4P1BH

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s e16c c84a c85a variant electron-transfer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
SFEKISSLDDIWVGCMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 111
sequence length 111
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4p1bH00
4NBBD 3CX5E 4QCKA 3DQYA 1G8JB 2YFJA 1UUWA 2BMOA 4HM6A 3GL0A 1Q90C 1SQPE 2FYNC 4HM2A 4HM3A 4NB8D 4P1CH 3C0DA 3VCPA 4QDDA 3BCCE 2NUKA 1EZVE 3GOBA 3H1LE 1ZRTE 2A06E 3GL2A 4QDFB 2NWFA 2YIUC 4OGQD 1BCCE 2QJYC 5KLVE 3TGUE 1L0NE 2XR8A 3GZYA 4AIVA 3H1JE 1ULIA 4QDFA 4NBHD 1BE3E 1PP9E 3L75E 3D89A 1O7WA 4NBCD 2CKFA 3AZCA 2XSOA 1WQLA 3CWBE 4HKVA 4QUPA 4HM0A 1NTZE 1SQXE 1ULJA 2BCCE 3EN1A 4NBDD 4EMJB 2XSHA 3VMGD 2QJKC 2E4QA 2DE5D 1RFSA 2E75D 1P84E 2NVEA 4AAYB 1L0LE 5CXMA 2QPZA 1VF5D 3GTSA 4HM1A 3VMID 1G8KB 4HJLA 1SJGA 2YFIA 1VCKA 4NBGD 1FQTA 3GB4A 3VMHD 1NDOA 1O7GA 2QJPC 4HM7A 1PPJE 1O7HA 1KB9E 3GKEA 1NU1E 2ZYLA 5HL4A 2HMKA 4HM5A 3GZXA 3H1KE 5AEUA 3L71E 2BMRA 4H0LD 4P1BH 2D2CD 2NUMA 4H13D 2NVFA 3FOUA 2B1XA 2YVJB 3L72E 2E4PA 2DE6D 2I7FA 2BMQA 4NBFD 1KYOE 2JZAA 5KLIC 1EG9A 3H1HE 3L70E 2DE7D 5KKZC 3L73E 3CXHE 2HMLA 4NBAD 1O7PA 2IBZE 3GCEA 2GBWA 5AEWA 2HMNA 3H1IE 4QURA 2B24A 1NYKA 4U3FE 2Q3WA 4H44D 5BOKA 3N0QA 1RIEA 2HMMA 1O7NA 1UUVA 3VCAA 4PD4E 2E76D 1SQQE 2HMJA 1NTKE 2JO6A 3EQQA 1VM9A 2ZT9D 2YFLA 1SQVE 2E74D 4HM8A 4NB9D 1NTME 2GBXA 3L74E 3GTEA 1JM1A 2FYUE 2NVGA 2XRXA 4QDCA 1O7MA 1SQBE 4QUQA 4HM4A 4PV1D 2HMOA 4NBED
chains in the Genus database with same CATH superfamily
4NBBD 3CX5E 4QCKA 3DQYA 1G8JB 2YFJA 1UUWA 2BMOA 4HM6A 3GL0A 1Q90C 1SQPE 2FYNC 4HM2A 4HM3A 4NB8D 4P1CH 3C0DA 3VCPA 4QDDA 3BCCE 2NUKA 1EZVE 3GOBA 3H1LE 1ZRTE 2A06E 3GL2A 4QDFB 2NWFA 2YIUC 4OGQD 1BCCE 2QJYC 5KLVE 3TGUE 1L0NE 2XR8A 3GZYA 4AIVA 3H1JE 1ULIA 4QDFA 4NBHD 1BE3E 1PP9E 3L75E 3D89A 1O7WA 4NBCD 2CKFA 3AZCA 2XSOA 1WQLA 3CWBE 4HKVA 4QUPA 4HM0A 1NTZE 1SQXE 1ULJA 2BCCE 3EN1A 4NBDD 4EMJB 2XSHA 3VMGD 2QJKC 2E4QA 2DE5D 1RFSA 2E75D 1P84E 2NVEA 4AAYB 1L0LE 5CXMA 2QPZA 1VF5D 3GTSA 4HM1A 3VMID 1G8KB 4HJLA 1SJGA 2YFIA 1VCKA 4NBGD 1FQTA 3GB4A 3VMHD 1NDOA 1O7GA 2QJPC 4HM7A 1PPJE 1O7HA 1KB9E 3GKEA 1NU1E 2ZYLA 5HL4A 2HMKA 4HM5A 3GZXA 3H1KE 5AEUA 3L71E 2BMRA 4H0LD 4P1BH 2D2CD 2NUMA 4H13D 2NVFA 3FOUA 2B1XA 2YVJB 3L72E 2E4PA 2DE6D 2I7FA 2BMQA 4NBFD 1KYOE 2JZAA 5KLIC 1EG9A 3H1HE 3L70E 2DE7D 5KKZC 3L73E 3CXHE 2HMLA 4NBAD 1O7PA 2IBZE 3GCEA 2GBWA 5AEWA 2HMNA 3H1IE 4QURA 2B24A 1NYKA 4U3FE 2Q3WA 4H44D 5BOKA 3N0QA 1RIEA 2HMMA 1O7NA 1UUVA 3VCAA 4PD4E 2E76D 1SQQE 2HMJA 1NTKE 2JO6A 3EQQA 1VM9A 2ZT9D 2YFLA 1SQVE 2E74D 4HM8A 4NB9D 1NTME 2GBXA 3L74E 3GTEA 1JM1A 2FYUE 2NVGA 2XRXA 4QDCA 1O7MA 1SQBE 4QUQA 4HM4A 4PV1D 2HMOA 4NBED
chains in the Genus database with same CATH topology
4NBBD 3CX5E 4QCKA 3DQYA 1G8JB 2YFJA 1UUWA 2BMOA 4HM6A 3GL0A 1Q90C 1SQPE 2FYNC 4HM2A 4HM3A 4NB8D 4P1CH 3C0DA 3VCPA 4QDDA 3BCCE 2NUKA 1EZVE 3GOBA 3H1LE 1ZRTE 2A06E 3GL2A 4QDFB 2NWFA 2YIUC 4OGQD 1BCCE 2QJYC 5KLVE 3TGUE 1L0NE 2XR8A 3GZYA 4AIVA 3H1JE 1ULIA 4QDFA 4NBHD 1BE3E 1PP9E 3L75E 3D89A 1O7WA 4NBCD 2CKFA 3AZCA 2XSOA 1WQLA 3CWBE 4HKVA 4QUPA 4HM0A 1NTZE 1SQXE 1ULJA 2BCCE 3EN1A 4NBDD 4EMJB 2XSHA 3VMGD 2QJKC 2E4QA 2DE5D 1RFSA 2E75D 1P84E 2NVEA 4AAYB 1L0LE 5CXMA 2QPZA 1VF5D 3GTSA 4HM1A 3VMID 1G8KB 4HJLA 1SJGA 2YFIA 1VCKA 4NBGD 1FQTA 3GB4A 3VMHD 1NDOA 1O7GA 2QJPC 4HM7A 1PPJE 1O7HA 1KB9E 3GKEA 1NU1E 2ZYLA 5HL4A 2HMKA 4HM5A 3GZXA 3H1KE 5AEUA 3L71E 2BMRA 4H0LD 4P1BH 2D2CD 2NUMA 4H13D 2NVFA 3FOUA 2B1XA 2YVJB 3L72E 2E4PA 2DE6D 2I7FA 2BMQA 4NBFD 1KYOE 2JZAA 5KLIC 1EG9A 3H1HE 3L70E 2DE7D 5KKZC 3L73E 3CXHE 2HMLA 4NBAD 1O7PA 2IBZE 3GCEA 2GBWA 5AEWA 2HMNA 3H1IE 4QURA 2B24A 1NYKA 4U3FE 2Q3WA 4H44D 5BOKA 3N0QA 1RIEA 2HMMA 1O7NA 1UUVA 3VCAA 4PD4E 2E76D 1SQQE 2HMJA 1NTKE 2JO6A 3EQQA 1VM9A 2ZT9D 2YFLA 1SQVE 2E74D 4HM8A 4NB9D 1NTME 2GBXA 3L74E 3GTEA 1JM1A 2FYUE 2NVGA 2XRXA 4QDCA 1O7MA 1SQBE 4QUQA 4HM4A 4PV1D 2HMOA 4NBED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBB D;  3CX5 E;  4QCK A;  3DQY A;  1G8J B;  2YFJ A;  1UUW A;  2BMO A;  4HM6 A;  3GL0 A;  1Q90 C;  1SQP E;  2FYN C;  4HM2 A;  4HM3 A;  4NB8 D;  4P1C H;  3C0D A;  3VCP A;  4QDD A;  3BCC E;  2NUK A;  1EZV E;  3GOB A;  3H1L E;  1ZRT E;  2A06 E;  3GL2 A;  4QDF B;  2NWF A;  2YIU C;  4OGQ D;  1BCC E;  2QJY C;  5KLV E;  3TGU E;  1L0N E;  2XR8 A;  3GZY A;  4AIV A;  3H1J E;  1ULI A;  4QDF A;  4NBH D;  1BE3 E;  1PP9 E;  3L75 E;  3D89 A;  1O7W A;  4NBC D;  2CKF A;  3AZC A;  2XSO A;  1WQL A;  3CWB E;  4HKV A;  4QUP A;  4HM0 A;  1NTZ E;  1SQX E;  1ULJ A;  2BCC E;  3EN1 A;  4NBD D;  4EMJ B;  2XSH A;  3VMG D;  2QJK C;  2E4Q A;  2DE5 D;  1RFS A;  2E75 D;  1P84 E;  2NVE A;  4AAY B;  1L0L E;  5CXM A;  2QPZ A;  1VF5 D;  3GTS A;  4HM1 A;  3VMI D;  1G8K B;  4HJL A;  1SJG A;  2YFI A;  1VCK A;  4NBG D;  1FQT A;  3GB4 A;  3VMH D;  1NDO A;  1O7G A;  2QJP C;  4HM7 A;  1PPJ E;  1O7H A;  1KB9 E;  3GKE A;  1NU1 E;  2ZYL A;  5HL4 A;  2HMK A;  4HM5 A;  3GZX A;  3H1K E;  5AEU A;  3L71 E;  2BMR A;  4H0L D;  4P1B H;  2D2C D;  2NUM A;  4H13 D;  2NVF A;  3FOU A;  2B1X A;  2YVJ B;  3L72 E;  2E4P A;  2DE6 D;  2I7F A;  2BMQ A;  4NBF D;  1KYO E;  2JZA A;  5KLI C;  1EG9 A;  3H1H E;  3L70 E;  2DE7 D;  5KKZ C;  3L73 E;  3CXH E;  2HML A;  4NBA D;  1O7P A;  2IBZ E;  3GCE A;  2GBW A;  5AEW A;  2HMN A;  3H1I E;  4QUR A;  2B24 A;  1NYK A;  4U3F E;  2Q3W A;  4H44 D;  5BOK A;  3N0Q A;  1RIE A;  2HMM A;  1O7N A;  1UUV A;  3VCA A;  4PD4 E;  2E76 D;  1SQQ E;  2HMJ A;  1NTK E;  2JO6 A;  3EQQ A;  1VM9 A;  2ZT9 D;  2YFL A;  1SQV E;  2E74 D;  4HM8 A;  4NB9 D;  1NTM E;  2GBX A;  3L74 E;  3GTE A;  1JM1 A;  2FYU E;  2NVG A;  2XRX A;  4QDC A;  1O7M A;  1SQB E;  4QUQ A;  4HM4 A;  4PV1 D;  2HMO A;  4NBE D; 
#chains in the Genus database with same CATH topology
 4NBB D;  3CX5 E;  4QCK A;  3DQY A;  1G8J B;  2YFJ A;  1UUW A;  2BMO A;  4HM6 A;  3GL0 A;  1Q90 C;  1SQP E;  2FYN C;  4HM2 A;  4HM3 A;  4NB8 D;  4P1C H;  3C0D A;  3VCP A;  4QDD A;  3BCC E;  2NUK A;  1EZV E;  3GOB A;  3H1L E;  1ZRT E;  2A06 E;  3GL2 A;  4QDF B;  2NWF A;  2YIU C;  4OGQ D;  1BCC E;  2QJY C;  5KLV E;  3TGU E;  1L0N E;  2XR8 A;  3GZY A;  4AIV A;  3H1J E;  1ULI A;  4QDF A;  4NBH D;  1BE3 E;  1PP9 E;  3L75 E;  3D89 A;  1O7W A;  4NBC D;  2CKF A;  3AZC A;  2XSO A;  1WQL A;  3CWB E;  4HKV A;  4QUP A;  4HM0 A;  1NTZ E;  1SQX E;  1ULJ A;  2BCC E;  3EN1 A;  4NBD D;  4EMJ B;  2XSH A;  3VMG D;  2QJK C;  2E4Q A;  2DE5 D;  1RFS A;  2E75 D;  1P84 E;  2NVE A;  4AAY B;  1L0L E;  5CXM A;  2QPZ A;  1VF5 D;  3GTS A;  4HM1 A;  3VMI D;  1G8K B;  4HJL A;  1SJG A;  2YFI A;  1VCK A;  4NBG D;  1FQT A;  3GB4 A;  3VMH D;  1NDO A;  1O7G A;  2QJP C;  4HM7 A;  1PPJ E;  1O7H A;  1KB9 E;  3GKE A;  1NU1 E;  2ZYL A;  5HL4 A;  2HMK A;  4HM5 A;  3GZX A;  3H1K E;  5AEU A;  3L71 E;  2BMR A;  4H0L D;  4P1B H;  2D2C D;  2NUM A;  4H13 D;  2NVF A;  3FOU A;  2B1X A;  2YVJ B;  3L72 E;  2E4P A;  2DE6 D;  2I7F A;  2BMQ A;  4NBF D;  1KYO E;  2JZA A;  5KLI C;  1EG9 A;  3H1H E;  3L70 E;  2DE7 D;  5KKZ C;  3L73 E;  3CXH E;  2HML A;  4NBA D;  1O7P A;  2IBZ E;  3GCE A;  2GBW A;  5AEW A;  2HMN A;  3H1I E;  4QUR A;  2B24 A;  1NYK A;  4U3F E;  2Q3W A;  4H44 D;  5BOK A;  3N0Q A;  1RIE A;  2HMM A;  1O7N A;  1UUV A;  3VCA A;  4PD4 E;  2E76 D;  1SQQ E;  2HMJ A;  1NTK E;  2JO6 A;  3EQQ A;  1VM9 A;  2ZT9 D;  2YFL A;  1SQV E;  2E74 D;  4HM8 A;  4NB9 D;  1NTM E;  2GBX A;  3L74 E;  3GTE A;  1JM1 A;  2FYU E;  2NVG A;  2XRX A;  4QDC A;  1O7M A;  1SQB E;  4QUQ A;  4HM4 A;  4PV1 D;  2HMO A;  4NBE D; 
#chains in the Genus database with same CATH homology
 4NBB D;  3CX5 E;  4QCK A;  3DQY A;  1G8J B;  2YFJ A;  1UUW A;  2BMO A;  4HM6 A;  3GL0 A;  1Q90 C;  1SQP E;  2FYN C;  4HM2 A;  4HM3 A;  4NB8 D;  4P1C H;  3C0D A;  3VCP A;  4QDD A;  3BCC E;  2NUK A;  1EZV E;  3GOB A;  3H1L E;  1ZRT E;  2A06 E;  3GL2 A;  4QDF B;  2NWF A;  2YIU C;  4OGQ D;  1BCC E;  2QJY C;  5KLV E;  3TGU E;  1L0N E;  2XR8 A;  3GZY A;  4AIV A;  3H1J E;  1ULI A;  4QDF A;  4NBH D;  1BE3 E;  1PP9 E;  3L75 E;  3D89 A;  1O7W A;  4NBC D;  2CKF A;  3AZC A;  2XSO A;  1WQL A;  3CWB E;  4HKV A;  4QUP A;  4HM0 A;  1NTZ E;  1SQX E;  1ULJ A;  2BCC E;  3EN1 A;  4NBD D;  4EMJ B;  2XSH A;  3VMG D;  2QJK C;  2E4Q A;  2DE5 D;  1RFS A;  2E75 D;  1P84 E;  2NVE A;  4AAY B;  1L0L E;  5CXM A;  2QPZ A;  1VF5 D;  3GTS A;  4HM1 A;  3VMI D;  1G8K B;  4HJL A;  1SJG A;  2YFI A;  1VCK A;  4NBG D;  1FQT A;  3GB4 A;  3VMH D;  1NDO A;  1O7G A;  2QJP C;  4HM7 A;  1PPJ E;  1O7H A;  1KB9 E;  3GKE A;  1NU1 E;  2ZYL A;  5HL4 A;  2HMK A;  4HM5 A;  3GZX A;  3H1K E;  5AEU A;  3L71 E;  2BMR A;  4H0L D;  4P1B H;  2D2C D;  2NUM A;  4H13 D;  2NVF A;  3FOU A;  2B1X A;  2YVJ B;  3L72 E;  2E4P A;  2DE6 D;  2I7F A;  2BMQ A;  4NBF D;  1KYO E;  2JZA A;  5KLI C;  1EG9 A;  3H1H E;  3L70 E;  2DE7 D;  5KKZ C;  3L73 E;  3CXH E;  2HML A;  4NBA D;  1O7P A;  2IBZ E;  3GCE A;  2GBW A;  5AEW A;  2HMN A;  3H1I E;  4QUR A;  2B24 A;  1NYK A;  4U3F E;  2Q3W A;  4H44 D;  5BOK A;  3N0Q A;  1RIE A;  2HMM A;  1O7N A;  1UUV A;  3VCA A;  4PD4 E;  2E76 D;  1SQQ E;  2HMJ A;  1NTK E;  2JO6 A;  3EQQ A;  1VM9 A;  2ZT9 D;  2YFL A;  1SQV E;  2E74 D;  4HM8 A;  4NB9 D;  1NTM E;  2GBX A;  3L74 E;  3GTE A;  1JM1 A;  2FYU E;  2NVG A;  2XRX A;  4QDC A;  1O7M A;  1SQB E;  4QUQ A;  4HM4 A;  4PV1 D;  2HMO A;  4NBE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...