2Q3WA

Ensemble refinement of the protein crystal structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SFEKICSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Electron transport
molecule keywords Toluene-4-monooxygenase system ferredoxin subunit
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2q3wA00
2QPZA 4PD4E 4HM6A 1NTZE 5KKZC 4QDCA 1SQBE 3AZCA 4NBAD 1L0NE 4H0LD 3H1HE 2B1XA 3EN1A 1RIEA 2CKFA 2GBWA 3H1KE 4QCKA 2A06E 2DE5D 2YFIA 3CWBE 4HM2A 3GB4A 4HM5A 2BMOA 5AEUA 3TGUE 1G8KB 1SQQE 1EZVE 3GZYA 2YVJB 3H1JE 2HMJA 1SQXE 1G8JB 3CX5E 2Q3WA 1KB9E 4NBBD 1VF5D 4QUPA 3VMHD 4HM1A 1NTME 2NVEA 4P1BH 1BE3E 1JM1A 2JZAA 1Q90C 1SJGA 4NBED 4AIVA 2E4QA 3GKEA 3GTEA 2HMKA 4H13D 4OGQD 2BMQA 2HMOA 4H44D 5HL4A 5AEWA 4QDFA 1SQVE 1O7HA 3EQQA 2BMRA 4HKVA 3H1LE 2HMMA 4NBGD 5BOKA 1L0LE 2E4PA 4EMJB 2IBZE 1O7PA 3GCEA 5KLVE 3H1IE 3GL2A 1PPJE 4HM8A 1NTKE 3GOBA 1WQLA 4NBCD 1O7WA 1O7GA 2BCCE 4QUQA 4NB8D 3C0DA 2ZT9D 1SQPE 3L75E 1PP9E 3GL0A 4NBDD 1NDOA 2XSOA 2XR8A 2DE7D 2E76D 2YFJA 5KLIC 2NUMA 4HJLA 1NU1E 2GBXA 1BCCE 4HM4A 4NBHD 1NYKA 4NB9D 2XSHA 3GZXA 2DE6D 3N0QA 4U3FE 2FYUE 2QJPC 2E74D 2B24A 3L73E 3DQYA 3VMGD 3VCPA 1RFSA 4HM0A 4QDFB 2YIUC 4P1CH 1O7NA 1O7MA 4AAYB 1ZRTE 3CXHE 1ULIA 2I7FA 2NVFA 2QJKC 3GTSA 3VMID 1EG9A 3BCCE 1ULJA 2HMNA 1KYOE 4NBFD 4HM3A 1UUVA 2JO6A 4QDDA 3FOUA 4QURA 1VM9A 2XRXA 2YFLA 4HM7A 3L70E 3L72E 3D89A 3L71E 1VCKA 1P84E 3VCAA 2E75D 1UUWA 2HMLA 2NWFA 3L74E 2ZYLA 5CXMA 2NVGA 2D2CD 2FYNC 1FQTA 2QJYC 4PV1D 2NUKA
chains in the Genus database with same CATH superfamily
2QPZA 4PD4E 4HM6A 1NTZE 5KKZC 4QDCA 1SQBE 3AZCA 4NBAD 1L0NE 4H0LD 3H1HE 2B1XA 3EN1A 1RIEA 2CKFA 2GBWA 3H1KE 4QCKA 2A06E 2DE5D 2YFIA 3CWBE 4HM2A 3GB4A 4HM5A 2BMOA 5AEUA 3TGUE 1G8KB 1SQQE 1EZVE 3GZYA 2YVJB 3H1JE 2HMJA 1SQXE 1G8JB 3CX5E 2Q3WA 1KB9E 4NBBD 1VF5D 4QUPA 3VMHD 4HM1A 1NTME 2NVEA 4P1BH 1BE3E 1JM1A 2JZAA 1Q90C 1SJGA 4NBED 4AIVA 2E4QA 3GKEA 3GTEA 2HMKA 4H13D 4OGQD 2BMQA 2HMOA 4H44D 5HL4A 5AEWA 4QDFA 1SQVE 1O7HA 3EQQA 2BMRA 4HKVA 3H1LE 2HMMA 4NBGD 5BOKA 1L0LE 2E4PA 4EMJB 2IBZE 1O7PA 3GCEA 5KLVE 3H1IE 3GL2A 1PPJE 4HM8A 1NTKE 3GOBA 1WQLA 4NBCD 1O7WA 1O7GA 2BCCE 4QUQA 4NB8D 3C0DA 2ZT9D 1SQPE 3L75E 1PP9E 3GL0A 4NBDD 1NDOA 2XSOA 2XR8A 2DE7D 2E76D 2YFJA 5KLIC 2NUMA 4HJLA 1NU1E 2GBXA 1BCCE 4HM4A 4NBHD 1NYKA 4NB9D 2XSHA 3GZXA 2DE6D 3N0QA 4U3FE 2FYUE 2QJPC 2E74D 2B24A 3L73E 3DQYA 3VMGD 3VCPA 1RFSA 4HM0A 4QDFB 2YIUC 4P1CH 1O7NA 1O7MA 4AAYB 1ZRTE 3CXHE 1ULIA 2I7FA 2NVFA 2QJKC 3GTSA 3VMID 1EG9A 3BCCE 1ULJA 2HMNA 1KYOE 4NBFD 4HM3A 1UUVA 2JO6A 4QDDA 3FOUA 4QURA 1VM9A 2XRXA 2YFLA 4HM7A 3L70E 3L72E 3D89A 3L71E 1VCKA 1P84E 3VCAA 2E75D 1UUWA 2HMLA 2NWFA 3L74E 2ZYLA 5CXMA 2NVGA 2D2CD 2FYNC 1FQTA 2QJYC 4PV1D 2NUKA
chains in the Genus database with same CATH topology
2QPZA 4PD4E 4HM6A 1NTZE 5KKZC 4QDCA 1SQBE 3AZCA 4NBAD 1L0NE 4H0LD 3H1HE 2B1XA 3EN1A 1RIEA 2CKFA 2GBWA 3H1KE 4QCKA 2A06E 2DE5D 2YFIA 3CWBE 4HM2A 3GB4A 4HM5A 2BMOA 5AEUA 3TGUE 1G8KB 1SQQE 1EZVE 3GZYA 2YVJB 3H1JE 2HMJA 1SQXE 1G8JB 3CX5E 2Q3WA 1KB9E 4NBBD 1VF5D 4QUPA 3VMHD 4HM1A 1NTME 2NVEA 4P1BH 1BE3E 1JM1A 2JZAA 1Q90C 1SJGA 4NBED 4AIVA 2E4QA 3GKEA 3GTEA 2HMKA 4H13D 4OGQD 2BMQA 2HMOA 4H44D 5HL4A 5AEWA 4QDFA 1SQVE 1O7HA 3EQQA 2BMRA 4HKVA 3H1LE 2HMMA 4NBGD 5BOKA 1L0LE 2E4PA 4EMJB 2IBZE 1O7PA 3GCEA 5KLVE 3H1IE 3GL2A 1PPJE 4HM8A 1NTKE 3GOBA 1WQLA 4NBCD 1O7WA 1O7GA 2BCCE 4QUQA 4NB8D 3C0DA 2ZT9D 1SQPE 3L75E 1PP9E 3GL0A 4NBDD 1NDOA 2XSOA 2XR8A 2DE7D 2E76D 2YFJA 5KLIC 2NUMA 4HJLA 1NU1E 2GBXA 1BCCE 4HM4A 4NBHD 1NYKA 4NB9D 2XSHA 3GZXA 2DE6D 3N0QA 4U3FE 2FYUE 2QJPC 2E74D 2B24A 3L73E 3DQYA 3VMGD 3VCPA 1RFSA 4HM0A 4QDFB 2YIUC 4P1CH 1O7NA 1O7MA 4AAYB 1ZRTE 3CXHE 1ULIA 2I7FA 2NVFA 2QJKC 3GTSA 3VMID 1EG9A 3BCCE 1ULJA 2HMNA 1KYOE 4NBFD 4HM3A 1UUVA 2JO6A 4QDDA 3FOUA 4QURA 1VM9A 2XRXA 2YFLA 4HM7A 3L70E 3L72E 3D89A 3L71E 1VCKA 1P84E 3VCAA 2E75D 1UUWA 2HMLA 2NWFA 3L74E 2ZYLA 5CXMA 2NVGA 2D2CD 2FYNC 1FQTA 2QJYC 4PV1D 2NUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPZ A;  4PD4 E;  4HM6 A;  1NTZ E;  5KKZ C;  4QDC A;  1SQB E;  3AZC A;  4NBA D;  1L0N E;  4H0L D;  3H1H E;  2B1X A;  3EN1 A;  1RIE A;  2CKF A;  2GBW A;  3H1K E;  4QCK A;  2A06 E;  2DE5 D;  2YFI A;  3CWB E;  4HM2 A;  3GB4 A;  4HM5 A;  2BMO A;  5AEU A;  3TGU E;  1G8K B;  1SQQ E;  1EZV E;  3GZY A;  2YVJ B;  3H1J E;  2HMJ A;  1SQX E;  1G8J B;  3CX5 E;  2Q3W A;  1KB9 E;  4NBB D;  1VF5 D;  4QUP A;  3VMH D;  4HM1 A;  1NTM E;  2NVE A;  4P1B H;  1BE3 E;  1JM1 A;  2JZA A;  1Q90 C;  1SJG A;  4NBE D;  4AIV A;  2E4Q A;  3GKE A;  3GTE A;  2HMK A;  4H13 D;  4OGQ D;  2BMQ A;  2HMO A;  4H44 D;  5HL4 A;  5AEW A;  4QDF A;  1SQV E;  1O7H A;  3EQQ A;  2BMR A;  4HKV A;  3H1L E;  2HMM A;  4NBG D;  5BOK A;  1L0L E;  2E4P A;  4EMJ B;  2IBZ E;  1O7P A;  3GCE A;  5KLV E;  3H1I E;  3GL2 A;  1PPJ E;  4HM8 A;  1NTK E;  3GOB A;  1WQL A;  4NBC D;  1O7W A;  1O7G A;  2BCC E;  4QUQ A;  4NB8 D;  3C0D A;  2ZT9 D;  1SQP E;  3L75 E;  1PP9 E;  3GL0 A;  4NBD D;  1NDO A;  2XSO A;  2XR8 A;  2DE7 D;  2E76 D;  2YFJ A;  5KLI C;  2NUM A;  4HJL A;  1NU1 E;  2GBX A;  1BCC E;  4HM4 A;  4NBH D;  1NYK A;  4NB9 D;  2XSH A;  3GZX A;  2DE6 D;  3N0Q A;  4U3F E;  2FYU E;  2QJP C;  2E74 D;  2B24 A;  3L73 E;  3DQY A;  3VMG D;  3VCP A;  1RFS A;  4HM0 A;  4QDF B;  2YIU C;  4P1C H;  1O7N A;  1O7M A;  4AAY B;  1ZRT E;  3CXH E;  1ULI A;  2I7F A;  2NVF A;  2QJK C;  3GTS A;  3VMI D;  1EG9 A;  3BCC E;  1ULJ A;  2HMN A;  1KYO E;  4NBF D;  4HM3 A;  1UUV A;  2JO6 A;  4QDD A;  3FOU A;  4QUR A;  1VM9 A;  2XRX A;  2YFL A;  4HM7 A;  3L70 E;  3L72 E;  3D89 A;  3L71 E;  1VCK A;  1P84 E;  3VCA A;  2E75 D;  1UUW A;  2HML A;  2NWF A;  3L74 E;  2ZYL A;  5CXM A;  2NVG A;  2D2C D;  2FYN C;  1FQT A;  2QJY C;  4PV1 D;  2NUK A; 
#chains in the Genus database with same CATH topology
 2QPZ A;  4PD4 E;  4HM6 A;  1NTZ E;  5KKZ C;  4QDC A;  1SQB E;  3AZC A;  4NBA D;  1L0N E;  4H0L D;  3H1H E;  2B1X A;  3EN1 A;  1RIE A;  2CKF A;  2GBW A;  3H1K E;  4QCK A;  2A06 E;  2DE5 D;  2YFI A;  3CWB E;  4HM2 A;  3GB4 A;  4HM5 A;  2BMO A;  5AEU A;  3TGU E;  1G8K B;  1SQQ E;  1EZV E;  3GZY A;  2YVJ B;  3H1J E;  2HMJ A;  1SQX E;  1G8J B;  3CX5 E;  2Q3W A;  1KB9 E;  4NBB D;  1VF5 D;  4QUP A;  3VMH D;  4HM1 A;  1NTM E;  2NVE A;  4P1B H;  1BE3 E;  1JM1 A;  2JZA A;  1Q90 C;  1SJG A;  4NBE D;  4AIV A;  2E4Q A;  3GKE A;  3GTE A;  2HMK A;  4H13 D;  4OGQ D;  2BMQ A;  2HMO A;  4H44 D;  5HL4 A;  5AEW A;  4QDF A;  1SQV E;  1O7H A;  3EQQ A;  2BMR A;  4HKV A;  3H1L E;  2HMM A;  4NBG D;  5BOK A;  1L0L E;  2E4P A;  4EMJ B;  2IBZ E;  1O7P A;  3GCE A;  5KLV E;  3H1I E;  3GL2 A;  1PPJ E;  4HM8 A;  1NTK E;  3GOB A;  1WQL A;  4NBC D;  1O7W A;  1O7G A;  2BCC E;  4QUQ A;  4NB8 D;  3C0D A;  2ZT9 D;  1SQP E;  3L75 E;  1PP9 E;  3GL0 A;  4NBD D;  1NDO A;  2XSO A;  2XR8 A;  2DE7 D;  2E76 D;  2YFJ A;  5KLI C;  2NUM A;  4HJL A;  1NU1 E;  2GBX A;  1BCC E;  4HM4 A;  4NBH D;  1NYK A;  4NB9 D;  2XSH A;  3GZX A;  2DE6 D;  3N0Q A;  4U3F E;  2FYU E;  2QJP C;  2E74 D;  2B24 A;  3L73 E;  3DQY A;  3VMG D;  3VCP A;  1RFS A;  4HM0 A;  4QDF B;  2YIU C;  4P1C H;  1O7N A;  1O7M A;  4AAY B;  1ZRT E;  3CXH E;  1ULI A;  2I7F A;  2NVF A;  2QJK C;  3GTS A;  3VMI D;  1EG9 A;  3BCC E;  1ULJ A;  2HMN A;  1KYO E;  4NBF D;  4HM3 A;  1UUV A;  2JO6 A;  4QDD A;  3FOU A;  4QUR A;  1VM9 A;  2XRX A;  2YFL A;  4HM7 A;  3L70 E;  3L72 E;  3D89 A;  3L71 E;  1VCK A;  1P84 E;  3VCA A;  2E75 D;  1UUW A;  2HML A;  2NWF A;  3L74 E;  2ZYL A;  5CXM A;  2NVG A;  2D2C D;  2FYN C;  1FQT A;  2QJY C;  4PV1 D;  2NUK A; 
#chains in the Genus database with same CATH homology
 2QPZ A;  4PD4 E;  4HM6 A;  1NTZ E;  5KKZ C;  4QDC A;  1SQB E;  3AZC A;  4NBA D;  1L0N E;  4H0L D;  3H1H E;  2B1X A;  3EN1 A;  1RIE A;  2CKF A;  2GBW A;  3H1K E;  4QCK A;  2A06 E;  2DE5 D;  2YFI A;  3CWB E;  4HM2 A;  3GB4 A;  4HM5 A;  2BMO A;  5AEU A;  3TGU E;  1G8K B;  1SQQ E;  1EZV E;  3GZY A;  2YVJ B;  3H1J E;  2HMJ A;  1SQX E;  1G8J B;  3CX5 E;  2Q3W A;  1KB9 E;  4NBB D;  1VF5 D;  4QUP A;  3VMH D;  4HM1 A;  1NTM E;  2NVE A;  4P1B H;  1BE3 E;  1JM1 A;  2JZA A;  1Q90 C;  1SJG A;  4NBE D;  4AIV A;  2E4Q A;  3GKE A;  3GTE A;  2HMK A;  4H13 D;  4OGQ D;  2BMQ A;  2HMO A;  4H44 D;  5HL4 A;  5AEW A;  4QDF A;  1SQV E;  1O7H A;  3EQQ A;  2BMR A;  4HKV A;  3H1L E;  2HMM A;  4NBG D;  5BOK A;  1L0L E;  2E4P A;  4EMJ B;  2IBZ E;  1O7P A;  3GCE A;  5KLV E;  3H1I E;  3GL2 A;  1PPJ E;  4HM8 A;  1NTK E;  3GOB A;  1WQL A;  4NBC D;  1O7W A;  1O7G A;  2BCC E;  4QUQ A;  4NB8 D;  3C0D A;  2ZT9 D;  1SQP E;  3L75 E;  1PP9 E;  3GL0 A;  4NBD D;  1NDO A;  2XSO A;  2XR8 A;  2DE7 D;  2E76 D;  2YFJ A;  5KLI C;  2NUM A;  4HJL A;  1NU1 E;  2GBX A;  1BCC E;  4HM4 A;  4NBH D;  1NYK A;  4NB9 D;  2XSH A;  3GZX A;  2DE6 D;  3N0Q A;  4U3F E;  2FYU E;  2QJP C;  2E74 D;  2B24 A;  3L73 E;  3DQY A;  3VMG D;  3VCP A;  1RFS A;  4HM0 A;  4QDF B;  2YIU C;  4P1C H;  1O7N A;  1O7M A;  4AAY B;  1ZRT E;  3CXH E;  1ULI A;  2I7F A;  2NVF A;  2QJK C;  3GTS A;  3VMI D;  1EG9 A;  3BCC E;  1ULJ A;  2HMN A;  1KYO E;  4NBF D;  4HM3 A;  1UUV A;  2JO6 A;  4QDD A;  3FOU A;  4QUR A;  1VM9 A;  2XRX A;  2YFL A;  4HM7 A;  3L70 E;  3L72 E;  3D89 A;  3L71 E;  1VCK A;  1P84 E;  3VCA A;  2E75 D;  1UUW A;  2HML A;  2NWF A;  3L74 E;  2ZYL A;  5CXM A;  2NVG A;  2D2C D;  2FYN C;  1FQT A;  2QJY C;  4PV1 D;  2NUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...