;  2CKF A;  1NTZ E;  3GTS A;  3GB4 A;  2XR8 A;  4NBF D;  1WQL A;  1NTM E;  3VMG A;  2JO6 A;  2E76 D;  1EZV E;  2GBX A;  4U3F E;  2HMM A;  4NB9 A;  2E75 D;  2JZA A;  4AIV A;  1UUV A;  1JM1 A;  2XSO A;  2YFI A;  3GL0 A;  1Q90 C;  4H13 D;  2E74 D;  4H0L D;  3GKQ A;  4NBE A;  3GCE A;  5CXM A;  3GZX A;  1BCC E;  4NB8 D;  3L73 E;  3L75 E;  1SQX E;  3VMI A;  1Z01 A;  4NBH A;  3VMH D;  3FOU A;  5KLV E;  2YVJ B;  4QDD A;  2HMK A;  4AAY B;  3CWB E;  2FYU E;  1NTK E;  2NUK A;  1SQQ E;  4P1C H;  3AZC A;  1ULI A;  2NVE A;  3L71 E;  1ZRT E;  2DE7 A;  4NBC A;  3L72 E;  3H1J E;  5KKZ C;  4NB9 D;  2BMQ A;  3GL2 A;  1SQP E;  2NVF A;  2DE6 A;  2D2C D;  2GBW A;  3GTE A;  1NU1 E;  1G8J B;  1O7W A;  1PPJ E;  1ULJ A;  1KYO E;  4NBE D;  4NBB D;  4HJL A;  4NBA A;  4NBG A;  2BMR A;  3L70 E;  3TGU E;  3VMI D;  2ZT9 D;  4NBH D;  3L74 E;  2HMN A;  3C0D A;  1O7N A;  2QPZ A;  1BE3 E;  1VF5 D;  2DE7 D;  2QJK C;  4HM1 A;  5BOK A;  3EQQ A;  4HM7 A;  1PP9 E;  4HM8 A;  4QUP A;  3GKE A;  1O7G A;  1EG9 A;  2DE6 D;  3H1I E;  3VMG D;  1Z02 A;  2E4Q A;  2YIU C; 
#chains in the Genus database with same CATH topology
 4NBA D;  5KLI C;  4NBG D;  1RFS A;  3H1K E;  1UUW A;  1RIE A;  4QDF A;  5HL4 A;  5AEW A;  3CX5 E;  2HMO A;  1VM9 A;  4OGQ D;  3DQY A;  4QUR A;  3VCP A;  2HML A;  3VCA A;  2E4P A;  3H1L E;  3GZY A;  4QUQ A;  4HM2 A;  3EN1 A;  4NBD A;  4QCK A;  4QDF B;  1KB9 E;  4HM0 A;  4NBC D;  4NB8 A;  1NDO A;  1Z03 A;  2ZYL A;  2DE5 A;  4EMJ B;  3VMH A;  3H1H E;  2BMO A;  2B1X A;  2NWF A;  1FQT A;  1SJG A;  1SQV E;  2NUM A;  2BCC E;  2B24 A;  2QJP C;  4H44 D;  1WW9 A;  2A06 E;  2QJY C;  1O7H A;  3N0Q A;  2HMJ A;  2I7F A;  4HM5 A;  4QDC A;  3GCF A;  4HM3 A;  4P1B H;  2YFJ A;  1O7P A;  4NBF A;  1G8K B;  2IBZ E;  4PD4 E;  2YFL A;  3D89 A;  1L0N E;  1P84 E;  4NBD D;  3BCC E;  1NYK A;  4NBB A;  4PV1 D;  1O7M A;  1SQB E;  2Q3W A;  2XRX A;  4HM4 A;  3CXH E;  2XSH A;  2DE5 D;  2FYN C;  5AEU A;  4HM6 A;  1L0L E;  3GOB A;  4HKV A;  1VCK A;  2NVG A;  2CKF A;  1NTZ E;  3GTS A;  3GB4 A;  2XR8 A;  4NBF D;  1WQL A;  1NTM E;  3VMG A;  2JO6 A;  2E76 D;  1EZV E;  2GBX A;  4U3F E;  2HMM A;  4NB9 A;  2E75 D;  2JZA A;  4AIV A;  1UUV A;  1JM1 A;  2XSO A;  2YFI A;  3GL0 A;  1Q90 C;  4H13 D;  2E74 D;  4H0L D;  3GKQ A;  4NBE A;  3GCE A;  5CXM A;  3GZX A;  1BCC E;  4NB8 D;  3L73 E;  3L75 E;  1SQX E;  3VMI A;  1Z01 A;  4NBH A;  3VMH D;  3FOU A;  5KLV E;  2YVJ B;  4QDD A;  2HMK A;  4AAY B;  3CWB E;  2FYU E;  1NTK E;  2NUK A;  1SQQ E;  4P1C H;  3AZC A;  1ULI A;  2NVE A;  3L71 E;  1ZRT E;  2DE7 A;  4NBC A;  3L72 E;  3H1J E;  5KKZ C;  4NB9 D;  2BMQ A;  3GL2 A;  1SQP E;  2NVF A;  2DE6 A;  2D2C D;  2GBW A;  3GTE A;  1NU1 E;  1G8J B;  1O7W A;  1PPJ E;  1ULJ A;  1KYO E;  4NBE D;  4NBB D;  4HJL A;  4NBA A;  4NBG A;  2BMR A;  3L70 E;  3TGU E;  3VMI D;  2ZT9 D;  4NBH D;  3L74 E;  2HMN A;  3C0D A;  1O7N A;  2QPZ A;  1BE3 E;  1VF5 D;  2DE7 D;  2QJK C;  4HM1 A;  5BOK A;  3EQQ A;  4HM7 A;  1PP9 E;  4HM8 A;  4QUP A;  3GKE A;  1O7G A;  1EG9 A;  2DE6 D;  3H1I E;  3VMG D;  1Z02 A;  2E4Q A;  2YIU C; 
#chains in the Genus database with same CATH homology
 4NBA D;  5KLI C;  4NBG D;  1RFS A;  3H1K E;  1UUW A;  1RIE A;  4QDF A;  5HL4 A;  5AEW A;  3CX5 E;  2HMO A;  1VM9 A;  4OGQ D;  3DQY A;  4QUR A;  3VCP A;  2HML A;  3VCA A;  2E4P A;  3H1L E;  3GZY A;  4QUQ A;  4HM2 A;  3EN1 A;  4NBD A;  4QCK A;  4QDF B;  1KB9 E;  4HM0 A;  4NBC D;  4NB8 A;  1NDO A;  1Z03 A;  2ZYL A;  2DE5 A;  4EMJ B;  3VMH A;  3H1H E;  2BMO A;  2B1X A;  2NWF A;  1FQT A;  1SJG A;  1SQV E;  2NUM A;  2BCC E;  2B24 A;  2QJP C;  4H44 D;  1WW9 A;  2A06 E;  2QJY C;  1O7H A;  3N0Q A;  2HMJ A;  2I7F A;  4HM5 A;  4QDC A;  3GCF A;  4HM3 A;  4P1B H;  2YFJ A;  1O7P A;  4NBF A;  1G8K B;  2IBZ E;  4PD4 E;  2YFL A;  3D89 A;  1L0N E;  1P84 E;  4NBD D;  3BCC E;  1NYK A;  4NBB A;  4PV1 D;  1O7M A;  1SQB E;  2Q3W A;  2XRX A;  4HM4 A;  3CXH E;  2XSH A;  2DE5 D;  2FYN C;  5AEU A;  4HM6 A;  1L0L E;  3GOB A;  4HKV A;  1VCK A;  2NVG A;  2CKF A;  1NTZ E;  3GTS A;  3GB4 A;  2XR8 A;  4NBF D;  1WQL A;  1NTM E;  3VMG A;  2JO6 A;  2E76 D;  1EZV E;  2GBX A;  4U3F E;  2HMM A;  4NB9 A;  2E75 D;  2JZA A;  4AIV A;  1UUV A;  1JM1 A;  2XSO A;  2YFI A;  3GL0 A;  1Q90 C;  4H13 D;  2E74 D;  4H0L D;  3GKQ A;  4NBE A;  3GCE A;  5CXM A;  3GZX A;  1BCC E;  4NB8 D;  3L73 E;  3L75 E;  1SQX E;  3VMI A;  1Z01 A;  4NBH A;  3VMH D;  3FOU A;  5KLV E;  2YVJ B;  4QDD A;  2HMK A;  4AAY B;  3CWB E;  2FYU E;  1NTK E;  2NUK A;  1SQQ E;  4P1C H;  3AZC A;  1ULI A;  2NVE A;  3L71 E;  1ZRT E;  2DE7 A;  4NBC A;  3L72 E;  3H1J E;  5KKZ C;  4NB9 D;  2BMQ A;  3GL2 A;  1SQP E;  2NVF A;  2DE6 A;  2D2C D;  2GBW A;  3GTE A;  1NU1 E;  1G8J B;  1O7W A;  1PPJ E;  1ULJ A;  1KYO E;  4NBE D;  4NBB D;  4HJL A;  4NBA A;  4NBG A;  2BMR A;  3L70 E;  3TGU E;  3VMI D;  2ZT9 D;  4NBH D;  3L74 E;  2HMN A;  3C0D A;  1O7N A;  2QPZ A;  1BE3 E;  1VF5 D;  2DE7 D;  2QJK C;  4HM1 A;  5BOK A;  3EQQ A;  4HM7 A;  1PP9 E;  4HM8 A;  4QUP A;  3GKE A;  1O7G A;  1EG9 A;  2DE6 D;  3H1I E;  3VMG D;  1Z02 A;  2E4Q A;  2YIU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...