2XSHA

Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 140
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xshA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xshA01
4HM8A 1Z01A 2XSOA 3D89A 2GBXA 1KYOE 1NTZE 4NBFA 3L74E 1Z03A 4NBHA 1ULJA 1PPJE 2E4PA 2BMQA 4NBED 4QURA 4NB9A 1UUWA 3FOUA 1SJGA 2HMNA 4OGQD 3VMHA 1UUVA 3CWBE 2E74D 4HM7A 1VM9A 3GTSA 2Q3WA 4NB8D 4P1BH 3VMGA 1RIEA 1SQPE 2ZYLA 3GZYA 4NBBD 2DE6A 4NBCD 3GKQA 2DE5D 3VCPA 4EMJB 3CX5E 3H1KE 3L73E 4NBGD 4NB8A 2JZAA 4AIVA 2YIUC 4PD4E 2QJYC 5KLIC 1BE3E 1O7PA 5BOKA 3GCFA 3L71E 4NBDD 4QUPA 3L72E 2DE7D 3GL0A 1SQXE 3DQYA 4NBAA 2XRXA 3H1HE 2D2CD 3BCCE 3GL2A 2XSHA 1RFSA 4HM3A 4HM2A 2YFLA 3VCAA 3H1IE 1L0LE 2QPZA 4HM0A 1JM1A 5HL4A 1EZVE 3EN1A 4NBEA 2NVGA 4H13D 1Q90C 4U3FE 4HJLA 1ZRTE 2BCCE 3CXHE 2HMLA 3GKEA 3GCEA 3L70E 5KKZC 3GZXA 4HM1A 4QDCA 5AEUA 2FYUE 3C0DA 2I7FA 2YFJA 4QDFB 2HMOA 2HMJA 4NBBA 4H44D 1O7NA 3VMID 2DE5A 4NBCA 2YVJB 4HM6A 4HKVA 5CXMA 3TGUE 4NBGA 5KLVE 3AZCA 4QCKA 2FYNC 2JO6A 1WQLA 2NUKA 1BCCE 3EQQA 2NVEA 4NBFD 4NBHD 4P1CH 4NBDA 2IBZE 2HMKA 2XR8A 5AEWA 1G8JB 1FQTA 2NUMA 2DE7A 1O7MA 1SQQE 1O7GA 2B24A 2B1XA 2YFIA 1ULIA 2HMMA 2NVFA 3VMHD 3H1LE 4AAYB 1L0NE 4QDFA 1NU1E 1PP9E 2QJKC 3H1JE 1SQVE 2QJPC 3GB4A 4HM4A 4HM5A 4QDDA 3VMGD 1VF5D 2GBWA 4PV1D 1NYKA 1O7HA 1NTME 1P84E 4QUQA 1O7WA 2DE6D 1G8KB 2A06E 2E75D 2ZT9D 4H0LD 2NWFA 1VCKA 3GTEA 1NDOA 2BMRA 1KB9E 1NTKE 1SQBE 2E76D 1WW9A 1Z02A 2BMOA 3N0QA 3GOBA 4NB9D 4NBAD 3VMIA 1EG9A 2CKFA 3L75E 2E4QA
chains in the Genus database with same CATH superfamily
4HM8A 1Z01A 2XSOA 3D89A 2GBXA 1KYOE 1NTZE 4NBFA 3L74E 1Z03A 4NBHA 1ULJA 1PPJE 2E4PA 2BMQA 4NBED 4QURA 4NB9A 1UUWA 3FOUA 1SJGA 2HMNA 4OGQD 3VMHA 1UUVA 3CWBE 2E74D 4HM7A 1VM9A 3GTSA 2Q3WA 4NB8D 4P1BH 3VMGA 1RIEA 1SQPE 2ZYLA 3GZYA 4NBBD 2DE6A 4NBCD 3GKQA 2DE5D 3VCPA 4EMJB 3CX5E 3H1KE 3L73E 4NBGD 4NB8A 2JZAA 4AIVA 2YIUC 4PD4E 2QJYC 5KLIC 1BE3E 1O7PA 5BOKA 3GCFA 3L71E 4NBDD 4QUPA 3L72E 2DE7D 3GL0A 1SQXE 3DQYA 4NBAA 2XRXA 3H1HE 2D2CD 3BCCE 3GL2A 2XSHA 1RFSA 4HM3A 4HM2A 2YFLA 3VCAA 3H1IE 1L0LE 2QPZA 4HM0A 1JM1A 5HL4A 1EZVE 3EN1A 4NBEA 2NVGA 4H13D 1Q90C 4U3FE 4HJLA 1ZRTE 2BCCE 3CXHE 2HMLA 3GKEA 3GCEA 3L70E 5KKZC 3GZXA 4HM1A 4QDCA 5AEUA 2FYUE 3C0DA 2I7FA 2YFJA 4QDFB 2HMOA 2HMJA 4NBBA 4H44D 1O7NA 3VMID 2DE5A 4NBCA 2YVJB 4HM6A 4HKVA 5CXMA 3TGUE 4NBGA 5KLVE 3AZCA 4QCKA 2FYNC 2JO6A 1WQLA 2NUKA 1BCCE 3EQQA 2NVEA 4NBFD 4NBHD 4P1CH 4NBDA 2IBZE 2HMKA 2XR8A 5AEWA 1G8JB 1FQTA 2NUMA 2DE7A 1O7MA 1SQQE 1O7GA 2B24A 2B1XA 2YFIA 1ULIA 2HMMA 2NVFA 3VMHD 3H1LE 4AAYB 1L0NE 4QDFA 1NU1E 1PP9E 2QJKC 3H1JE 1SQVE 2QJPC 3GB4A 4HM4A 4HM5A 4QDDA 3VMGD 1VF5D 2GBWA 4PV1D 1NYKA 1O7HA 1NTME 1P84E 4QUQA 1O7WA 2DE6D 1G8KB 2A06E 2E75D 2ZT9D 4H0LD 2NWFA 1VCKA 3GTEA 1NDOA 2BMRA 1KB9E 1NTKE 1SQBE 2E76D 1WW9A 1Z02A 2BMOA 3N0QA 3GOBA 4NB9D 4NBAD 3VMIA 1EG9A 2CKFA 3L75E 2E4QA
chains in the Genus database with same CATH topology
4HM8A 1Z01A 2XSOA 3D89A 2GBXA 1KYOE 1NTZE 4NBFA 3L74E 1Z03A 4NBHA 1ULJA 1PPJE 2E4PA 2BMQA 4NBED 4QURA 4NB9A 1UUWA 3FOUA 1SJGA 2HMNA 4OGQD 3VMHA 1UUVA 3CWBE 2E74D 4HM7A 1VM9A 3GTSA 2Q3WA 4NB8D 4P1BH 3VMGA 1RIEA 1SQPE 2ZYLA 3GZYA 4NBBD 2DE6A 4NBCD 3GKQA 2DE5D 3VCPA 4EMJB 3CX5E 3H1KE 3L73E 4NBGD 4NB8A 2JZAA 4AIVA 2YIUC 4PD4E 2QJYC 5KLIC 1BE3E 1O7PA 5BOKA 3GCFA 3L71E 4NBDD 4QUPA 3L72E 2DE7D 3GL0A 1SQXE 3DQYA 4NBAA 2XRXA 3H1HE 2D2CD 3BCCE 3GL2A 2XSHA 1RFSA 4HM3A 4HM2A 2YFLA 3VCAA 3H1IE 1L0LE 2QPZA 4HM0A 1JM1A 5HL4A 1EZVE 3EN1A 4NBEA 2NVGA 4H13D 1Q90C 4U3FE 4HJLA 1ZRTE 2BCCE 3CXHE 2HMLA 3GKEA 3GCEA 3L70E 5KKZC 3GZXA 4HM1A 4QDCA 5AEUA 2FYUE 3C0DA 2I7FA 2YFJA 4QDFB 2HMOA 2HMJA 4NBBA 4H44D 1O7NA 3VMID 2DE5A 4NBCA 2YVJB 4HM6A 4HKVA 5CXMA 3TGUE 4NBGA 5KLVE 3AZCA 4QCKA 2FYNC 2JO6A 1WQLA 2NUKA 1BCCE 3EQQA 2NVEA 4NBFD 4NBHD 4P1CH 4NBDA 2IBZE 2HMKA 2XR8A 5AEWA 1G8JB 1FQTA 2NUMA 2DE7A 1O7MA 1SQQE 1O7GA 2B24A 2B1XA 2YFIA 1ULIA 2HMMA 2NVFA 3VMHD 3H1LE 4AAYB 1L0NE 4QDFA 1NU1E 1PP9E 2QJKC 3H1JE 1SQVE 2QJPC 3GB4A 4HM4A 4HM5A 4QDDA 3VMGD 1VF5D 2GBWA 4PV1D 1NYKA 1O7HA 1NTME 1P84E 4QUQA 1O7WA 2DE6D 1G8KB 2A06E 2E75D 2ZT9D 4H0LD 2NWFA 1VCKA 3GTEA 1NDOA 2BMRA 1KB9E 1NTKE 1SQBE 2E76D 1WW9A 1Z02A 2BMOA 3N0QA 3GOBA 4NB9D 4NBAD 3VMIA 1EG9A 2CKFA 3L75E 2E4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM8 A;  1Z01 A;  2XSO A;  3D89 A;  2GBX A;  1KYO E;  1NTZ E;  4NBF A;  3L74 E;  1Z03 A;  4NBH A;  1ULJ A;  1PPJ E;  2E4P A;  2BMQ A;  4NBE D;  4QUR A;  4NB9 A;  1UUW A;  3FOU A;  1SJG A;  2HMN A;  4OGQ D;  3VMH A;  1UUV A;  3CWB E;  2E74 D;  4HM7 A;  1VM9 A;  3GTS A;  2Q3W A;  4NB8 D;  4P1B H;  3VMG A;  1RIE A;  1SQP E;  2ZYL A;  3GZY A;  4NBB D;  2DE6 A;  4NBC D;  3GKQ A;  2DE5 D;  3VCP A;  4EMJ B;  3CX5 E;  3H1K E;  3L73 E;  4NBG D;  4NB8 A;  2JZA A;  4AIV A;  2YIU C;  4PD4 E;  2QJY C;  5KLI C;  1BE3 E;  1O7P A;  5BOK A;  3GCF A;  3L71 E;  4NBD D;  4QUP A;  3L72 E;  2DE7 D;  3GL0 A;  1SQX E;  3DQY A;  4NBA A;  2XRX A;  3H1H E;  2D2C D;  3BCC E;  3GL2 A;  2XSH A;  1RFS A;  4HM3 A;  4HM2 A;  2YFL A;  3VCA A;  3H1I E;  1L0L E;  2QPZ A;  4HM0 A;  1JM1 A;  5HL4 A;  1EZV E;  3EN1 A;  4NBE A;  2NVG A;  4H13 D;  1Q90 C;  4U3F E;  4HJL A;  1ZRT E;  2BCC E;  3CXH E;  2HML A;  3GKE A;  3GCE A;  3L70 E;  5KKZ C;  3GZX A;  4HM1 A;  4QDC A;  5AEU A;  2FYU E;  3C0D A;  2I7F A;  2YFJ A;  4QDF B;  2HMO A;  2HMJ A;  4NBB A;  4H44 D;  1O7N A;  3VMI D;  2DE5 A;  4NBC A;  2YVJ B;  4HM6 A;  4HKV A;  5CXM A;  3TGU E;  4NBG A;  5KLV E;  3AZC A;  4QCK A;  2FYN C;  2JO6 A;  1WQL A;  2NUK A;  1BCC E;  3EQQ A;  2NVE A;  4NBF D;  4NBH D;  4P1C H;  4NBD A;  2IBZ E;  2HMK A;  2XR8 A;  5AEW A;  1G8J B;  1FQT A;  2NUM A;  2DE7 A;  1O7M A;  1SQQ E;  1O7G A;  2B24 A;  2B1X A;  2YFI A;  1ULI A;  2HMM A;  2NVF A;  3VMH D;  3H1L E;  4AAY B;  1L0N E;  4QDF A;  1NU1 E;  1PP9 E;  2QJK C;  3H1J E;  1SQV E;  2QJP C;  3GB4 A;  4HM4 A;  4HM5 A;  4QDD A;  3VMG D;  1VF5 D;  2GBW A;  4PV1 D;  1NYK A;  1O7H A;  1NTM E;  1P84 E;  4QUQ A;  1O7W A;  2DE6 D;  1G8K B;  2A06 E;  2E75 D;  2ZT9 D;  4H0L D;  2NWF A;  1VCK A;  3GTE A;  1NDO A;  2BMR A;  1KB9 E;  1NTK E;  1SQB E;  2E76 D;  1WW9 A;  1Z02 A;  2BMO A;  3N0Q A;  3GOB A;  4NB9 D;  4NBA D;  3VMI A;  1EG9 A;  2CKF A;  3L75 E;  2E4Q A; 
#chains in the Genus database with same CATH topology
 4HM8 A;  1Z01 A;  2XSO A;  3D89 A;  2GBX A;  1KYO E;  1NTZ E;  4NBF A;  3L74 E;  1Z03 A;  4NBH A;  1ULJ A;  1PPJ E;  2E4P A;  2BMQ A;  4NBE D;  4QUR A;  4NB9 A;  1UUW A;  3FOU A;  1SJG A;  2HMN A;  4OGQ D;  3VMH A;  1UUV A;  3CWB E;  2E74 D;  4HM7 A;  1VM9 A;  3GTS A;  2Q3W A;  4NB8 D;  4P1B H;  3VMG A;  1RIE A;  1SQP E;  2ZYL A;  3GZY A;  4NBB D;  2DE6 A;  4NBC D;  3GKQ A;  2DE5 D;  3VCP A;  4EMJ B;  3CX5 E;  3H1K E;  3L73 E;  4NBG D;  4NB8 A;  2JZA A;  4AIV A;  2YIU C;  4PD4 E;  2QJY C;  5KLI C;  1BE3 E;  1O7P A;  5BOK A;  3GCF A;  3L71 E;  4NBD D;  4QUP A;  3L72 E;  2DE7 D;  3GL0 A;  1SQX E;  3DQY A;  4NBA A;  2XRX A;  3H1H E;  2D2C D;  3BCC E;  3GL2 A;  2XSH A;  1RFS A;  4HM3 A;  4HM2 A;  2YFL A;  3VCA A;  3H1I E;  1L0L E;  2QPZ A;  4HM0 A;  1JM1 A;  5HL4 A;  1EZV E;  3EN1 A;  4NBE A;  2NVG A;  4H13 D;  1Q90 C;  4U3F E;  4HJL A;  1ZRT E;  2BCC E;  3CXH E;  2HML A;  3GKE A;  3GCE A;  3L70 E;  5KKZ C;  3GZX A;  4HM1 A;  4QDC A;  5AEU A;  2FYU E;  3C0D A;  2I7F A;  2YFJ A;  4QDF B;  2HMO A;  2HMJ A;  4NBB A;  4H44 D;  1O7N A;  3VMI D;  2DE5 A;  4NBC A;  2YVJ B;  4HM6 A;  4HKV A;  5CXM A;  3TGU E;  4NBG A;  5KLV E;  3AZC A;  4QCK A;  2FYN C;  2JO6 A;  1WQL A;  2NUK A;  1BCC E;  3EQQ A;  2NVE A;  4NBF D;  4NBH D;  4P1C H;  4NBD A;  2IBZ E;  2HMK A;  2XR8 A;  5AEW A;  1G8J B;  1FQT A;  2NUM A;  2DE7 A;  1O7M A;  1SQQ E;  1O7G A;  2B24 A;  2B1X A;  2YFI A;  1ULI A;  2HMM A;  2NVF A;  3VMH D;  3H1L E;  4AAY B;  1L0N E;  4QDF A;  1NU1 E;  1PP9 E;  2QJK C;  3H1J E;  1SQV E;  2QJP C;  3GB4 A;  4HM4 A;  4HM5 A;  4QDD A;  3VMG D;  1VF5 D;  2GBW A;  4PV1 D;  1NYK A;  1O7H A;  1NTM E;  1P84 E;  4QUQ A;  1O7W A;  2DE6 D;  1G8K B;  2A06 E;  2E75 D;  2ZT9 D;  4H0L D;  2NWF A;  1VCK A;  3GTE A;  1NDO A;  2BMR A;  1KB9 E;  1NTK E;  1SQB E;  2E76 D;  1WW9 A;  1Z02 A;  2BMO A;  3N0Q A;  3GOB A;  4NB9 D;  4NBA D;  3VMI A;  1EG9 A;  2CKF A;  3L75 E;  2E4Q A; 
#chains in the Genus database with same CATH homology
 4HM8 A;  1Z01 A;  2XSO A;  3D89 A;  2GBX A;  1KYO E;  1NTZ E;  4NBF A;  3L74 E;  1Z03 A;  4NBH A;  1ULJ A;  1PPJ E;  2E4P A;  2BMQ A;  4NBE D;  4QUR A;  4NB9 A;  1UUW A;  3FOU A;  1SJG A;  2HMN A;  4OGQ D;  3VMH A;  1UUV A;  3CWB E;  2E74 D;  4HM7 A;  1VM9 A;  3GTS A;  2Q3W A;  4NB8 D;  4P1B H;  3VMG A;  1RIE A;  1SQP E;  2ZYL A;  3GZY A;  4NBB D;  2DE6 A;  4NBC D;  3GKQ A;  2DE5 D;  3VCP A;  4EMJ B;  3CX5 E;  3H1K E;  3L73 E;  4NBG D;  4NB8 A;  2JZA A;  4AIV A;  2YIU C;  4PD4 E;  2QJY C;  5KLI C;  1BE3 E;  1O7P A;  5BOK A;  3GCF A;  3L71 E;  4NBD D;  4QUP A;  3L72 E;  2DE7 D;  3GL0 A;  1SQX E;  3DQY A;  4NBA A;  2XRX A;  3H1H E;  2D2C D;  3BCC E;  3GL2 A;  2XSH A;  1RFS A;  4HM3 A;  4HM2 A;  2YFL A;  3VCA A;  3H1I E;  1L0L E;  2QPZ A;  4HM0 A;  1JM1 A;  5HL4 A;  1EZV E;  3EN1 A;  4NBE A;  2NVG A;  4H13 D;  1Q90 C;  4U3F E;  4HJL A;  1ZRT E;  2BCC E;  3CXH E;  2HML A;  3GKE A;  3GCE A;  3L70 E;  5KKZ C;  3GZX A;  4HM1 A;  4QDC A;  5AEU A;  2FYU E;  3C0D A;  2I7F A;  2YFJ A;  4QDF B;  2HMO A;  2HMJ A;  4NBB A;  4H44 D;  1O7N A;  3VMI D;  2DE5 A;  4NBC A;  2YVJ B;  4HM6 A;  4HKV A;  5CXM A;  3TGU E;  4NBG A;  5KLV E;  3AZC A;  4QCK A;  2FYN C;  2JO6 A;  1WQL A;  2NUK A;  1BCC E;  3EQQ A;  2NVE A;  4NBF D;  4NBH D;  4P1C H;  4NBD A;  2IBZ E;  2HMK A;  2XR8 A;  5AEW A;  1G8J B;  1FQT A;  2NUM A;  2DE7 A;  1O7M A;  1SQQ E;  1O7G A;  2B24 A;  2B1X A;  2YFI A;  1ULI A;  2HMM A;  2NVF A;  3VMH D;  3H1L E;  4AAY B;  1L0N E;  4QDF A;  1NU1 E;  1PP9 E;  2QJK C;  3H1J E;  1SQV E;  2QJP C;  3GB4 A;  4HM4 A;  4HM5 A;  4QDD A;  3VMG D;  1VF5 D;  2GBW A;  4PV1 D;  1NYK A;  1O7H A;  1NTM E;  1P84 E;  4QUQ A;  1O7W A;  2DE6 D;  1G8K B;  2A06 E;  2E75 D;  2ZT9 D;  4H0L D;  2NWF A;  1VCK A;  3GTE A;  1NDO A;  2BMR A;  1KB9 E;  1NTK E;  1SQB E;  2E76 D;  1WW9 A;  1Z02 A;  2BMO A;  3N0Q A;  3GOB A;  4NB9 D;  4NBA D;  3VMI A;  1EG9 A;  2CKF A;  3L75 E;  2E4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...