2Q3WA

Ensemble refinement of the protein crystal structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SFEKICSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Toluene-4-monooxygenase system ferredoxin subunit
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2q3wA00
1NYKA 4QDFA 2XSOA 4NBCD 1L0LE 3VCAA 4NBAD 1SQPE 3GZXA 2NVEA 3GKEA 1NTME 2IBZE 3EQQA 1SQBE 2YFLA 3L73E 1SQQE 3DQYA 3GTEA 5AEWA 1NU1E 2YFIA 4NBFD 3L72E 1SQXE 4HM6A 2BMQA 1BCCE 2HMNA 5KLVE 2BMRA 2HMOA 2XRXA 4NBHD 3L70E 1SJGA 4HKVA 4HM4A 5HL4A 5BOKA 2DE5D 3TGUE 1NTZE 5KLIC 1G8JB 4QUPA 4U3FE 5KKZC 1KB9E 2FYNC 2B1XA 3GL0A 1JM1A 3L75E 2NVGA 2NVFA 3VMID 1RIEA 2HMKA 4H13D 2E4PA 4QDFB 2Q3WA 4H0LD 4P1CH 2CKFA 1O7HA 3CX5E 1BE3E 1ZRTE 2JZAA 4HM7A 2A06E 3BCCE 4HM0A 4AAYB 1VM9A 2E76D 3FOUA 2QJKC 1FQTA 1SQVE 2E74D 2HMLA 1L0NE 2YFJA 3GL2A 4HM3A 1O7NA 2YIUC 3GTSA 3H1IE 4HM2A 4QUQA 2XSHA 1UUVA 2QJYC 2E75D 1O7WA 5AEUA 1RFSA 2GBWA 2I7FA 1NDOA 3C0DA 2DE6D 1EZVE 2NWFA 2DE7D 3H1HE 2BMOA 3EN1A 2NUKA 4QDDA 2YVJB 4P1BH 4H44D 2E4QA 1P84E 4NBBD 2HMJA 2NUMA 4NBGD 2QJPC 4QCKA 2QPZA 4HM5A 4OGQD 3GZYA 1PP9E 4NBDD 4HJLA 1ULJA 3VMHD 4QDCA 4NBED 4EMJB 2D2CD 4QURA 3L71E 1Q90C 1G8KB 3GCEA 1VCKA 1KYOE 2ZYLA 4PV1D 2HMMA 3CWBE 2JO6A 1EG9A 4HM8A 2BCCE 3VCPA 1O7PA 4NB9D 3CXHE 3N0QA 1O7MA 1PPJE 3AZCA 2GBXA 2B24A 1UUWA 1ULIA 4HM1A 3VMGD 1NTKE 3D89A 4NB8D 2FYUE 1VF5D 4AIVA 3H1KE 2XR8A 3GB4A 3H1JE 1O7GA 5CXMA 3GOBA 2ZT9D 3H1LE 4PD4E 1WQLA 3L74E
chains in the Genus database with same CATH superfamily
1NYKA 4QDFA 2XSOA 4NBCD 1L0LE 3VCAA 4NBAD 1SQPE 3GZXA 2NVEA 3GKEA 1NTME 2IBZE 3EQQA 1SQBE 2YFLA 3L73E 1SQQE 3DQYA 3GTEA 5AEWA 1NU1E 2YFIA 4NBFD 3L72E 1SQXE 4HM6A 2BMQA 1BCCE 2HMNA 5KLVE 2BMRA 2HMOA 2XRXA 4NBHD 3L70E 1SJGA 4HKVA 4HM4A 5HL4A 5BOKA 2DE5D 3TGUE 1NTZE 5KLIC 1G8JB 4QUPA 4U3FE 5KKZC 1KB9E 2FYNC 2B1XA 3GL0A 1JM1A 3L75E 2NVGA 2NVFA 3VMID 1RIEA 2HMKA 4H13D 2E4PA 4QDFB 2Q3WA 4H0LD 4P1CH 2CKFA 1O7HA 3CX5E 1BE3E 1ZRTE 2JZAA 4HM7A 2A06E 3BCCE 4HM0A 4AAYB 1VM9A 2E76D 3FOUA 2QJKC 1FQTA 1SQVE 2E74D 2HMLA 1L0NE 2YFJA 3GL2A 4HM3A 1O7NA 2YIUC 3GTSA 3H1IE 4HM2A 4QUQA 2XSHA 1UUVA 2QJYC 2E75D 1O7WA 5AEUA 1RFSA 2GBWA 2I7FA 1NDOA 3C0DA 2DE6D 1EZVE 2NWFA 2DE7D 3H1HE 2BMOA 3EN1A 2NUKA 4QDDA 2YVJB 4P1BH 4H44D 2E4QA 1P84E 4NBBD 2HMJA 2NUMA 4NBGD 2QJPC 4QCKA 2QPZA 4HM5A 4OGQD 3GZYA 1PP9E 4NBDD 4HJLA 1ULJA 3VMHD 4QDCA 4NBED 4EMJB 2D2CD 4QURA 3L71E 1Q90C 1G8KB 3GCEA 1VCKA 1KYOE 2ZYLA 4PV1D 2HMMA 3CWBE 2JO6A 1EG9A 4HM8A 2BCCE 3VCPA 1O7PA 4NB9D 3CXHE 3N0QA 1O7MA 1PPJE 3AZCA 2GBXA 2B24A 1UUWA 1ULIA 4HM1A 3VMGD 1NTKE 3D89A 4NB8D 2FYUE 1VF5D 4AIVA 3H1KE 2XR8A 3GB4A 3H1JE 1O7GA 5CXMA 3GOBA 2ZT9D 3H1LE 4PD4E 1WQLA 3L74E
chains in the Genus database with same CATH topology
1NYKA 4QDFA 2XSOA 4NBCD 1L0LE 3VCAA 4NBAD 1SQPE 3GZXA 2NVEA 3GKEA 1NTME 2IBZE 3EQQA 1SQBE 2YFLA 3L73E 1SQQE 3DQYA 3GTEA 5AEWA 1NU1E 2YFIA 4NBFD 3L72E 1SQXE 4HM6A 2BMQA 1BCCE 2HMNA 5KLVE 2BMRA 2HMOA 2XRXA 4NBHD 3L70E 1SJGA 4HKVA 4HM4A 5HL4A 5BOKA 2DE5D 3TGUE 1NTZE 5KLIC 1G8JB 4QUPA 4U3FE 5KKZC 1KB9E 2FYNC 2B1XA 3GL0A 1JM1A 3L75E 2NVGA 2NVFA 3VMID 1RIEA 2HMKA 4H13D 2E4PA 4QDFB 2Q3WA 4H0LD 4P1CH 2CKFA 1O7HA 3CX5E 1BE3E 1ZRTE 2JZAA 4HM7A 2A06E 3BCCE 4HM0A 4AAYB 1VM9A 2E76D 3FOUA 2QJKC 1FQTA 1SQVE 2E74D 2HMLA 1L0NE 2YFJA 3GL2A 4HM3A 1O7NA 2YIUC 3GTSA 3H1IE 4HM2A 4QUQA 2XSHA 1UUVA 2QJYC 2E75D 1O7WA 5AEUA 1RFSA 2GBWA 2I7FA 1NDOA 3C0DA 2DE6D 1EZVE 2NWFA 2DE7D 3H1HE 2BMOA 3EN1A 2NUKA 4QDDA 2YVJB 4P1BH 4H44D 2E4QA 1P84E 4NBBD 2HMJA 2NUMA 4NBGD 2QJPC 4QCKA 2QPZA 4HM5A 4OGQD 3GZYA 1PP9E 4NBDD 4HJLA 1ULJA 3VMHD 4QDCA 4NBED 4EMJB 2D2CD 4QURA 3L71E 1Q90C 1G8KB 3GCEA 1VCKA 1KYOE 2ZYLA 4PV1D 2HMMA 3CWBE 2JO6A 1EG9A 4HM8A 2BCCE 3VCPA 1O7PA 4NB9D 3CXHE 3N0QA 1O7MA 1PPJE 3AZCA 2GBXA 2B24A 1UUWA 1ULIA 4HM1A 3VMGD 1NTKE 3D89A 4NB8D 2FYUE 1VF5D 4AIVA 3H1KE 2XR8A 3GB4A 3H1JE 1O7GA 5CXMA 3GOBA 2ZT9D 3H1LE 4PD4E 1WQLA 3L74E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYK A;  4QDF A;  2XSO A;  4NBC D;  1L0L E;  3VCA A;  4NBA D;  1SQP E;  3GZX A;  2NVE A;  3GKE A;  1NTM E;  2IBZ E;  3EQQ A;  1SQB E;  2YFL A;  3L73 E;  1SQQ E;  3DQY A;  3GTE A;  5AEW A;  1NU1 E;  2YFI A;  4NBF D;  3L72 E;  1SQX E;  4HM6 A;  2BMQ A;  1BCC E;  2HMN A;  5KLV E;  2BMR A;  2HMO A;  2XRX A;  4NBH D;  3L70 E;  1SJG A;  4HKV A;  4HM4 A;  5HL4 A;  5BOK A;  2DE5 D;  3TGU E;  1NTZ E;  5KLI C;  1G8J B;  4QUP A;  4U3F E;  5KKZ C;  1KB9 E;  2FYN C;  2B1X A;  3GL0 A;  1JM1 A;  3L75 E;  2NVG A;  2NVF A;  3VMI D;  1RIE A;  2HMK A;  4H13 D;  2E4P A;  4QDF B;  2Q3W A;  4H0L D;  4P1C H;  2CKF A;  1O7H A;  3CX5 E;  1BE3 E;  1ZRT E;  2JZA A;  4HM7 A;  2A06 E;  3BCC E;  4HM0 A;  4AAY B;  1VM9 A;  2E76 D;  3FOU A;  2QJK C;  1FQT A;  1SQV E;  2E74 D;  2HML A;  1L0N E;  2YFJ A;  3GL2 A;  4HM3 A;  1O7N A;  2YIU C;  3GTS A;  3H1I E;  4HM2 A;  4QUQ A;  2XSH A;  1UUV A;  2QJY C;  2E75 D;  1O7W A;  5AEU A;  1RFS A;  2GBW A;  2I7F A;  1NDO A;  3C0D A;  2DE6 D;  1EZV E;  2NWF A;  2DE7 D;  3H1H E;  2BMO A;  3EN1 A;  2NUK A;  4QDD A;  2YVJ B;  4P1B H;  4H44 D;  2E4Q A;  1P84 E;  4NBB D;  2HMJ A;  2NUM A;  4NBG D;  2QJP C;  4QCK A;  2QPZ A;  4HM5 A;  4OGQ D;  3GZY A;  1PP9 E;  4NBD D;  4HJL A;  1ULJ A;  3VMH D;  4QDC A;  4NBE D;  4EMJ B;  2D2C D;  4QUR A;  3L71 E;  1Q90 C;  1G8K B;  3GCE A;  1VCK A;  1KYO E;  2ZYL A;  4PV1 D;  2HMM A;  3CWB E;  2JO6 A;  1EG9 A;  4HM8 A;  2BCC E;  3VCP A;  1O7P A;  4NB9 D;  3CXH E;  3N0Q A;  1O7M A;  1PPJ E;  3AZC A;  2GBX A;  2B24 A;  1UUW A;  1ULI A;  4HM1 A;  3VMG D;  1NTK E;  3D89 A;  4NB8 D;  2FYU E;  1VF5 D;  4AIV A;  3H1K E;  2XR8 A;  3GB4 A;  3H1J E;  1O7G A;  5CXM A;  3GOB A;  2ZT9 D;  3H1L E;  4PD4 E;  1WQL A;  3L74 E; 
#chains in the Genus database with same CATH topology
 1NYK A;  4QDF A;  2XSO A;  4NBC D;  1L0L E;  3VCA A;  4NBA D;  1SQP E;  3GZX A;  2NVE A;  3GKE A;  1NTM E;  2IBZ E;  3EQQ A;  1SQB E;  2YFL A;  3L73 E;  1SQQ E;  3DQY A;  3GTE A;  5AEW A;  1NU1 E;  2YFI A;  4NBF D;  3L72 E;  1SQX E;  4HM6 A;  2BMQ A;  1BCC E;  2HMN A;  5KLV E;  2BMR A;  2HMO A;  2XRX A;  4NBH D;  3L70 E;  1SJG A;  4HKV A;  4HM4 A;  5HL4 A;  5BOK A;  2DE5 D;  3TGU E;  1NTZ E;  5KLI C;  1G8J B;  4QUP A;  4U3F E;  5KKZ C;  1KB9 E;  2FYN C;  2B1X A;  3GL0 A;  1JM1 A;  3L75 E;  2NVG A;  2NVF A;  3VMI D;  1RIE A;  2HMK A;  4H13 D;  2E4P A;  4QDF B;  2Q3W A;  4H0L D;  4P1C H;  2CKF A;  1O7H A;  3CX5 E;  1BE3 E;  1ZRT E;  2JZA A;  4HM7 A;  2A06 E;  3BCC E;  4HM0 A;  4AAY B;  1VM9 A;  2E76 D;  3FOU A;  2QJK C;  1FQT A;  1SQV E;  2E74 D;  2HML A;  1L0N E;  2YFJ A;  3GL2 A;  4HM3 A;  1O7N A;  2YIU C;  3GTS A;  3H1I E;  4HM2 A;  4QUQ A;  2XSH A;  1UUV A;  2QJY C;  2E75 D;  1O7W A;  5AEU A;  1RFS A;  2GBW A;  2I7F A;  1NDO A;  3C0D A;  2DE6 D;  1EZV E;  2NWF A;  2DE7 D;  3H1H E;  2BMO A;  3EN1 A;  2NUK A;  4QDD A;  2YVJ B;  4P1B H;  4H44 D;  2E4Q A;  1P84 E;  4NBB D;  2HMJ A;  2NUM A;  4NBG D;  2QJP C;  4QCK A;  2QPZ A;  4HM5 A;  4OGQ D;  3GZY A;  1PP9 E;  4NBD D;  4HJL A;  1ULJ A;  3VMH D;  4QDC A;  4NBE D;  4EMJ B;  2D2C D;  4QUR A;  3L71 E;  1Q90 C;  1G8K B;  3GCE A;  1VCK A;  1KYO E;  2ZYL A;  4PV1 D;  2HMM A;  3CWB E;  2JO6 A;  1EG9 A;  4HM8 A;  2BCC E;  3VCP A;  1O7P A;  4NB9 D;  3CXH E;  3N0Q A;  1O7M A;  1PPJ E;  3AZC A;  2GBX A;  2B24 A;  1UUW A;  1ULI A;  4HM1 A;  3VMG D;  1NTK E;  3D89 A;  4NB8 D;  2FYU E;  1VF5 D;  4AIV A;  3H1K E;  2XR8 A;  3GB4 A;  3H1J E;  1O7G A;  5CXM A;  3GOB A;  2ZT9 D;  3H1L E;  4PD4 E;  1WQL A;  3L74 E; 
#chains in the Genus database with same CATH homology
 1NYK A;  4QDF A;  2XSO A;  4NBC D;  1L0L E;  3VCA A;  4NBA D;  1SQP E;  3GZX A;  2NVE A;  3GKE A;  1NTM E;  2IBZ E;  3EQQ A;  1SQB E;  2YFL A;  3L73 E;  1SQQ E;  3DQY A;  3GTE A;  5AEW A;  1NU1 E;  2YFI A;  4NBF D;  3L72 E;  1SQX E;  4HM6 A;  2BMQ A;  1BCC E;  2HMN A;  5KLV E;  2BMR A;  2HMO A;  2XRX A;  4NBH D;  3L70 E;  1SJG A;  4HKV A;  4HM4 A;  5HL4 A;  5BOK A;  2DE5 D;  3TGU E;  1NTZ E;  5KLI C;  1G8J B;  4QUP A;  4U3F E;  5KKZ C;  1KB9 E;  2FYN C;  2B1X A;  3GL0 A;  1JM1 A;  3L75 E;  2NVG A;  2NVF A;  3VMI D;  1RIE A;  2HMK A;  4H13 D;  2E4P A;  4QDF B;  2Q3W A;  4H0L D;  4P1C H;  2CKF A;  1O7H A;  3CX5 E;  1BE3 E;  1ZRT E;  2JZA A;  4HM7 A;  2A06 E;  3BCC E;  4HM0 A;  4AAY B;  1VM9 A;  2E76 D;  3FOU A;  2QJK C;  1FQT A;  1SQV E;  2E74 D;  2HML A;  1L0N E;  2YFJ A;  3GL2 A;  4HM3 A;  1O7N A;  2YIU C;  3GTS A;  3H1I E;  4HM2 A;  4QUQ A;  2XSH A;  1UUV A;  2QJY C;  2E75 D;  1O7W A;  5AEU A;  1RFS A;  2GBW A;  2I7F A;  1NDO A;  3C0D A;  2DE6 D;  1EZV E;  2NWF A;  2DE7 D;  3H1H E;  2BMO A;  3EN1 A;  2NUK A;  4QDD A;  2YVJ B;  4P1B H;  4H44 D;  2E4Q A;  1P84 E;  4NBB D;  2HMJ A;  2NUM A;  4NBG D;  2QJP C;  4QCK A;  2QPZ A;  4HM5 A;  4OGQ D;  3GZY A;  1PP9 E;  4NBD D;  4HJL A;  1ULJ A;  3VMH D;  4QDC A;  4NBE D;  4EMJ B;  2D2C D;  4QUR A;  3L71 E;  1Q90 C;  1G8K B;  3GCE A;  1VCK A;  1KYO E;  2ZYL A;  4PV1 D;  2HMM A;  3CWB E;  2JO6 A;  1EG9 A;  4HM8 A;  2BCC E;  3VCP A;  1O7P A;  4NB9 D;  3CXH E;  3N0Q A;  1O7M A;  1PPJ E;  3AZC A;  2GBX A;  2B24 A;  1UUW A;  1ULI A;  4HM1 A;  3VMG D;  1NTK E;  3D89 A;  4NB8 D;  2FYU E;  1VF5 D;  4AIV A;  3H1K E;  2XR8 A;  3GB4 A;  3H1J E;  1O7G A;  5CXM A;  3GOB A;  2ZT9 D;  3H1L E;  4PD4 E;  1WQL A;  3L74 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...