4P1BH

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s e16c c84a c85a variant electron-transfer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
b'SFEKISSLDDIWVGCMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKAHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 111
sequence length 111
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4p1bH00
1WQLA 2IBZE 1BE3E 4HM2A 3CXHE 1O7WA 1PP9E 3GL0A 4HM0A 2ZYLA 2JO6A 4QCKA 1SQXE 3L73E 1O7HA 1SQPE 3H1KE 4NB9D 3VCPA 4HKVA 1P84E 1ULIA 1ZRTE 3CWBE 3L74E 4HM7A 2Q3WA 1KB9E 2ZT9D 3GB4A 4PD4E 2HMOA 4NBCD 2HMJA 5KKZC 2E4PA 4NBFD 1VM9A 2QPZA 1G8KB 3AZCA 2FYNC 1UUVA 3GZYA 2QJYC 1O7NA 1SQBE 3VMHD 3H1LE 4H13D 2YFIA 4QURA 2HMLA 2QJPC 3GTEA 2DE6D 2E76D 3H1HE 4QUPA 1VCKA 2YFJA 1NTZE 5HL4A 1G8JB 4P1CH 3GOBA 1JM1A 2XSOA 2JZAA 2YIUC 4HM5A 3H1JE 3C0DA 1UUWA 4HM1A 2XR8A 1NU1E 3VMID 3VCAA 1EZVE 2FYUE 4AAYB 3BCCE 4H0LD 5KLIC 1RFSA 4OGQD 5AEUA 1NYKA 1SQQE 2E75D 1SJGA 4HM8A 4HM6A 2NVEA 4P1BH 2E74D 2HMNA 1FQTA 4NBDD 4NBHD 3H1IE 2BMOA 4EMJB 4AIVA 2B1XA 4QDDA 4NB8D 2QJKC 2YVJB 4HJLA 1PPJE 2DE5D 2GBXA 2E4QA 2NVFA 2HMKA 3DQYA 4U3FE 1O7PA 3L71E 1ULJA 4HM4A 3EN1A 4NBAD 1SQVE 1EG9A 2BCCE 2NUMA 2NWFA 3FOUA 4QUQA 2DE7D 3N0QA 2GBWA 4QDFB 3L72E 4NBBD 2NUKA 3GL2A 2CKFA 4PV1D 1VF5D 3GTSA 5AEWA 3GZXA 4QDFA 1NTME 4H44D 1RIEA 2YFLA 2I7FA 4NBGD 1L0NE 1O7GA 1O7MA 1L0LE 2A06E 4QDCA 1Q90C 5CXMA 3L70E 2BMRA 2XRXA 5BOKA 4HM3A 3L75E 3GCEA 3CX5E 2D2CD 3VMGD 3D89A 3EQQA 2NVGA 3GKEA 5KLVE 4NBED 2B24A 1KYOE 2XSHA 1NTKE 3TGUE 1BCCE 2BMQA 2HMMA 1NDOA
chains in the Genus database with same CATH superfamily
1WQLA 2IBZE 1BE3E 4HM2A 3CXHE 1O7WA 1PP9E 3GL0A 4HM0A 2ZYLA 2JO6A 4QCKA 1SQXE 3L73E 1O7HA 1SQPE 3H1KE 4NB9D 3VCPA 4HKVA 1P84E 1ULIA 1ZRTE 3CWBE 3L74E 4HM7A 2Q3WA 1KB9E 2ZT9D 3GB4A 4PD4E 2HMOA 4NBCD 2HMJA 5KKZC 2E4PA 4NBFD 1VM9A 2QPZA 1G8KB 3AZCA 2FYNC 1UUVA 3GZYA 2QJYC 1O7NA 1SQBE 3VMHD 3H1LE 4H13D 2YFIA 4QURA 2HMLA 2QJPC 3GTEA 2DE6D 2E76D 3H1HE 4QUPA 1VCKA 2YFJA 1NTZE 5HL4A 1G8JB 4P1CH 3GOBA 1JM1A 2XSOA 2JZAA 2YIUC 4HM5A 3H1JE 3C0DA 1UUWA 4HM1A 2XR8A 1NU1E 3VMID 3VCAA 1EZVE 2FYUE 4AAYB 3BCCE 4H0LD 5KLIC 1RFSA 4OGQD 5AEUA 1NYKA 1SQQE 2E75D 1SJGA 4HM8A 4HM6A 2NVEA 4P1BH 2E74D 2HMNA 1FQTA 4NBDD 4NBHD 3H1IE 2BMOA 4EMJB 4AIVA 2B1XA 4QDDA 4NB8D 2QJKC 2YVJB 4HJLA 1PPJE 2DE5D 2GBXA 2E4QA 2NVFA 2HMKA 3DQYA 4U3FE 1O7PA 3L71E 1ULJA 4HM4A 3EN1A 4NBAD 1SQVE 1EG9A 2BCCE 2NUMA 2NWFA 3FOUA 4QUQA 2DE7D 3N0QA 2GBWA 4QDFB 3L72E 4NBBD 2NUKA 3GL2A 2CKFA 4PV1D 1VF5D 3GTSA 5AEWA 3GZXA 4QDFA 1NTME 4H44D 1RIEA 2YFLA 2I7FA 4NBGD 1L0NE 1O7GA 1O7MA 1L0LE 2A06E 4QDCA 1Q90C 5CXMA 3L70E 2BMRA 2XRXA 5BOKA 4HM3A 3L75E 3GCEA 3CX5E 2D2CD 3VMGD 3D89A 3EQQA 2NVGA 3GKEA 5KLVE 4NBED 2B24A 1KYOE 2XSHA 1NTKE 3TGUE 1BCCE 2BMQA 2HMMA 1NDOA
chains in the Genus database with same CATH topology
1WQLA 2IBZE 1BE3E 4HM2A 3CXHE 1O7WA 1PP9E 3GL0A 4HM0A 2ZYLA 2JO6A 4QCKA 1SQXE 3L73E 1O7HA 1SQPE 3H1KE 4NB9D 3VCPA 4HKVA 1P84E 1ULIA 1ZRTE 3CWBE 3L74E 4HM7A 2Q3WA 1KB9E 2ZT9D 3GB4A 4PD4E 2HMOA 4NBCD 2HMJA 5KKZC 2E4PA 4NBFD 1VM9A 2QPZA 1G8KB 3AZCA 2FYNC 1UUVA 3GZYA 2QJYC 1O7NA 1SQBE 3VMHD 3H1LE 4H13D 2YFIA 4QURA 2HMLA 2QJPC 3GTEA 2DE6D 2E76D 3H1HE 4QUPA 1VCKA 2YFJA 1NTZE 5HL4A 1G8JB 4P1CH 3GOBA 1JM1A 2XSOA 2JZAA 2YIUC 4HM5A 3H1JE 3C0DA 1UUWA 4HM1A 2XR8A 1NU1E 3VMID 3VCAA 1EZVE 2FYUE 4AAYB 3BCCE 4H0LD 5KLIC 1RFSA 4OGQD 5AEUA 1NYKA 1SQQE 2E75D 1SJGA 4HM8A 4HM6A 2NVEA 4P1BH 2E74D 2HMNA 1FQTA 4NBDD 4NBHD 3H1IE 2BMOA 4EMJB 4AIVA 2B1XA 4QDDA 4NB8D 2QJKC 2YVJB 4HJLA 1PPJE 2DE5D 2GBXA 2E4QA 2NVFA 2HMKA 3DQYA 4U3FE 1O7PA 3L71E 1ULJA 4HM4A 3EN1A 4NBAD 1SQVE 1EG9A 2BCCE 2NUMA 2NWFA 3FOUA 4QUQA 2DE7D 3N0QA 2GBWA 4QDFB 3L72E 4NBBD 2NUKA 3GL2A 2CKFA 4PV1D 1VF5D 3GTSA 5AEWA 3GZXA 4QDFA 1NTME 4H44D 1RIEA 2YFLA 2I7FA 4NBGD 1L0NE 1O7GA 1O7MA 1L0LE 2A06E 4QDCA 1Q90C 5CXMA 3L70E 2BMRA 2XRXA 5BOKA 4HM3A 3L75E 3GCEA 3CX5E 2D2CD 3VMGD 3D89A 3EQQA 2NVGA 3GKEA 5KLVE 4NBED 2B24A 1KYOE 2XSHA 1NTKE 3TGUE 1BCCE 2BMQA 2HMMA 1NDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQL A;  2IBZ E;  1BE3 E;  4HM2 A;  3CXH E;  1O7W A;  1PP9 E;  3GL0 A;  4HM0 A;  2ZYL A;  2JO6 A;  4QCK A;  1SQX E;  3L73 E;  1O7H A;  1SQP E;  3H1K E;  4NB9 D;  3VCP A;  4HKV A;  1P84 E;  1ULI A;  1ZRT E;  3CWB E;  3L74 E;  4HM7 A;  2Q3W A;  1KB9 E;  2ZT9 D;  3GB4 A;  4PD4 E;  2HMO A;  4NBC D;  2HMJ A;  5KKZ C;  2E4P A;  4NBF D;  1VM9 A;  2QPZ A;  1G8K B;  3AZC A;  2FYN C;  1UUV A;  3GZY A;  2QJY C;  1O7N A;  1SQB E;  3VMH D;  3H1L E;  4H13 D;  2YFI A;  4QUR A;  2HML A;  2QJP C;  3GTE A;  2DE6 D;  2E76 D;  3H1H E;  4QUP A;  1VCK A;  2YFJ A;  1NTZ E;  5HL4 A;  1G8J B;  4P1C H;  3GOB A;  1JM1 A;  2XSO A;  2JZA A;  2YIU C;  4HM5 A;  3H1J E;  3C0D A;  1UUW A;  4HM1 A;  2XR8 A;  1NU1 E;  3VMI D;  3VCA A;  1EZV E;  2FYU E;  4AAY B;  3BCC E;  4H0L D;  5KLI C;  1RFS A;  4OGQ D;  5AEU A;  1NYK A;  1SQQ E;  2E75 D;  1SJG A;  4HM8 A;  4HM6 A;  2NVE A;  4P1B H;  2E74 D;  2HMN A;  1FQT A;  4NBD D;  4NBH D;  3H1I E;  2BMO A;  4EMJ B;  4AIV A;  2B1X A;  4QDD A;  4NB8 D;  2QJK C;  2YVJ B;  4HJL A;  1PPJ E;  2DE5 D;  2GBX A;  2E4Q A;  2NVF A;  2HMK A;  3DQY A;  4U3F E;  1O7P A;  3L71 E;  1ULJ A;  4HM4 A;  3EN1 A;  4NBA D;  1SQV E;  1EG9 A;  2BCC E;  2NUM A;  2NWF A;  3FOU A;  4QUQ A;  2DE7 D;  3N0Q A;  2GBW A;  4QDF B;  3L72 E;  4NBB D;  2NUK A;  3GL2 A;  2CKF A;  4PV1 D;  1VF5 D;  3GTS A;  5AEW A;  3GZX A;  4QDF A;  1NTM E;  4H44 D;  1RIE A;  2YFL A;  2I7F A;  4NBG D;  1L0N E;  1O7G A;  1O7M A;  1L0L E;  2A06 E;  4QDC A;  1Q90 C;  5CXM A;  3L70 E;  2BMR A;  2XRX A;  5BOK A;  4HM3 A;  3L75 E;  3GCE A;  3CX5 E;  2D2C D;  3VMG D;  3D89 A;  3EQQ A;  2NVG A;  3GKE A;  5KLV E;  4NBE D;  2B24 A;  1KYO E;  2XSH A;  1NTK E;  3TGU E;  1BCC E;  2BMQ A;  2HMM A;  1NDO A; 
#chains in the Genus database with same CATH topology
 1WQL A;  2IBZ E;  1BE3 E;  4HM2 A;  3CXH E;  1O7W A;  1PP9 E;  3GL0 A;  4HM0 A;  2ZYL A;  2JO6 A;  4QCK A;  1SQX E;  3L73 E;  1O7H A;  1SQP E;  3H1K E;  4NB9 D;  3VCP A;  4HKV A;  1P84 E;  1ULI A;  1ZRT E;  3CWB E;  3L74 E;  4HM7 A;  2Q3W A;  1KB9 E;  2ZT9 D;  3GB4 A;  4PD4 E;  2HMO A;  4NBC D;  2HMJ A;  5KKZ C;  2E4P A;  4NBF D;  1VM9 A;  2QPZ A;  1G8K B;  3AZC A;  2FYN C;  1UUV A;  3GZY A;  2QJY C;  1O7N A;  1SQB E;  3VMH D;  3H1L E;  4H13 D;  2YFI A;  4QUR A;  2HML A;  2QJP C;  3GTE A;  2DE6 D;  2E76 D;  3H1H E;  4QUP A;  1VCK A;  2YFJ A;  1NTZ E;  5HL4 A;  1G8J B;  4P1C H;  3GOB A;  1JM1 A;  2XSO A;  2JZA A;  2YIU C;  4HM5 A;  3H1J E;  3C0D A;  1UUW A;  4HM1 A;  2XR8 A;  1NU1 E;  3VMI D;  3VCA A;  1EZV E;  2FYU E;  4AAY B;  3BCC E;  4H0L D;  5KLI C;  1RFS A;  4OGQ D;  5AEU A;  1NYK A;  1SQQ E;  2E75 D;  1SJG A;  4HM8 A;  4HM6 A;  2NVE A;  4P1B H;  2E74 D;  2HMN A;  1FQT A;  4NBD D;  4NBH D;  3H1I E;  2BMO A;  4EMJ B;  4AIV A;  2B1X A;  4QDD A;  4NB8 D;  2QJK C;  2YVJ B;  4HJL A;  1PPJ E;  2DE5 D;  2GBX A;  2E4Q A;  2NVF A;  2HMK A;  3DQY A;  4U3F E;  1O7P A;  3L71 E;  1ULJ A;  4HM4 A;  3EN1 A;  4NBA D;  1SQV E;  1EG9 A;  2BCC E;  2NUM A;  2NWF A;  3FOU A;  4QUQ A;  2DE7 D;  3N0Q A;  2GBW A;  4QDF B;  3L72 E;  4NBB D;  2NUK A;  3GL2 A;  2CKF A;  4PV1 D;  1VF5 D;  3GTS A;  5AEW A;  3GZX A;  4QDF A;  1NTM E;  4H44 D;  1RIE A;  2YFL A;  2I7F A;  4NBG D;  1L0N E;  1O7G A;  1O7M A;  1L0L E;  2A06 E;  4QDC A;  1Q90 C;  5CXM A;  3L70 E;  2BMR A;  2XRX A;  5BOK A;  4HM3 A;  3L75 E;  3GCE A;  3CX5 E;  2D2C D;  3VMG D;  3D89 A;  3EQQ A;  2NVG A;  3GKE A;  5KLV E;  4NBE D;  2B24 A;  1KYO E;  2XSH A;  1NTK E;  3TGU E;  1BCC E;  2BMQ A;  2HMM A;  1NDO A; 
#chains in the Genus database with same CATH homology
 1WQL A;  2IBZ E;  1BE3 E;  4HM2 A;  3CXH E;  1O7W A;  1PP9 E;  3GL0 A;  4HM0 A;  2ZYL A;  2JO6 A;  4QCK A;  1SQX E;  3L73 E;  1O7H A;  1SQP E;  3H1K E;  4NB9 D;  3VCP A;  4HKV A;  1P84 E;  1ULI A;  1ZRT E;  3CWB E;  3L74 E;  4HM7 A;  2Q3W A;  1KB9 E;  2ZT9 D;  3GB4 A;  4PD4 E;  2HMO A;  4NBC D;  2HMJ A;  5KKZ C;  2E4P A;  4NBF D;  1VM9 A;  2QPZ A;  1G8K B;  3AZC A;  2FYN C;  1UUV A;  3GZY A;  2QJY C;  1O7N A;  1SQB E;  3VMH D;  3H1L E;  4H13 D;  2YFI A;  4QUR A;  2HML A;  2QJP C;  3GTE A;  2DE6 D;  2E76 D;  3H1H E;  4QUP A;  1VCK A;  2YFJ A;  1NTZ E;  5HL4 A;  1G8J B;  4P1C H;  3GOB A;  1JM1 A;  2XSO A;  2JZA A;  2YIU C;  4HM5 A;  3H1J E;  3C0D A;  1UUW A;  4HM1 A;  2XR8 A;  1NU1 E;  3VMI D;  3VCA A;  1EZV E;  2FYU E;  4AAY B;  3BCC E;  4H0L D;  5KLI C;  1RFS A;  4OGQ D;  5AEU A;  1NYK A;  1SQQ E;  2E75 D;  1SJG A;  4HM8 A;  4HM6 A;  2NVE A;  4P1B H;  2E74 D;  2HMN A;  1FQT A;  4NBD D;  4NBH D;  3H1I E;  2BMO A;  4EMJ B;  4AIV A;  2B1X A;  4QDD A;  4NB8 D;  2QJK C;  2YVJ B;  4HJL A;  1PPJ E;  2DE5 D;  2GBX A;  2E4Q A;  2NVF A;  2HMK A;  3DQY A;  4U3F E;  1O7P A;  3L71 E;  1ULJ A;  4HM4 A;  3EN1 A;  4NBA D;  1SQV E;  1EG9 A;  2BCC E;  2NUM A;  2NWF A;  3FOU A;  4QUQ A;  2DE7 D;  3N0Q A;  2GBW A;  4QDF B;  3L72 E;  4NBB D;  2NUK A;  3GL2 A;  2CKF A;  4PV1 D;  1VF5 D;  3GTS A;  5AEW A;  3GZX A;  4QDF A;  1NTM E;  4H44 D;  1RIE A;  2YFL A;  2I7F A;  4NBG D;  1L0N E;  1O7G A;  1O7M A;  1L0L E;  2A06 E;  4QDC A;  1Q90 C;  5CXM A;  3L70 E;  2BMR A;  2XRX A;  5BOK A;  4HM3 A;  3L75 E;  3GCE A;  3CX5 E;  2D2C D;  3VMG D;  3D89 A;  3EQQ A;  2NVG A;  3GKE A;  5KLV E;  4NBE D;  2B24 A;  1KYO E;  2XSH A;  1NTK E;  3TGU E;  1BCC E;  2BMQ A;  2HMM A;  1NDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...