4P1BH

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s e16c c84a c85a variant electron-transfer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
b'SFEKISSLDDIWVGCMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKAHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
molecule keywords Toluene-4-monooxygenase system protein A
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 111
sequence length 111
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4p1bH00
2BMRA 4QCKA 3L74E 2NWFA 2FYNC 4HM1A 2FYUE 2ZYLA 3CWBE 4NBED 2B24A 2ZT9D 1UUWA 4HM3A 1O7HA 2NVGA 3H1JE 4NBHD 1VM9A 2E76D 4HM4A 1FQTA 4H0LD 3L70E 4QDFA 2NVFA 4PD4E 2HMLA 1G8JB 3D89A 1O7GA 2E4PA 1EZVE 2QJPC 2IBZE 4HM6A 2BMQA 1SQVE 4NBBD 3FOUA 3GOBA 1G8KB 4HM7A 3GCEA 2JZAA 4U3FE 1L0NE 3BCCE 4QUPA 4QDFB 1BCCE 1NTZE 5AEUA 2XSHA 3GZXA 1NU1E 1SJGA 2NUMA 1NDOA 2DE5D 2GBWA 2JO6A 2BCCE 1JM1A 3VCAA 1P84E 2D2CD 2HMMA 2HMOA 4AIVA 3VMHD 1SQPE 3GL2A 4HM2A 2GBXA 3L71E 4OGQD 2DE7D 4EMJB 3GTSA 4AAYB 2XRXA 2XR8A 2HMKA 2YIUC 3H1IE 4NBGD 1L0LE 2YFIA 2YVJB 4QDCA 2QPZA 1VF5D 3EN1A 4HM0A 4H44D 4QUQA 2QJYC 2A06E 4NBFD 3CX5E 4NBAD 1RFSA 4H13D 4P1BH 3L75E 1PPJE 1ULIA 2CKFA 1O7WA 3EQQA 5BOKA 1O7MA 2XSOA 2DE6D 5CXMA 1ZRTE 2QJKC 5HL4A 3C0DA 3VMGD 2NUKA 4HM5A 1O7PA 3DQYA 3GB4A 3GL0A 4HM8A 1NTKE 4NB8D 5KLIC 1SQXE 5KLVE 2Q3WA 3GKEA 1ULJA 4NBDD 2E74D 2NVEA 4P1CH 3H1LE 3GTEA 2HMNA 4NBCD 5AEWA 1KB9E 3AZCA 2I7FA 4QURA 1SQBE 2E4QA 1O7NA 3CXHE 3N0QA 1Q90C 3H1KE 3L72E 3L73E 1KYOE 1NYKA 1PP9E 1RIEA 3VCPA 3TGUE 1BE3E 2HMJA 3VMID 2YFLA 1NTME 2BMOA 2YFJA 4QDDA 4HKVA 5KKZC 3H1HE 4NB9D 3GZYA 1VCKA 4PV1D 1EG9A 1UUVA 1WQLA 2E75D 4HJLA 1SQQE 2B1XA
chains in the Genus database with same CATH superfamily
2BMRA 4QCKA 3L74E 2NWFA 2FYNC 4HM1A 2FYUE 2ZYLA 3CWBE 4NBED 2B24A 2ZT9D 1UUWA 4HM3A 1O7HA 2NVGA 3H1JE 4NBHD 1VM9A 2E76D 4HM4A 1FQTA 4H0LD 3L70E 4QDFA 2NVFA 4PD4E 2HMLA 1G8JB 3D89A 1O7GA 2E4PA 1EZVE 2QJPC 2IBZE 4HM6A 2BMQA 1SQVE 4NBBD 3FOUA 3GOBA 1G8KB 4HM7A 3GCEA 2JZAA 4U3FE 1L0NE 3BCCE 4QUPA 4QDFB 1BCCE 1NTZE 5AEUA 2XSHA 3GZXA 1NU1E 1SJGA 2NUMA 1NDOA 2DE5D 2GBWA 2JO6A 2BCCE 1JM1A 3VCAA 1P84E 2D2CD 2HMMA 2HMOA 4AIVA 3VMHD 1SQPE 3GL2A 4HM2A 2GBXA 3L71E 4OGQD 2DE7D 4EMJB 3GTSA 4AAYB 2XRXA 2XR8A 2HMKA 2YIUC 3H1IE 4NBGD 1L0LE 2YFIA 2YVJB 4QDCA 2QPZA 1VF5D 3EN1A 4HM0A 4H44D 4QUQA 2QJYC 2A06E 4NBFD 3CX5E 4NBAD 1RFSA 4H13D 4P1BH 3L75E 1PPJE 1ULIA 2CKFA 1O7WA 3EQQA 5BOKA 1O7MA 2XSOA 2DE6D 5CXMA 1ZRTE 2QJKC 5HL4A 3C0DA 3VMGD 2NUKA 4HM5A 1O7PA 3DQYA 3GB4A 3GL0A 4HM8A 1NTKE 4NB8D 5KLIC 1SQXE 5KLVE 2Q3WA 3GKEA 1ULJA 4NBDD 2E74D 2NVEA 4P1CH 3H1LE 3GTEA 2HMNA 4NBCD 5AEWA 1KB9E 3AZCA 2I7FA 4QURA 1SQBE 2E4QA 1O7NA 3CXHE 3N0QA 1Q90C 3H1KE 3L72E 3L73E 1KYOE 1NYKA 1PP9E 1RIEA 3VCPA 3TGUE 1BE3E 2HMJA 3VMID 2YFLA 1NTME 2BMOA 2YFJA 4QDDA 4HKVA 5KKZC 3H1HE 4NB9D 3GZYA 1VCKA 4PV1D 1EG9A 1UUVA 1WQLA 2E75D 4HJLA 1SQQE 2B1XA
chains in the Genus database with same CATH topology
2BMRA 4QCKA 3L74E 2NWFA 2FYNC 4HM1A 2FYUE 2ZYLA 3CWBE 4NBED 2B24A 2ZT9D 1UUWA 4HM3A 1O7HA 2NVGA 3H1JE 4NBHD 1VM9A 2E76D 4HM4A 1FQTA 4H0LD 3L70E 4QDFA 2NVFA 4PD4E 2HMLA 1G8JB 3D89A 1O7GA 2E4PA 1EZVE 2QJPC 2IBZE 4HM6A 2BMQA 1SQVE 4NBBD 3FOUA 3GOBA 1G8KB 4HM7A 3GCEA 2JZAA 4U3FE 1L0NE 3BCCE 4QUPA 4QDFB 1BCCE 1NTZE 5AEUA 2XSHA 3GZXA 1NU1E 1SJGA 2NUMA 1NDOA 2DE5D 2GBWA 2JO6A 2BCCE 1JM1A 3VCAA 1P84E 2D2CD 2HMMA 2HMOA 4AIVA 3VMHD 1SQPE 3GL2A 4HM2A 2GBXA 3L71E 4OGQD 2DE7D 4EMJB 3GTSA 4AAYB 2XRXA 2XR8A 2HMKA 2YIUC 3H1IE 4NBGD 1L0LE 2YFIA 2YVJB 4QDCA 2QPZA 1VF5D 3EN1A 4HM0A 4H44D 4QUQA 2QJYC 2A06E 4NBFD 3CX5E 4NBAD 1RFSA 4H13D 4P1BH 3L75E 1PPJE 1ULIA 2CKFA 1O7WA 3EQQA 5BOKA 1O7MA 2XSOA 2DE6D 5CXMA 1ZRTE 2QJKC 5HL4A 3C0DA 3VMGD 2NUKA 4HM5A 1O7PA 3DQYA 3GB4A 3GL0A 4HM8A 1NTKE 4NB8D 5KLIC 1SQXE 5KLVE 2Q3WA 3GKEA 1ULJA 4NBDD 2E74D 2NVEA 4P1CH 3H1LE 3GTEA 2HMNA 4NBCD 5AEWA 1KB9E 3AZCA 2I7FA 4QURA 1SQBE 2E4QA 1O7NA 3CXHE 3N0QA 1Q90C 3H1KE 3L72E 3L73E 1KYOE 1NYKA 1PP9E 1RIEA 3VCPA 3TGUE 1BE3E 2HMJA 3VMID 2YFLA 1NTME 2BMOA 2YFJA 4QDDA 4HKVA 5KKZC 3H1HE 4NB9D 3GZYA 1VCKA 4PV1D 1EG9A 1UUVA 1WQLA 2E75D 4HJLA 1SQQE 2B1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMR A;  4QCK A;  3L74 E;  2NWF A;  2FYN C;  4HM1 A;  2FYU E;  2ZYL A;  3CWB E;  4NBE D;  2B24 A;  2ZT9 D;  1UUW A;  4HM3 A;  1O7H A;  2NVG A;  3H1J E;  4NBH D;  1VM9 A;  2E76 D;  4HM4 A;  1FQT A;  4H0L D;  3L70 E;  4QDF A;  2NVF A;  4PD4 E;  2HML A;  1G8J B;  3D89 A;  1O7G A;  2E4P A;  1EZV E;  2QJP C;  2IBZ E;  4HM6 A;  2BMQ A;  1SQV E;  4NBB D;  3FOU A;  3GOB A;  1G8K B;  4HM7 A;  3GCE A;  2JZA A;  4U3F E;  1L0N E;  3BCC E;  4QUP A;  4QDF B;  1BCC E;  1NTZ E;  5AEU A;  2XSH A;  3GZX A;  1NU1 E;  1SJG A;  2NUM A;  1NDO A;  2DE5 D;  2GBW A;  2JO6 A;  2BCC E;  1JM1 A;  3VCA A;  1P84 E;  2D2C D;  2HMM A;  2HMO A;  4AIV A;  3VMH D;  1SQP E;  3GL2 A;  4HM2 A;  2GBX A;  3L71 E;  4OGQ D;  2DE7 D;  4EMJ B;  3GTS A;  4AAY B;  2XRX A;  2XR8 A;  2HMK A;  2YIU C;  3H1I E;  4NBG D;  1L0L E;  2YFI A;  2YVJ B;  4QDC A;  2QPZ A;  1VF5 D;  3EN1 A;  4HM0 A;  4H44 D;  4QUQ A;  2QJY C;  2A06 E;  4NBF D;  3CX5 E;  4NBA D;  1RFS A;  4H13 D;  4P1B H;  3L75 E;  1PPJ E;  1ULI A;  2CKF A;  1O7W A;  3EQQ A;  5BOK A;  1O7M A;  2XSO A;  2DE6 D;  5CXM A;  1ZRT E;  2QJK C;  5HL4 A;  3C0D A;  3VMG D;  2NUK A;  4HM5 A;  1O7P A;  3DQY A;  3GB4 A;  3GL0 A;  4HM8 A;  1NTK E;  4NB8 D;  5KLI C;  1SQX E;  5KLV E;  2Q3W A;  3GKE A;  1ULJ A;  4NBD D;  2E74 D;  2NVE A;  4P1C H;  3H1L E;  3GTE A;  2HMN A;  4NBC D;  5AEW A;  1KB9 E;  3AZC A;  2I7F A;  4QUR A;  1SQB E;  2E4Q A;  1O7N A;  3CXH E;  3N0Q A;  1Q90 C;  3H1K E;  3L72 E;  3L73 E;  1KYO E;  1NYK A;  1PP9 E;  1RIE A;  3VCP A;  3TGU E;  1BE3 E;  2HMJ A;  3VMI D;  2YFL A;  1NTM E;  2BMO A;  2YFJ A;  4QDD A;  4HKV A;  5KKZ C;  3H1H E;  4NB9 D;  3GZY A;  1VCK A;  4PV1 D;  1EG9 A;  1UUV A;  1WQL A;  2E75 D;  4HJL A;  1SQQ E;  2B1X A; 
#chains in the Genus database with same CATH topology
 2BMR A;  4QCK A;  3L74 E;  2NWF A;  2FYN C;  4HM1 A;  2FYU E;  2ZYL A;  3CWB E;  4NBE D;  2B24 A;  2ZT9 D;  1UUW A;  4HM3 A;  1O7H A;  2NVG A;  3H1J E;  4NBH D;  1VM9 A;  2E76 D;  4HM4 A;  1FQT A;  4H0L D;  3L70 E;  4QDF A;  2NVF A;  4PD4 E;  2HML A;  1G8J B;  3D89 A;  1O7G A;  2E4P A;  1EZV E;  2QJP C;  2IBZ E;  4HM6 A;  2BMQ A;  1SQV E;  4NBB D;  3FOU A;  3GOB A;  1G8K B;  4HM7 A;  3GCE A;  2JZA A;  4U3F E;  1L0N E;  3BCC E;  4QUP A;  4QDF B;  1BCC E;  1NTZ E;  5AEU A;  2XSH A;  3GZX A;  1NU1 E;  1SJG A;  2NUM A;  1NDO A;  2DE5 D;  2GBW A;  2JO6 A;  2BCC E;  1JM1 A;  3VCA A;  1P84 E;  2D2C D;  2HMM A;  2HMO A;  4AIV A;  3VMH D;  1SQP E;  3GL2 A;  4HM2 A;  2GBX A;  3L71 E;  4OGQ D;  2DE7 D;  4EMJ B;  3GTS A;  4AAY B;  2XRX A;  2XR8 A;  2HMK A;  2YIU C;  3H1I E;  4NBG D;  1L0L E;  2YFI A;  2YVJ B;  4QDC A;  2QPZ A;  1VF5 D;  3EN1 A;  4HM0 A;  4H44 D;  4QUQ A;  2QJY C;  2A06 E;  4NBF D;  3CX5 E;  4NBA D;  1RFS A;  4H13 D;  4P1B H;  3L75 E;  1PPJ E;  1ULI A;  2CKF A;  1O7W A;  3EQQ A;  5BOK A;  1O7M A;  2XSO A;  2DE6 D;  5CXM A;  1ZRT E;  2QJK C;  5HL4 A;  3C0D A;  3VMG D;  2NUK A;  4HM5 A;  1O7P A;  3DQY A;  3GB4 A;  3GL0 A;  4HM8 A;  1NTK E;  4NB8 D;  5KLI C;  1SQX E;  5KLV E;  2Q3W A;  3GKE A;  1ULJ A;  4NBD D;  2E74 D;  2NVE A;  4P1C H;  3H1L E;  3GTE A;  2HMN A;  4NBC D;  5AEW A;  1KB9 E;  3AZC A;  2I7F A;  4QUR A;  1SQB E;  2E4Q A;  1O7N A;  3CXH E;  3N0Q A;  1Q90 C;  3H1K E;  3L72 E;  3L73 E;  1KYO E;  1NYK A;  1PP9 E;  1RIE A;  3VCP A;  3TGU E;  1BE3 E;  2HMJ A;  3VMI D;  2YFL A;  1NTM E;  2BMO A;  2YFJ A;  4QDD A;  4HKV A;  5KKZ C;  3H1H E;  4NB9 D;  3GZY A;  1VCK A;  4PV1 D;  1EG9 A;  1UUV A;  1WQL A;  2E75 D;  4HJL A;  1SQQ E;  2B1X A; 
#chains in the Genus database with same CATH homology
 2BMR A;  4QCK A;  3L74 E;  2NWF A;  2FYN C;  4HM1 A;  2FYU E;  2ZYL A;  3CWB E;  4NBE D;  2B24 A;  2ZT9 D;  1UUW A;  4HM3 A;  1O7H A;  2NVG A;  3H1J E;  4NBH D;  1VM9 A;  2E76 D;  4HM4 A;  1FQT A;  4H0L D;  3L70 E;  4QDF A;  2NVF A;  4PD4 E;  2HML A;  1G8J B;  3D89 A;  1O7G A;  2E4P A;  1EZV E;  2QJP C;  2IBZ E;  4HM6 A;  2BMQ A;  1SQV E;  4NBB D;  3FOU A;  3GOB A;  1G8K B;  4HM7 A;  3GCE A;  2JZA A;  4U3F E;  1L0N E;  3BCC E;  4QUP A;  4QDF B;  1BCC E;  1NTZ E;  5AEU A;  2XSH A;  3GZX A;  1NU1 E;  1SJG A;  2NUM A;  1NDO A;  2DE5 D;  2GBW A;  2JO6 A;  2BCC E;  1JM1 A;  3VCA A;  1P84 E;  2D2C D;  2HMM A;  2HMO A;  4AIV A;  3VMH D;  1SQP E;  3GL2 A;  4HM2 A;  2GBX A;  3L71 E;  4OGQ D;  2DE7 D;  4EMJ B;  3GTS A;  4AAY B;  2XRX A;  2XR8 A;  2HMK A;  2YIU C;  3H1I E;  4NBG D;  1L0L E;  2YFI A;  2YVJ B;  4QDC A;  2QPZ A;  1VF5 D;  3EN1 A;  4HM0 A;  4H44 D;  4QUQ A;  2QJY C;  2A06 E;  4NBF D;  3CX5 E;  4NBA D;  1RFS A;  4H13 D;  4P1B H;  3L75 E;  1PPJ E;  1ULI A;  2CKF A;  1O7W A;  3EQQ A;  5BOK A;  1O7M A;  2XSO A;  2DE6 D;  5CXM A;  1ZRT E;  2QJK C;  5HL4 A;  3C0D A;  3VMG D;  2NUK A;  4HM5 A;  1O7P A;  3DQY A;  3GB4 A;  3GL0 A;  4HM8 A;  1NTK E;  4NB8 D;  5KLI C;  1SQX E;  5KLV E;  2Q3W A;  3GKE A;  1ULJ A;  4NBD D;  2E74 D;  2NVE A;  4P1C H;  3H1L E;  3GTE A;  2HMN A;  4NBC D;  5AEW A;  1KB9 E;  3AZC A;  2I7F A;  4QUR A;  1SQB E;  2E4Q A;  1O7N A;  3CXH E;  3N0Q A;  1Q90 C;  3H1K E;  3L72 E;  3L73 E;  1KYO E;  1NYK A;  1PP9 E;  1RIE A;  3VCP A;  3TGU E;  1BE3 E;  2HMJ A;  3VMI D;  2YFL A;  1NTM E;  2BMO A;  2YFJ A;  4QDD A;  4HKV A;  5KKZ C;  3H1H E;  4NB9 D;  3GZY A;  1VCK A;  4PV1 D;  1EG9 A;  1UUV A;  1WQL A;  2E75 D;  4HJL A;  1SQQ E;  2B1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...