2XSHA

Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
total genus 140
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xshA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xshA01
4NBHD 2CKFA 4HM5A 4HKVA 1RIEA 1WW9A 3C0DA 4NBGA 2HMOA 2JZAA 4U3FE 1WQLA 3VMGD 2BMOA 2HMJA 3EQQA 2XSHA 1UUVA 2YFIA 3VCPA 2BMQA 1G8JB 1NYKA 4NBFD 3CX5E 2B24A 1PPJE 2FYUE 4P1CH 4NBED 1SQQE 4HJLA 2DE6D 4NBBD 1SJGA 4QDFA 4NBGD 1G8KB 1NTKE 2NUKA 4NBCA 1VM9A 1PP9E 4NBFA 1EG9A 2E74D 4PV1D 3VCAA 2HMKA 3GCEA 1FQTA 3H1HE 2DE6A 4NBBA 1L0LE 2E76D 3L71E 3VMID 3H1KE 2NWFA 5KKZC 2GBXA 3CXHE 1ZRTE 1O7GA 3L74E 5KLVE 4NB8D 5AEWA 2GBWA 2HMNA 3VMIA 2I7FA 4NBCD 2JO6A 1VF5D 2NVEA 4HM3A 4QURA 2XSOA 5HL4A 1RFSA 1EZVE 2B1XA 4NB9D 4QDCA 3TGUE 3FOUA 4NB8A 2E4QA 2Q3WA 4H0LD 2QJYC 3AZCA 3GL2A 3H1JE 3CWBE 1KYOE 1SQBE 2XRXA 4NBDD 1Q90C 4NB9A 2DE7A 4AAYB 3DQYA 4HM8A 4QCKA 2E75D 2FYNC 5BOKA 4HM7A 4QDDA 1NDOA 3L72E 3GOBA 3GB4A 3H1IE 2E4PA 3VMHD 1Z02A 4NBDA 2QJKC 3GCFA 1O7WA 1BCCE 2QJPC 5AEUA 5CXMA 2YFLA 2NUMA 4NBAD 3GL0A 4QUPA 3VMHA 1SQVE 2NVFA 2BMRA 1KB9E 2DE7D 3L73E 2QPZA 3D89A 3GZYA 1NTZE 1ULIA 4PD4E 3GTEA 5KLIC 2XR8A 3GKQA 1L0NE 4EMJB 3L70E 1NTME 4NBAA 1O7HA 3GZXA 3GKEA 1VCKA 1O7PA 4HM1A 1Z01A 4H44D 4P1BH 2D2CD 2ZT9D 2HMLA 1NU1E 1SQXE 1P84E 2YIUC 4NBHA 4HM6A 1UUWA 4HM0A 1ULJA 3L75E 3H1LE 2BCCE 2HMMA 2NVGA 2IBZE 3VMGA 2DE5D 2ZYLA 1O7MA 1O7NA 4QDFB 2YFJA 3BCCE 2YVJB 1SQPE 2A06E 4H13D 4AIVA 1BE3E 1Z03A 1JM1A 3N0QA 3EN1A 4NBEA 4QUQA 3GTSA 4HM4A 2DE5A 4HM2A 4OGQD
chains in the Genus database with same CATH superfamily
4NBHD 2CKFA 4HM5A 4HKVA 1RIEA 1WW9A 3C0DA 4NBGA 2HMOA 2JZAA 4U3FE 1WQLA 3VMGD 2BMOA 2HMJA 3EQQA 2XSHA 1UUVA 2YFIA 3VCPA 2BMQA 1G8JB 1NYKA 4NBFD 3CX5E 2B24A 1PPJE 2FYUE 4P1CH 4NBED 1SQQE 4HJLA 2DE6D 4NBBD 1SJGA 4QDFA 4NBGD 1G8KB 1NTKE 2NUKA 4NBCA 1VM9A 1PP9E 4NBFA 1EG9A 2E74D 4PV1D 3VCAA 2HMKA 3GCEA 1FQTA 3H1HE 2DE6A 4NBBA 1L0LE 2E76D 3L71E 3VMID 3H1KE 2NWFA 5KKZC 2GBXA 3CXHE 1ZRTE 1O7GA 3L74E 5KLVE 4NB8D 5AEWA 2GBWA 2HMNA 3VMIA 2I7FA 4NBCD 2JO6A 1VF5D 2NVEA 4HM3A 4QURA 2XSOA 5HL4A 1RFSA 1EZVE 2B1XA 4NB9D 4QDCA 3TGUE 3FOUA 4NB8A 2E4QA 2Q3WA 4H0LD 2QJYC 3AZCA 3GL2A 3H1JE 3CWBE 1KYOE 1SQBE 2XRXA 4NBDD 1Q90C 4NB9A 2DE7A 4AAYB 3DQYA 4HM8A 4QCKA 2E75D 2FYNC 5BOKA 4HM7A 4QDDA 1NDOA 3L72E 3GOBA 3GB4A 3H1IE 2E4PA 3VMHD 1Z02A 4NBDA 2QJKC 3GCFA 1O7WA 1BCCE 2QJPC 5AEUA 5CXMA 2YFLA 2NUMA 4NBAD 3GL0A 4QUPA 3VMHA 1SQVE 2NVFA 2BMRA 1KB9E 2DE7D 3L73E 2QPZA 3D89A 3GZYA 1NTZE 1ULIA 4PD4E 3GTEA 5KLIC 2XR8A 3GKQA 1L0NE 4EMJB 3L70E 1NTME 4NBAA 1O7HA 3GZXA 3GKEA 1VCKA 1O7PA 4HM1A 1Z01A 4H44D 4P1BH 2D2CD 2ZT9D 2HMLA 1NU1E 1SQXE 1P84E 2YIUC 4NBHA 4HM6A 1UUWA 4HM0A 1ULJA 3L75E 3H1LE 2BCCE 2HMMA 2NVGA 2IBZE 3VMGA 2DE5D 2ZYLA 1O7MA 1O7NA 4QDFB 2YFJA 3BCCE 2YVJB 1SQPE 2A06E 4H13D 4AIVA 1BE3E 1Z03A 1JM1A 3N0QA 3EN1A 4NBEA 4QUQA 3GTSA 4HM4A 2DE5A 4HM2A 4OGQD
chains in the Genus database with same CATH topology
4NBHD 2CKFA 4HM5A 4HKVA 1RIEA 1WW9A 3C0DA 4NBGA 2HMOA 2JZAA 4U3FE 1WQLA 3VMGD 2BMOA 2HMJA 3EQQA 2XSHA 1UUVA 2YFIA 3VCPA 2BMQA 1G8JB 1NYKA 4NBFD 3CX5E 2B24A 1PPJE 2FYUE 4P1CH 4NBED 1SQQE 4HJLA 2DE6D 4NBBD 1SJGA 4QDFA 4NBGD 1G8KB 1NTKE 2NUKA 4NBCA 1VM9A 1PP9E 4NBFA 1EG9A 2E74D 4PV1D 3VCAA 2HMKA 3GCEA 1FQTA 3H1HE 2DE6A 4NBBA 1L0LE 2E76D 3L71E 3VMID 3H1KE 2NWFA 5KKZC 2GBXA 3CXHE 1ZRTE 1O7GA 3L74E 5KLVE 4NB8D 5AEWA 2GBWA 2HMNA 3VMIA 2I7FA 4NBCD 2JO6A 1VF5D 2NVEA 4HM3A 4QURA 2XSOA 5HL4A 1RFSA 1EZVE 2B1XA 4NB9D 4QDCA 3TGUE 3FOUA 4NB8A 2E4QA 2Q3WA 4H0LD 2QJYC 3AZCA 3GL2A 3H1JE 3CWBE 1KYOE 1SQBE 2XRXA 4NBDD 1Q90C 4NB9A 2DE7A 4AAYB 3DQYA 4HM8A 4QCKA 2E75D 2FYNC 5BOKA 4HM7A 4QDDA 1NDOA 3L72E 3GOBA 3GB4A 3H1IE 2E4PA 3VMHD 1Z02A 4NBDA 2QJKC 3GCFA 1O7WA 1BCCE 2QJPC 5AEUA 5CXMA 2YFLA 2NUMA 4NBAD 3GL0A 4QUPA 3VMHA 1SQVE 2NVFA 2BMRA 1KB9E 2DE7D 3L73E 2QPZA 3D89A 3GZYA 1NTZE 1ULIA 4PD4E 3GTEA 5KLIC 2XR8A 3GKQA 1L0NE 4EMJB 3L70E 1NTME 4NBAA 1O7HA 3GZXA 3GKEA 1VCKA 1O7PA 4HM1A 1Z01A 4H44D 4P1BH 2D2CD 2ZT9D 2HMLA 1NU1E 1SQXE 1P84E 2YIUC 4NBHA 4HM6A 1UUWA 4HM0A 1ULJA 3L75E 3H1LE 2BCCE 2HMMA 2NVGA 2IBZE 3VMGA 2DE5D 2ZYLA 1O7MA 1O7NA 4QDFB 2YFJA 3BCCE 2YVJB 1SQPE 2A06E 4H13D 4AIVA 1BE3E 1Z03A 1JM1A 3N0QA 3EN1A 4NBEA 4QUQA 3GTSA 4HM4A 2DE5A 4HM2A 4OGQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBH D;  2CKF A;  4HM5 A;  4HKV A;  1RIE A;  1WW9 A;  3C0D A;  4NBG A;  2HMO A;  2JZA A;  4U3F E;  1WQL A;  3VMG D;  2BMO A;  2HMJ A;  3EQQ A;  2XSH A;  1UUV A;  2YFI A;  3VCP A;  2BMQ A;  1G8J B;  1NYK A;  4NBF D;  3CX5 E;  2B24 A;  1PPJ E;  2FYU E;  4P1C H;  4NBE D;  1SQQ E;  4HJL A;  2DE6 D;  4NBB D;  1SJG A;  4QDF A;  4NBG D;  1G8K B;  1NTK E;  2NUK A;  4NBC A;  1VM9 A;  1PP9 E;  4NBF A;  1EG9 A;  2E74 D;  4PV1 D;  3VCA A;  2HMK A;  3GCE A;  1FQT A;  3H1H E;  2DE6 A;  4NBB A;  1L0L E;  2E76 D;  3L71 E;  3VMI D;  3H1K E;  2NWF A;  5KKZ C;  2GBX A;  3CXH E;  1ZRT E;  1O7G A;  3L74 E;  5KLV E;  4NB8 D;  5AEW A;  2GBW A;  2HMN A;  3VMI A;  2I7F A;  4NBC D;  2JO6 A;  1VF5 D;  2NVE A;  4HM3 A;  4QUR A;  2XSO A;  5HL4 A;  1RFS A;  1EZV E;  2B1X A;  4NB9 D;  4QDC A;  3TGU E;  3FOU A;  4NB8 A;  2E4Q A;  2Q3W A;  4H0L D;  2QJY C;  3AZC A;  3GL2 A;  3H1J E;  3CWB E;  1KYO E;  1SQB E;  2XRX A;  4NBD D;  1Q90 C;  4NB9 A;  2DE7 A;  4AAY B;  3DQY A;  4HM8 A;  4QCK A;  2E75 D;  2FYN C;  5BOK A;  4HM7 A;  4QDD A;  1NDO A;  3L72 E;  3GOB A;  3GB4 A;  3H1I E;  2E4P A;  3VMH D;  1Z02 A;  4NBD A;  2QJK C;  3GCF A;  1O7W A;  1BCC E;  2QJP C;  5AEU A;  5CXM A;  2YFL A;  2NUM A;  4NBA D;  3GL0 A;  4QUP A;  3VMH A;  1SQV E;  2NVF A;  2BMR A;  1KB9 E;  2DE7 D;  3L73 E;  2QPZ A;  3D89 A;  3GZY A;  1NTZ E;  1ULI A;  4PD4 E;  3GTE A;  5KLI C;  2XR8 A;  3GKQ A;  1L0N E;  4EMJ B;  3L70 E;  1NTM E;  4NBA A;  1O7H A;  3GZX A;  3GKE A;  1VCK A;  1O7P A;  4HM1 A;  1Z01 A;  4H44 D;  4P1B H;  2D2C D;  2ZT9 D;  2HML A;  1NU1 E;  1SQX E;  1P84 E;  2YIU C;  4NBH A;  4HM6 A;  1UUW A;  4HM0 A;  1ULJ A;  3L75 E;  3H1L E;  2BCC E;  2HMM A;  2NVG A;  2IBZ E;  3VMG A;  2DE5 D;  2ZYL A;  1O7M A;  1O7N A;  4QDF B;  2YFJ A;  3BCC E;  2YVJ B;  1SQP E;  2A06 E;  4H13 D;  4AIV A;  1BE3 E;  1Z03 A;  1JM1 A;  3N0Q A;  3EN1 A;  4NBE A;  4QUQ A;  3GTS A;  4HM4 A;  2DE5 A;  4HM2 A;  4OGQ D; 
#chains in the Genus database with same CATH topology
 4NBH D;  2CKF A;  4HM5 A;  4HKV A;  1RIE A;  1WW9 A;  3C0D A;  4NBG A;  2HMO A;  2JZA A;  4U3F E;  1WQL A;  3VMG D;  2BMO A;  2HMJ A;  3EQQ A;  2XSH A;  1UUV A;  2YFI A;  3VCP A;  2BMQ A;  1G8J B;  1NYK A;  4NBF D;  3CX5 E;  2B24 A;  1PPJ E;  2FYU E;  4P1C H;  4NBE D;  1SQQ E;  4HJL A;  2DE6 D;  4NBB D;  1SJG A;  4QDF A;  4NBG D;  1G8K B;  1NTK E;  2NUK A;  4NBC A;  1VM9 A;  1PP9 E;  4NBF A;  1EG9 A;  2E74 D;  4PV1 D;  3VCA A;  2HMK A;  3GCE A;  1FQT A;  3H1H E;  2DE6 A;  4NBB A;  1L0L E;  2E76 D;  3L71 E;  3VMI D;  3H1K E;  2NWF A;  5KKZ C;  2GBX A;  3CXH E;  1ZRT E;  1O7G A;  3L74 E;  5KLV E;  4NB8 D;  5AEW A;  2GBW A;  2HMN A;  3VMI A;  2I7F A;  4NBC D;  2JO6 A;  1VF5 D;  2NVE A;  4HM3 A;  4QUR A;  2XSO A;  5HL4 A;  1RFS A;  1EZV E;  2B1X A;  4NB9 D;  4QDC A;  3TGU E;  3FOU A;  4NB8 A;  2E4Q A;  2Q3W A;  4H0L D;  2QJY C;  3AZC A;  3GL2 A;  3H1J E;  3CWB E;  1KYO E;  1SQB E;  2XRX A;  4NBD D;  1Q90 C;  4NB9 A;  2DE7 A;  4AAY B;  3DQY A;  4HM8 A;  4QCK A;  2E75 D;  2FYN C;  5BOK A;  4HM7 A;  4QDD A;  1NDO A;  3L72 E;  3GOB A;  3GB4 A;  3H1I E;  2E4P A;  3VMH D;  1Z02 A;  4NBD A;  2QJK C;  3GCF A;  1O7W A;  1BCC E;  2QJP C;  5AEU A;  5CXM A;  2YFL A;  2NUM A;  4NBA D;  3GL0 A;  4QUP A;  3VMH A;  1SQV E;  2NVF A;  2BMR A;  1KB9 E;  2DE7 D;  3L73 E;  2QPZ A;  3D89 A;  3GZY A;  1NTZ E;  1ULI A;  4PD4 E;  3GTE A;  5KLI C;  2XR8 A;  3GKQ A;  1L0N E;  4EMJ B;  3L70 E;  1NTM E;  4NBA A;  1O7H A;  3GZX A;  3GKE A;  1VCK A;  1O7P A;  4HM1 A;  1Z01 A;  4H44 D;  4P1B H;  2D2C D;  2ZT9 D;  2HML A;  1NU1 E;  1SQX E;  1P84 E;  2YIU C;  4NBH A;  4HM6 A;  1UUW A;  4HM0 A;  1ULJ A;  3L75 E;  3H1L E;  2BCC E;  2HMM A;  2NVG A;  2IBZ E;  3VMG A;  2DE5 D;  2ZYL A;  1O7M A;  1O7N A;  4QDF B;  2YFJ A;  3BCC E;  2YVJ B;  1SQP E;  2A06 E;  4H13 D;  4AIV A;  1BE3 E;  1Z03 A;  1JM1 A;  3N0Q A;  3EN1 A;  4NBE A;  4QUQ A;  3GTS A;  4HM4 A;  2DE5 A;  4HM2 A;  4OGQ D; 
#chains in the Genus database with same CATH homology
 4NBH D;  2CKF A;  4HM5 A;  4HKV A;  1RIE A;  1WW9 A;  3C0D A;  4NBG A;  2HMO A;  2JZA A;  4U3F E;  1WQL A;  3VMG D;  2BMO A;  2HMJ A;  3EQQ A;  2XSH A;  1UUV A;  2YFI A;  3VCP A;  2BMQ A;  1G8J B;  1NYK A;  4NBF D;  3CX5 E;  2B24 A;  1PPJ E;  2FYU E;  4P1C H;  4NBE D;  1SQQ E;  4HJL A;  2DE6 D;  4NBB D;  1SJG A;  4QDF A;  4NBG D;  1G8K B;  1NTK E;  2NUK A;  4NBC A;  1VM9 A;  1PP9 E;  4NBF A;  1EG9 A;  2E74 D;  4PV1 D;  3VCA A;  2HMK A;  3GCE A;  1FQT A;  3H1H E;  2DE6 A;  4NBB A;  1L0L E;  2E76 D;  3L71 E;  3VMI D;  3H1K E;  2NWF A;  5KKZ C;  2GBX A;  3CXH E;  1ZRT E;  1O7G A;  3L74 E;  5KLV E;  4NB8 D;  5AEW A;  2GBW A;  2HMN A;  3VMI A;  2I7F A;  4NBC D;  2JO6 A;  1VF5 D;  2NVE A;  4HM3 A;  4QUR A;  2XSO A;  5HL4 A;  1RFS A;  1EZV E;  2B1X A;  4NB9 D;  4QDC A;  3TGU E;  3FOU A;  4NB8 A;  2E4Q A;  2Q3W A;  4H0L D;  2QJY C;  3AZC A;  3GL2 A;  3H1J E;  3CWB E;  1KYO E;  1SQB E;  2XRX A;  4NBD D;  1Q90 C;  4NB9 A;  2DE7 A;  4AAY B;  3DQY A;  4HM8 A;  4QCK A;  2E75 D;  2FYN C;  5BOK A;  4HM7 A;  4QDD A;  1NDO A;  3L72 E;  3GOB A;  3GB4 A;  3H1I E;  2E4P A;  3VMH D;  1Z02 A;  4NBD A;  2QJK C;  3GCF A;  1O7W A;  1BCC E;  2QJP C;  5AEU A;  5CXM A;  2YFL A;  2NUM A;  4NBA D;  3GL0 A;  4QUP A;  3VMH A;  1SQV E;  2NVF A;  2BMR A;  1KB9 E;  2DE7 D;  3L73 E;  2QPZ A;  3D89 A;  3GZY A;  1NTZ E;  1ULI A;  4PD4 E;  3GTE A;  5KLI C;  2XR8 A;  3GKQ A;  1L0N E;  4EMJ B;  3L70 E;  1NTM E;  4NBA A;  1O7H A;  3GZX A;  3GKE A;  1VCK A;  1O7P A;  4HM1 A;  1Z01 A;  4H44 D;  4P1B H;  2D2C D;  2ZT9 D;  2HML A;  1NU1 E;  1SQX E;  1P84 E;  2YIU C;  4NBH A;  4HM6 A;  1UUW A;  4HM0 A;  1ULJ A;  3L75 E;  3H1L E;  2BCC E;  2HMM A;  2NVG A;  2IBZ E;  3VMG A;  2DE5 D;  2ZYL A;  1O7M A;  1O7N A;  4QDF B;  2YFJ A;  3BCC E;  2YVJ B;  1SQP E;  2A06 E;  4H13 D;  4AIV A;  1BE3 E;  1Z03 A;  1JM1 A;  3N0Q A;  3EN1 A;  4NBE A;  4QUQ A;  3GTS A;  4HM4 A;  2DE5 A;  4HM2 A;  4OGQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...