2Q3WA

Ensemble refinement of the protein crystal structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
b'SFEKICSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system ferredoxin subunit
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Electron transport
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2q3wA00
3GZYA 4HM1A 1BE3E 4H0LD 4U3FE 4NB8D 2CKFA 4HJLA 5AEWA 2E74D 2B24A 2B1XA 2E76D 4NBBD 1L0LE 1SQQE 1EG9A 4HM5A 2GBWA 2XRXA 1O7WA 2ZT9D 4QUQA 3N0QA 1RIEA 4NBGD 2A06E 1WQLA 4EMJB 3GKEA 1UUWA 2JO6A 4NBAD 4QURA 4HM3A 1NTZE 2XSOA 3GCEA 4AIVA 3CX5E 1VM9A 1P84E 3H1KE 3L75E 3L70E 5BOKA 2HMLA 4HM4A 4OGQD 2NVFA 1KYOE 4NBED 4QDDA 5KKZC 4PV1D 4PD4E 3H1HE 3DQYA 3C0DA 1O7NA 3GTEA 2HMOA 2QJKC 4HM2A 2GBXA 4HM7A 1JM1A 2QJYC 1ZRTE 3GTSA 3FOUA 4NBHD 3EN1A 1RFSA 3EQQA 2DE5D 1SJGA 5AEUA 3TGUE 4QDCA 2E4PA 3VCPA 1ULJA 4HM6A 2NUMA 4QUPA 3CWBE 3GB4A 2NVGA 3GL2A 1NDOA 2XSHA 1O7HA 1SQPE 2YFIA 2BMOA 3GOBA 3VMHD 2DE6D 1O7PA 2BMQA 3AZCA 4P1BH 2YFJA 4NBDD 1G8KB 1BCCE 1KB9E 1ULIA 2HMJA 4HKVA 1NTKE 3L72E 3BCCE 3H1LE 2FYNC 1PPJE 1SQXE 2BMRA 2YFLA 3VMGD 2NVEA 2QJPC 2YVJB 1O7GA 2NUKA 3L73E 4QDFA 2YIUC 2QPZA 1FQTA 3L71E 3GL0A 4QDFB 1SQBE 1UUVA 2NWFA 2E75D 1L0NE 2JZAA 4H44D 1Q90C 5KLIC 2ZYLA 4AAYB 5HL4A 4HM0A 2BCCE 1SQVE 1VCKA 1VF5D 3D89A 3VMID 2HMKA 2E4QA 2I7FA 1NYKA 3GZXA 4QCKA 4NBFD 5CXMA 2FYUE 2HMNA 2DE7D 2IBZE 4NBCD 1NU1E 1G8JB 4P1CH 2D2CD 4NB9D 2Q3WA 3VCAA 1NTME 1EZVE 5KLVE 2XR8A 3L74E 1PP9E 3CXHE 4HM8A 3H1JE 1O7MA 2HMMA 3H1IE 4H13D
chains in the Genus database with same CATH superfamily
3GZYA 4HM1A 1BE3E 4H0LD 4U3FE 4NB8D 2CKFA 4HJLA 5AEWA 2E74D 2B24A 2B1XA 2E76D 4NBBD 1L0LE 1SQQE 1EG9A 4HM5A 2GBWA 2XRXA 1O7WA 2ZT9D 4QUQA 3N0QA 1RIEA 4NBGD 2A06E 1WQLA 4EMJB 3GKEA 1UUWA 2JO6A 4NBAD 4QURA 4HM3A 1NTZE 2XSOA 3GCEA 4AIVA 3CX5E 1VM9A 1P84E 3H1KE 3L75E 3L70E 5BOKA 2HMLA 4HM4A 4OGQD 2NVFA 1KYOE 4NBED 4QDDA 5KKZC 4PV1D 4PD4E 3H1HE 3DQYA 3C0DA 1O7NA 3GTEA 2HMOA 2QJKC 4HM2A 2GBXA 4HM7A 1JM1A 2QJYC 1ZRTE 3GTSA 3FOUA 4NBHD 3EN1A 1RFSA 3EQQA 2DE5D 1SJGA 5AEUA 3TGUE 4QDCA 2E4PA 3VCPA 1ULJA 4HM6A 2NUMA 4QUPA 3CWBE 3GB4A 2NVGA 3GL2A 1NDOA 2XSHA 1O7HA 1SQPE 2YFIA 2BMOA 3GOBA 3VMHD 2DE6D 1O7PA 2BMQA 3AZCA 4P1BH 2YFJA 4NBDD 1G8KB 1BCCE 1KB9E 1ULIA 2HMJA 4HKVA 1NTKE 3L72E 3BCCE 3H1LE 2FYNC 1PPJE 1SQXE 2BMRA 2YFLA 3VMGD 2NVEA 2QJPC 2YVJB 1O7GA 2NUKA 3L73E 4QDFA 2YIUC 2QPZA 1FQTA 3L71E 3GL0A 4QDFB 1SQBE 1UUVA 2NWFA 2E75D 1L0NE 2JZAA 4H44D 1Q90C 5KLIC 2ZYLA 4AAYB 5HL4A 4HM0A 2BCCE 1SQVE 1VCKA 1VF5D 3D89A 3VMID 2HMKA 2E4QA 2I7FA 1NYKA 3GZXA 4QCKA 4NBFD 5CXMA 2FYUE 2HMNA 2DE7D 2IBZE 4NBCD 1NU1E 1G8JB 4P1CH 2D2CD 4NB9D 2Q3WA 3VCAA 1NTME 1EZVE 5KLVE 2XR8A 3L74E 1PP9E 3CXHE 4HM8A 3H1JE 1O7MA 2HMMA 3H1IE 4H13D
chains in the Genus database with same CATH topology
3GZYA 4HM1A 1BE3E 4H0LD 4U3FE 4NB8D 2CKFA 4HJLA 5AEWA 2E74D 2B24A 2B1XA 2E76D 4NBBD 1L0LE 1SQQE 1EG9A 4HM5A 2GBWA 2XRXA 1O7WA 2ZT9D 4QUQA 3N0QA 1RIEA 4NBGD 2A06E 1WQLA 4EMJB 3GKEA 1UUWA 2JO6A 4NBAD 4QURA 4HM3A 1NTZE 2XSOA 3GCEA 4AIVA 3CX5E 1VM9A 1P84E 3H1KE 3L75E 3L70E 5BOKA 2HMLA 4HM4A 4OGQD 2NVFA 1KYOE 4NBED 4QDDA 5KKZC 4PV1D 4PD4E 3H1HE 3DQYA 3C0DA 1O7NA 3GTEA 2HMOA 2QJKC 4HM2A 2GBXA 4HM7A 1JM1A 2QJYC 1ZRTE 3GTSA 3FOUA 4NBHD 3EN1A 1RFSA 3EQQA 2DE5D 1SJGA 5AEUA 3TGUE 4QDCA 2E4PA 3VCPA 1ULJA 4HM6A 2NUMA 4QUPA 3CWBE 3GB4A 2NVGA 3GL2A 1NDOA 2XSHA 1O7HA 1SQPE 2YFIA 2BMOA 3GOBA 3VMHD 2DE6D 1O7PA 2BMQA 3AZCA 4P1BH 2YFJA 4NBDD 1G8KB 1BCCE 1KB9E 1ULIA 2HMJA 4HKVA 1NTKE 3L72E 3BCCE 3H1LE 2FYNC 1PPJE 1SQXE 2BMRA 2YFLA 3VMGD 2NVEA 2QJPC 2YVJB 1O7GA 2NUKA 3L73E 4QDFA 2YIUC 2QPZA 1FQTA 3L71E 3GL0A 4QDFB 1SQBE 1UUVA 2NWFA 2E75D 1L0NE 2JZAA 4H44D 1Q90C 5KLIC 2ZYLA 4AAYB 5HL4A 4HM0A 2BCCE 1SQVE 1VCKA 1VF5D 3D89A 3VMID 2HMKA 2E4QA 2I7FA 1NYKA 3GZXA 4QCKA 4NBFD 5CXMA 2FYUE 2HMNA 2DE7D 2IBZE 4NBCD 1NU1E 1G8JB 4P1CH 2D2CD 4NB9D 2Q3WA 3VCAA 1NTME 1EZVE 5KLVE 2XR8A 3L74E 1PP9E 3CXHE 4HM8A 3H1JE 1O7MA 2HMMA 3H1IE 4H13D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZY A;  4HM1 A;  1BE3 E;  4H0L D;  4U3F E;  4NB8 D;  2CKF A;  4HJL A;  5AEW A;  2E74 D;  2B24 A;  2B1X A;  2E76 D;  4NBB D;  1L0L E;  1SQQ E;  1EG9 A;  4HM5 A;  2GBW A;  2XRX A;  1O7W A;  2ZT9 D;  4QUQ A;  3N0Q A;  1RIE A;  4NBG D;  2A06 E;  1WQL A;  4EMJ B;  3GKE A;  1UUW A;  2JO6 A;  4NBA D;  4QUR A;  4HM3 A;  1NTZ E;  2XSO A;  3GCE A;  4AIV A;  3CX5 E;  1VM9 A;  1P84 E;  3H1K E;  3L75 E;  3L70 E;  5BOK A;  2HML A;  4HM4 A;  4OGQ D;  2NVF A;  1KYO E;  4NBE D;  4QDD A;  5KKZ C;  4PV1 D;  4PD4 E;  3H1H E;  3DQY A;  3C0D A;  1O7N A;  3GTE A;  2HMO A;  2QJK C;  4HM2 A;  2GBX A;  4HM7 A;  1JM1 A;  2QJY C;  1ZRT E;  3GTS A;  3FOU A;  4NBH D;  3EN1 A;  1RFS A;  3EQQ A;  2DE5 D;  1SJG A;  5AEU A;  3TGU E;  4QDC A;  2E4P A;  3VCP A;  1ULJ A;  4HM6 A;  2NUM A;  4QUP A;  3CWB E;  3GB4 A;  2NVG A;  3GL2 A;  1NDO A;  2XSH A;  1O7H A;  1SQP E;  2YFI A;  2BMO A;  3GOB A;  3VMH D;  2DE6 D;  1O7P A;  2BMQ A;  3AZC A;  4P1B H;  2YFJ A;  4NBD D;  1G8K B;  1BCC E;  1KB9 E;  1ULI A;  2HMJ A;  4HKV A;  1NTK E;  3L72 E;  3BCC E;  3H1L E;  2FYN C;  1PPJ E;  1SQX E;  2BMR A;  2YFL A;  3VMG D;  2NVE A;  2QJP C;  2YVJ B;  1O7G A;  2NUK A;  3L73 E;  4QDF A;  2YIU C;  2QPZ A;  1FQT A;  3L71 E;  3GL0 A;  4QDF B;  1SQB E;  1UUV A;  2NWF A;  2E75 D;  1L0N E;  2JZA A;  4H44 D;  1Q90 C;  5KLI C;  2ZYL A;  4AAY B;  5HL4 A;  4HM0 A;  2BCC E;  1SQV E;  1VCK A;  1VF5 D;  3D89 A;  3VMI D;  2HMK A;  2E4Q A;  2I7F A;  1NYK A;  3GZX A;  4QCK A;  4NBF D;  5CXM A;  2FYU E;  2HMN A;  2DE7 D;  2IBZ E;  4NBC D;  1NU1 E;  1G8J B;  4P1C H;  2D2C D;  4NB9 D;  2Q3W A;  3VCA A;  1NTM E;  1EZV E;  5KLV E;  2XR8 A;  3L74 E;  1PP9 E;  3CXH E;  4HM8 A;  3H1J E;  1O7M A;  2HMM A;  3H1I E;  4H13 D; 
#chains in the Genus database with same CATH topology
 3GZY A;  4HM1 A;  1BE3 E;  4H0L D;  4U3F E;  4NB8 D;  2CKF A;  4HJL A;  5AEW A;  2E74 D;  2B24 A;  2B1X A;  2E76 D;  4NBB D;  1L0L E;  1SQQ E;  1EG9 A;  4HM5 A;  2GBW A;  2XRX A;  1O7W A;  2ZT9 D;  4QUQ A;  3N0Q A;  1RIE A;  4NBG D;  2A06 E;  1WQL A;  4EMJ B;  3GKE A;  1UUW A;  2JO6 A;  4NBA D;  4QUR A;  4HM3 A;  1NTZ E;  2XSO A;  3GCE A;  4AIV A;  3CX5 E;  1VM9 A;  1P84 E;  3H1K E;  3L75 E;  3L70 E;  5BOK A;  2HML A;  4HM4 A;  4OGQ D;  2NVF A;  1KYO E;  4NBE D;  4QDD A;  5KKZ C;  4PV1 D;  4PD4 E;  3H1H E;  3DQY A;  3C0D A;  1O7N A;  3GTE A;  2HMO A;  2QJK C;  4HM2 A;  2GBX A;  4HM7 A;  1JM1 A;  2QJY C;  1ZRT E;  3GTS A;  3FOU A;  4NBH D;  3EN1 A;  1RFS A;  3EQQ A;  2DE5 D;  1SJG A;  5AEU A;  3TGU E;  4QDC A;  2E4P A;  3VCP A;  1ULJ A;  4HM6 A;  2NUM A;  4QUP A;  3CWB E;  3GB4 A;  2NVG A;  3GL2 A;  1NDO A;  2XSH A;  1O7H A;  1SQP E;  2YFI A;  2BMO A;  3GOB A;  3VMH D;  2DE6 D;  1O7P A;  2BMQ A;  3AZC A;  4P1B H;  2YFJ A;  4NBD D;  1G8K B;  1BCC E;  1KB9 E;  1ULI A;  2HMJ A;  4HKV A;  1NTK E;  3L72 E;  3BCC E;  3H1L E;  2FYN C;  1PPJ E;  1SQX E;  2BMR A;  2YFL A;  3VMG D;  2NVE A;  2QJP C;  2YVJ B;  1O7G A;  2NUK A;  3L73 E;  4QDF A;  2YIU C;  2QPZ A;  1FQT A;  3L71 E;  3GL0 A;  4QDF B;  1SQB E;  1UUV A;  2NWF A;  2E75 D;  1L0N E;  2JZA A;  4H44 D;  1Q90 C;  5KLI C;  2ZYL A;  4AAY B;  5HL4 A;  4HM0 A;  2BCC E;  1SQV E;  1VCK A;  1VF5 D;  3D89 A;  3VMI D;  2HMK A;  2E4Q A;  2I7F A;  1NYK A;  3GZX A;  4QCK A;  4NBF D;  5CXM A;  2FYU E;  2HMN A;  2DE7 D;  2IBZ E;  4NBC D;  1NU1 E;  1G8J B;  4P1C H;  2D2C D;  4NB9 D;  2Q3W A;  3VCA A;  1NTM E;  1EZV E;  5KLV E;  2XR8 A;  3L74 E;  1PP9 E;  3CXH E;  4HM8 A;  3H1J E;  1O7M A;  2HMM A;  3H1I E;  4H13 D; 
#chains in the Genus database with same CATH homology
 3GZY A;  4HM1 A;  1BE3 E;  4H0L D;  4U3F E;  4NB8 D;  2CKF A;  4HJL A;  5AEW A;  2E74 D;  2B24 A;  2B1X A;  2E76 D;  4NBB D;  1L0L E;  1SQQ E;  1EG9 A;  4HM5 A;  2GBW A;  2XRX A;  1O7W A;  2ZT9 D;  4QUQ A;  3N0Q A;  1RIE A;  4NBG D;  2A06 E;  1WQL A;  4EMJ B;  3GKE A;  1UUW A;  2JO6 A;  4NBA D;  4QUR A;  4HM3 A;  1NTZ E;  2XSO A;  3GCE A;  4AIV A;  3CX5 E;  1VM9 A;  1P84 E;  3H1K E;  3L75 E;  3L70 E;  5BOK A;  2HML A;  4HM4 A;  4OGQ D;  2NVF A;  1KYO E;  4NBE D;  4QDD A;  5KKZ C;  4PV1 D;  4PD4 E;  3H1H E;  3DQY A;  3C0D A;  1O7N A;  3GTE A;  2HMO A;  2QJK C;  4HM2 A;  2GBX A;  4HM7 A;  1JM1 A;  2QJY C;  1ZRT E;  3GTS A;  3FOU A;  4NBH D;  3EN1 A;  1RFS A;  3EQQ A;  2DE5 D;  1SJG A;  5AEU A;  3TGU E;  4QDC A;  2E4P A;  3VCP A;  1ULJ A;  4HM6 A;  2NUM A;  4QUP A;  3CWB E;  3GB4 A;  2NVG A;  3GL2 A;  1NDO A;  2XSH A;  1O7H A;  1SQP E;  2YFI A;  2BMO A;  3GOB A;  3VMH D;  2DE6 D;  1O7P A;  2BMQ A;  3AZC A;  4P1B H;  2YFJ A;  4NBD D;  1G8K B;  1BCC E;  1KB9 E;  1ULI A;  2HMJ A;  4HKV A;  1NTK E;  3L72 E;  3BCC E;  3H1L E;  2FYN C;  1PPJ E;  1SQX E;  2BMR A;  2YFL A;  3VMG D;  2NVE A;  2QJP C;  2YVJ B;  1O7G A;  2NUK A;  3L73 E;  4QDF A;  2YIU C;  2QPZ A;  1FQT A;  3L71 E;  3GL0 A;  4QDF B;  1SQB E;  1UUV A;  2NWF A;  2E75 D;  1L0N E;  2JZA A;  4H44 D;  1Q90 C;  5KLI C;  2ZYL A;  4AAY B;  5HL4 A;  4HM0 A;  2BCC E;  1SQV E;  1VCK A;  1VF5 D;  3D89 A;  3VMI D;  2HMK A;  2E4Q A;  2I7F A;  1NYK A;  3GZX A;  4QCK A;  4NBF D;  5CXM A;  2FYU E;  2HMN A;  2DE7 D;  2IBZ E;  4NBC D;  1NU1 E;  1G8J B;  4P1C H;  2D2C D;  4NB9 D;  2Q3W A;  3VCA A;  1NTM E;  1EZV E;  5KLV E;  2XR8 A;  3L74 E;  1PP9 E;  3CXH E;  4HM8 A;  3H1J E;  1O7M A;  2HMM A;  3H1I E;  4H13 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...