2XSHA

Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
total genus 140
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xshA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xshA01
2DE6D 2NVEA 1VF5D 2NUKA 1Z03A 2DE5A 1VCKA 3FOUA 1Z01A 2YIUC 5BOKA 2NUMA 5CXMA 3GKEA 4NB8D 2QJPC 4PD4E 4HM7A 2DE7A 3D89A 3GTSA 2GBXA 1ZRTE 3L74E 5KLIC 4P1BH 4NBHD 3H1LE 3GCEA 2BMRA 2E76D 2DE7D 4QURA 2DE6A 1BE3E 1ULIA 4AAYB 5KKZC 1KYOE 1O7NA 1NDOA 2XRXA 5HL4A 4NB9D 4QDCA 1SQBE 4QDFB 1WQLA 1WW9A 4PV1D 4QCKA 2FYUE 3TGUE 1VM9A 3L70E 2NVGA 4NBAD 4QDFA 2XR8A 4NB9A 2JO6A 1L0NE 4NBDD 3AZCA 4H44D 3CXHE 1BCCE 4EMJB 2B1XA 1O7MA 2HMOA 4NBBA 1UUWA 3VMGD 3VMHA 1O7PA 3CX5E 2E4PA 1KB9E 4QUPA 2BMOA 4NBAA 3L73E 3BCCE 2YFLA 2IBZE 4NBBD 4HM3A 4NBFA 3CWBE 2QJKC 2HMNA 3N0QA 4NBDA 1FQTA 3H1IE 2A06E 1SJGA 1NTZE 1UUVA 3VCAA 4AIVA 3H1KE 2ZT9D 4NBED 4HM1A 1SQVE 3GOBA 4H0LD 3VMHD 3VMGA 1PP9E 3GB4A 4HM0A 4NBEA 3GZYA 2E74D 4NBFD 1G8KB 3GKQA 1RIEA 1EZVE 3L75E 3VCPA 1NU1E 1Q90C 1PPJE 1SQPE 2XSOA 2YFIA 4H13D 3H1HE 4HKVA 1ULJA 1EG9A 1NTME 3GL0A 4HM4A 4NBGA 1RFSA 2HMJA 5AEUA 3C0DA 2YVJB 2QPZA 4HJLA 4HM6A 1O7WA 4HM5A 3L72E 4P1CH 1L0LE 1SQXE 4NBGD 2E4QA 2NVFA 3L71E 3VMIA 1G8JB 3GZXA 4NBCA 2BCCE 2QJYC 2HMLA 2I7FA 1P84E 4HM2A 2HMMA 2CKFA 2XSHA 2YFJA 3GTEA 3H1JE 1SQQE 2E75D 2GBWA 2HMKA 2ZYLA 2JZAA 1NTKE 5KLVE 3GCFA 1NYKA 2BMQA 3VMID 1Z02A 2B24A 4NBCD 2NWFA 2Q3WA 4QDDA 1O7GA 4NBHA 3GL2A 2D2CD 4QUQA 5AEWA 3EQQA 4HM8A 4NB8A 2DE5D 1JM1A 1O7HA 2FYNC 3EN1A 4OGQD 3DQYA 4U3FE
chains in the Genus database with same CATH superfamily
2DE6D 2NVEA 1VF5D 2NUKA 1Z03A 2DE5A 1VCKA 3FOUA 1Z01A 2YIUC 5BOKA 2NUMA 5CXMA 3GKEA 4NB8D 2QJPC 4PD4E 4HM7A 2DE7A 3D89A 3GTSA 2GBXA 1ZRTE 3L74E 5KLIC 4P1BH 4NBHD 3H1LE 3GCEA 2BMRA 2E76D 2DE7D 4QURA 2DE6A 1BE3E 1ULIA 4AAYB 5KKZC 1KYOE 1O7NA 1NDOA 2XRXA 5HL4A 4NB9D 4QDCA 1SQBE 4QDFB 1WQLA 1WW9A 4PV1D 4QCKA 2FYUE 3TGUE 1VM9A 3L70E 2NVGA 4NBAD 4QDFA 2XR8A 4NB9A 2JO6A 1L0NE 4NBDD 3AZCA 4H44D 3CXHE 1BCCE 4EMJB 2B1XA 1O7MA 2HMOA 4NBBA 1UUWA 3VMGD 3VMHA 1O7PA 3CX5E 2E4PA 1KB9E 4QUPA 2BMOA 4NBAA 3L73E 3BCCE 2YFLA 2IBZE 4NBBD 4HM3A 4NBFA 3CWBE 2QJKC 2HMNA 3N0QA 4NBDA 1FQTA 3H1IE 2A06E 1SJGA 1NTZE 1UUVA 3VCAA 4AIVA 3H1KE 2ZT9D 4NBED 4HM1A 1SQVE 3GOBA 4H0LD 3VMHD 3VMGA 1PP9E 3GB4A 4HM0A 4NBEA 3GZYA 2E74D 4NBFD 1G8KB 3GKQA 1RIEA 1EZVE 3L75E 3VCPA 1NU1E 1Q90C 1PPJE 1SQPE 2XSOA 2YFIA 4H13D 3H1HE 4HKVA 1ULJA 1EG9A 1NTME 3GL0A 4HM4A 4NBGA 1RFSA 2HMJA 5AEUA 3C0DA 2YVJB 2QPZA 4HJLA 4HM6A 1O7WA 4HM5A 3L72E 4P1CH 1L0LE 1SQXE 4NBGD 2E4QA 2NVFA 3L71E 3VMIA 1G8JB 3GZXA 4NBCA 2BCCE 2QJYC 2HMLA 2I7FA 1P84E 4HM2A 2HMMA 2CKFA 2XSHA 2YFJA 3GTEA 3H1JE 1SQQE 2E75D 2GBWA 2HMKA 2ZYLA 2JZAA 1NTKE 5KLVE 3GCFA 1NYKA 2BMQA 3VMID 1Z02A 2B24A 4NBCD 2NWFA 2Q3WA 4QDDA 1O7GA 4NBHA 3GL2A 2D2CD 4QUQA 5AEWA 3EQQA 4HM8A 4NB8A 2DE5D 1JM1A 1O7HA 2FYNC 3EN1A 4OGQD 3DQYA 4U3FE
chains in the Genus database with same CATH topology
2DE6D 2NVEA 1VF5D 2NUKA 1Z03A 2DE5A 1VCKA 3FOUA 1Z01A 2YIUC 5BOKA 2NUMA 5CXMA 3GKEA 4NB8D 2QJPC 4PD4E 4HM7A 2DE7A 3D89A 3GTSA 2GBXA 1ZRTE 3L74E 5KLIC 4P1BH 4NBHD 3H1LE 3GCEA 2BMRA 2E76D 2DE7D 4QURA 2DE6A 1BE3E 1ULIA 4AAYB 5KKZC 1KYOE 1O7NA 1NDOA 2XRXA 5HL4A 4NB9D 4QDCA 1SQBE 4QDFB 1WQLA 1WW9A 4PV1D 4QCKA 2FYUE 3TGUE 1VM9A 3L70E 2NVGA 4NBAD 4QDFA 2XR8A 4NB9A 2JO6A 1L0NE 4NBDD 3AZCA 4H44D 3CXHE 1BCCE 4EMJB 2B1XA 1O7MA 2HMOA 4NBBA 1UUWA 3VMGD 3VMHA 1O7PA 3CX5E 2E4PA 1KB9E 4QUPA 2BMOA 4NBAA 3L73E 3BCCE 2YFLA 2IBZE 4NBBD 4HM3A 4NBFA 3CWBE 2QJKC 2HMNA 3N0QA 4NBDA 1FQTA 3H1IE 2A06E 1SJGA 1NTZE 1UUVA 3VCAA 4AIVA 3H1KE 2ZT9D 4NBED 4HM1A 1SQVE 3GOBA 4H0LD 3VMHD 3VMGA 1PP9E 3GB4A 4HM0A 4NBEA 3GZYA 2E74D 4NBFD 1G8KB 3GKQA 1RIEA 1EZVE 3L75E 3VCPA 1NU1E 1Q90C 1PPJE 1SQPE 2XSOA 2YFIA 4H13D 3H1HE 4HKVA 1ULJA 1EG9A 1NTME 3GL0A 4HM4A 4NBGA 1RFSA 2HMJA 5AEUA 3C0DA 2YVJB 2QPZA 4HJLA 4HM6A 1O7WA 4HM5A 3L72E 4P1CH 1L0LE 1SQXE 4NBGD 2E4QA 2NVFA 3L71E 3VMIA 1G8JB 3GZXA 4NBCA 2BCCE 2QJYC 2HMLA 2I7FA 1P84E 4HM2A 2HMMA 2CKFA 2XSHA 2YFJA 3GTEA 3H1JE 1SQQE 2E75D 2GBWA 2HMKA 2ZYLA 2JZAA 1NTKE 5KLVE 3GCFA 1NYKA 2BMQA 3VMID 1Z02A 2B24A 4NBCD 2NWFA 2Q3WA 4QDDA 1O7GA 4NBHA 3GL2A 2D2CD 4QUQA 5AEWA 3EQQA 4HM8A 4NB8A 2DE5D 1JM1A 1O7HA 2FYNC 3EN1A 4OGQD 3DQYA 4U3FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE6 D;  2NVE A;  1VF5 D;  2NUK A;  1Z03 A;  2DE5 A;  1VCK A;  3FOU A;  1Z01 A;  2YIU C;  5BOK A;  2NUM A;  5CXM A;  3GKE A;  4NB8 D;  2QJP C;  4PD4 E;  4HM7 A;  2DE7 A;  3D89 A;  3GTS A;  2GBX A;  1ZRT E;  3L74 E;  5KLI C;  4P1B H;  4NBH D;  3H1L E;  3GCE A;  2BMR A;  2E76 D;  2DE7 D;  4QUR A;  2DE6 A;  1BE3 E;  1ULI A;  4AAY B;  5KKZ C;  1KYO E;  1O7N A;  1NDO A;  2XRX A;  5HL4 A;  4NB9 D;  4QDC A;  1SQB E;  4QDF B;  1WQL A;  1WW9 A;  4PV1 D;  4QCK A;  2FYU E;  3TGU E;  1VM9 A;  3L70 E;  2NVG A;  4NBA D;  4QDF A;  2XR8 A;  4NB9 A;  2JO6 A;  1L0N E;  4NBD D;  3AZC A;  4H44 D;  3CXH E;  1BCC E;  4EMJ B;  2B1X A;  1O7M A;  2HMO A;  4NBB A;  1UUW A;  3VMG D;  3VMH A;  1O7P A;  3CX5 E;  2E4P A;  1KB9 E;  4QUP A;  2BMO A;  4NBA A;  3L73 E;  3BCC E;  2YFL A;  2IBZ E;  4NBB D;  4HM3 A;  4NBF A;  3CWB E;  2QJK C;  2HMN A;  3N0Q A;  4NBD A;  1FQT A;  3H1I E;  2A06 E;  1SJG A;  1NTZ E;  1UUV A;  3VCA A;  4AIV A;  3H1K E;  2ZT9 D;  4NBE D;  4HM1 A;  1SQV E;  3GOB A;  4H0L D;  3VMH D;  3VMG A;  1PP9 E;  3GB4 A;  4HM0 A;  4NBE A;  3GZY A;  2E74 D;  4NBF D;  1G8K B;  3GKQ A;  1RIE A;  1EZV E;  3L75 E;  3VCP A;  1NU1 E;  1Q90 C;  1PPJ E;  1SQP E;  2XSO A;  2YFI A;  4H13 D;  3H1H E;  4HKV A;  1ULJ A;  1EG9 A;  1NTM E;  3GL0 A;  4HM4 A;  4NBG A;  1RFS A;  2HMJ A;  5AEU A;  3C0D A;  2YVJ B;  2QPZ A;  4HJL A;  4HM6 A;  1O7W A;  4HM5 A;  3L72 E;  4P1C H;  1L0L E;  1SQX E;  4NBG D;  2E4Q A;  2NVF A;  3L71 E;  3VMI A;  1G8J B;  3GZX A;  4NBC A;  2BCC E;  2QJY C;  2HML A;  2I7F A;  1P84 E;  4HM2 A;  2HMM A;  2CKF A;  2XSH A;  2YFJ A;  3GTE A;  3H1J E;  1SQQ E;  2E75 D;  2GBW A;  2HMK A;  2ZYL A;  2JZA A;  1NTK E;  5KLV E;  3GCF A;  1NYK A;  2BMQ A;  3VMI D;  1Z02 A;  2B24 A;  4NBC D;  2NWF A;  2Q3W A;  4QDD A;  1O7G A;  4NBH A;  3GL2 A;  2D2C D;  4QUQ A;  5AEW A;  3EQQ A;  4HM8 A;  4NB8 A;  2DE5 D;  1JM1 A;  1O7H A;  2FYN C;  3EN1 A;  4OGQ D;  3DQY A;  4U3F E; 
#chains in the Genus database with same CATH topology
 2DE6 D;  2NVE A;  1VF5 D;  2NUK A;  1Z03 A;  2DE5 A;  1VCK A;  3FOU A;  1Z01 A;  2YIU C;  5BOK A;  2NUM A;  5CXM A;  3GKE A;  4NB8 D;  2QJP C;  4PD4 E;  4HM7 A;  2DE7 A;  3D89 A;  3GTS A;  2GBX A;  1ZRT E;  3L74 E;  5KLI C;  4P1B H;  4NBH D;  3H1L E;  3GCE A;  2BMR A;  2E76 D;  2DE7 D;  4QUR A;  2DE6 A;  1BE3 E;  1ULI A;  4AAY B;  5KKZ C;  1KYO E;  1O7N A;  1NDO A;  2XRX A;  5HL4 A;  4NB9 D;  4QDC A;  1SQB E;  4QDF B;  1WQL A;  1WW9 A;  4PV1 D;  4QCK A;  2FYU E;  3TGU E;  1VM9 A;  3L70 E;  2NVG A;  4NBA D;  4QDF A;  2XR8 A;  4NB9 A;  2JO6 A;  1L0N E;  4NBD D;  3AZC A;  4H44 D;  3CXH E;  1BCC E;  4EMJ B;  2B1X A;  1O7M A;  2HMO A;  4NBB A;  1UUW A;  3VMG D;  3VMH A;  1O7P A;  3CX5 E;  2E4P A;  1KB9 E;  4QUP A;  2BMO A;  4NBA A;  3L73 E;  3BCC E;  2YFL A;  2IBZ E;  4NBB D;  4HM3 A;  4NBF A;  3CWB E;  2QJK C;  2HMN A;  3N0Q A;  4NBD A;  1FQT A;  3H1I E;  2A06 E;  1SJG A;  1NTZ E;  1UUV A;  3VCA A;  4AIV A;  3H1K E;  2ZT9 D;  4NBE D;  4HM1 A;  1SQV E;  3GOB A;  4H0L D;  3VMH D;  3VMG A;  1PP9 E;  3GB4 A;  4HM0 A;  4NBE A;  3GZY A;  2E74 D;  4NBF D;  1G8K B;  3GKQ A;  1RIE A;  1EZV E;  3L75 E;  3VCP A;  1NU1 E;  1Q90 C;  1PPJ E;  1SQP E;  2XSO A;  2YFI A;  4H13 D;  3H1H E;  4HKV A;  1ULJ A;  1EG9 A;  1NTM E;  3GL0 A;  4HM4 A;  4NBG A;  1RFS A;  2HMJ A;  5AEU A;  3C0D A;  2YVJ B;  2QPZ A;  4HJL A;  4HM6 A;  1O7W A;  4HM5 A;  3L72 E;  4P1C H;  1L0L E;  1SQX E;  4NBG D;  2E4Q A;  2NVF A;  3L71 E;  3VMI A;  1G8J B;  3GZX A;  4NBC A;  2BCC E;  2QJY C;  2HML A;  2I7F A;  1P84 E;  4HM2 A;  2HMM A;  2CKF A;  2XSH A;  2YFJ A;  3GTE A;  3H1J E;  1SQQ E;  2E75 D;  2GBW A;  2HMK A;  2ZYL A;  2JZA A;  1NTK E;  5KLV E;  3GCF A;  1NYK A;  2BMQ A;  3VMI D;  1Z02 A;  2B24 A;  4NBC D;  2NWF A;  2Q3W A;  4QDD A;  1O7G A;  4NBH A;  3GL2 A;  2D2C D;  4QUQ A;  5AEW A;  3EQQ A;  4HM8 A;  4NB8 A;  2DE5 D;  1JM1 A;  1O7H A;  2FYN C;  3EN1 A;  4OGQ D;  3DQY A;  4U3F E; 
#chains in the Genus database with same CATH homology
 2DE6 D;  2NVE A;  1VF5 D;  2NUK A;  1Z03 A;  2DE5 A;  1VCK A;  3FOU A;  1Z01 A;  2YIU C;  5BOK A;  2NUM A;  5CXM A;  3GKE A;  4NB8 D;  2QJP C;  4PD4 E;  4HM7 A;  2DE7 A;  3D89 A;  3GTS A;  2GBX A;  1ZRT E;  3L74 E;  5KLI C;  4P1B H;  4NBH D;  3H1L E;  3GCE A;  2BMR A;  2E76 D;  2DE7 D;  4QUR A;  2DE6 A;  1BE3 E;  1ULI A;  4AAY B;  5KKZ C;  1KYO E;  1O7N A;  1NDO A;  2XRX A;  5HL4 A;  4NB9 D;  4QDC A;  1SQB E;  4QDF B;  1WQL A;  1WW9 A;  4PV1 D;  4QCK A;  2FYU E;  3TGU E;  1VM9 A;  3L70 E;  2NVG A;  4NBA D;  4QDF A;  2XR8 A;  4NB9 A;  2JO6 A;  1L0N E;  4NBD D;  3AZC A;  4H44 D;  3CXH E;  1BCC E;  4EMJ B;  2B1X A;  1O7M A;  2HMO A;  4NBB A;  1UUW A;  3VMG D;  3VMH A;  1O7P A;  3CX5 E;  2E4P A;  1KB9 E;  4QUP A;  2BMO A;  4NBA A;  3L73 E;  3BCC E;  2YFL A;  2IBZ E;  4NBB D;  4HM3 A;  4NBF A;  3CWB E;  2QJK C;  2HMN A;  3N0Q A;  4NBD A;  1FQT A;  3H1I E;  2A06 E;  1SJG A;  1NTZ E;  1UUV A;  3VCA A;  4AIV A;  3H1K E;  2ZT9 D;  4NBE D;  4HM1 A;  1SQV E;  3GOB A;  4H0L D;  3VMH D;  3VMG A;  1PP9 E;  3GB4 A;  4HM0 A;  4NBE A;  3GZY A;  2E74 D;  4NBF D;  1G8K B;  3GKQ A;  1RIE A;  1EZV E;  3L75 E;  3VCP A;  1NU1 E;  1Q90 C;  1PPJ E;  1SQP E;  2XSO A;  2YFI A;  4H13 D;  3H1H E;  4HKV A;  1ULJ A;  1EG9 A;  1NTM E;  3GL0 A;  4HM4 A;  4NBG A;  1RFS A;  2HMJ A;  5AEU A;  3C0D A;  2YVJ B;  2QPZ A;  4HJL A;  4HM6 A;  1O7W A;  4HM5 A;  3L72 E;  4P1C H;  1L0L E;  1SQX E;  4NBG D;  2E4Q A;  2NVF A;  3L71 E;  3VMI A;  1G8J B;  3GZX A;  4NBC A;  2BCC E;  2QJY C;  2HML A;  2I7F A;  1P84 E;  4HM2 A;  2HMM A;  2CKF A;  2XSH A;  2YFJ A;  3GTE A;  3H1J E;  1SQQ E;  2E75 D;  2GBW A;  2HMK A;  2ZYL A;  2JZA A;  1NTK E;  5KLV E;  3GCF A;  1NYK A;  2BMQ A;  3VMI D;  1Z02 A;  2B24 A;  4NBC D;  2NWF A;  2Q3W A;  4QDD A;  1O7G A;  4NBH A;  3GL2 A;  2D2C D;  4QUQ A;  5AEW A;  3EQQ A;  4HM8 A;  4NB8 A;  2DE5 D;  1JM1 A;  1O7H A;  2FYN C;  3EN1 A;  4OGQ D;  3DQY A;  4U3F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...