2Q3WA

Ensemble refinement of the protein crystal structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SFEKICSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system ferredoxin subunit
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Electron transport
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2q3wA00
1O7WA 4QDFB 1L0LE 2YFLA 1VM9A 1RIEA 1UUVA 2I7FA 2IBZE 1EG9A 2Q3WA 1JM1A 4H44D 1NYKA 4HM2A 4AAYB 1VF5D 3GL0A 4HM0A 3GKEA 2NVFA 4HM4A 4PD4E 4QUPA 1SQVE 2NVGA 4HM8A 1SJGA 1ZRTE 2NUMA 3BCCE 3L73E 3GB4A 2CKFA 2JZAA 1G8JB 4P1CH 3H1HE 1ULJA 2E4QA 2QJPC 3H1KE 5KLVE 2BCCE 3CX5E 3AZCA 2HMMA 1BE3E 3GL2A 3L72E 1O7PA 4H13D 1NTKE 1KYOE 3GZYA 1RFSA 4NBHD 2HMJA 4NBDD 1L0NE 4QDDA 2QPZA 1KB9E 4QDCA 1PPJE 1NU1E 3EN1A 2A06E 3EQQA 1NTZE 3VCAA 4NBFD 4OGQD 2HMKA 2NVEA 1SQXE 3D89A 5BOKA 3GZXA 2D2CD 4NBCD 1BCCE 3L71E 3GTSA 2YFIA 1ULIA 4HM1A 1WQLA 2E75D 5AEWA 2BMOA 4NBGD 1SQPE 4QURA 1NTME 2FYNC 2XSOA 4U3FE 2NUKA 2HMLA 4PV1D 3L70E 1PP9E 5AEUA 3CXHE 2JO6A 3C0DA 2DE5D 3FOUA 2YVJB 2E4PA 2QJKC 2HMOA 2QJYC 2ZT9D 1FQTA 2XR8A 2GBXA 1O7MA 4HKVA 3N0QA 5KKZC 2BMQA 4H0LD 2BMRA 4QUQA 1Q90C 3VCPA 4QDFA 2B1XA 3VMHD 1O7GA 1P84E 5KLIC 3VMID 3H1JE 4P1BH 4HM5A 4HM3A 4HJLA 2E76D 2YFJA 3L75E 2DE6D 4NBAD 2XRXA 2YIUC 2FYUE 2XSHA 4NB8D 1VCKA 3DQYA 1NDOA 2NWFA 2B24A 4NBBD 4NBED 5HL4A 3H1IE 1G8KB 3GTEA 3GOBA 2DE7D 2GBWA 3VMGD 3L74E 4QCKA 1SQQE 3TGUE 1O7NA 4NB9D 1SQBE 1UUWA 5CXMA 4HM7A 1EZVE 1O7HA 2E74D 2HMNA 4EMJB 3GCEA 3H1LE 2ZYLA 4AIVA 3CWBE 4HM6A
chains in the Genus database with same CATH superfamily
1O7WA 4QDFB 1L0LE 2YFLA 1VM9A 1RIEA 1UUVA 2I7FA 2IBZE 1EG9A 2Q3WA 1JM1A 4H44D 1NYKA 4HM2A 4AAYB 1VF5D 3GL0A 4HM0A 3GKEA 2NVFA 4HM4A 4PD4E 4QUPA 1SQVE 2NVGA 4HM8A 1SJGA 1ZRTE 2NUMA 3BCCE 3L73E 3GB4A 2CKFA 2JZAA 1G8JB 4P1CH 3H1HE 1ULJA 2E4QA 2QJPC 3H1KE 5KLVE 2BCCE 3CX5E 3AZCA 2HMMA 1BE3E 3GL2A 3L72E 1O7PA 4H13D 1NTKE 1KYOE 3GZYA 1RFSA 4NBHD 2HMJA 4NBDD 1L0NE 4QDDA 2QPZA 1KB9E 4QDCA 1PPJE 1NU1E 3EN1A 2A06E 3EQQA 1NTZE 3VCAA 4NBFD 4OGQD 2HMKA 2NVEA 1SQXE 3D89A 5BOKA 3GZXA 2D2CD 4NBCD 1BCCE 3L71E 3GTSA 2YFIA 1ULIA 4HM1A 1WQLA 2E75D 5AEWA 2BMOA 4NBGD 1SQPE 4QURA 1NTME 2FYNC 2XSOA 4U3FE 2NUKA 2HMLA 4PV1D 3L70E 1PP9E 5AEUA 3CXHE 2JO6A 3C0DA 2DE5D 3FOUA 2YVJB 2E4PA 2QJKC 2HMOA 2QJYC 2ZT9D 1FQTA 2XR8A 2GBXA 1O7MA 4HKVA 3N0QA 5KKZC 2BMQA 4H0LD 2BMRA 4QUQA 1Q90C 3VCPA 4QDFA 2B1XA 3VMHD 1O7GA 1P84E 5KLIC 3VMID 3H1JE 4P1BH 4HM5A 4HM3A 4HJLA 2E76D 2YFJA 3L75E 2DE6D 4NBAD 2XRXA 2YIUC 2FYUE 2XSHA 4NB8D 1VCKA 3DQYA 1NDOA 2NWFA 2B24A 4NBBD 4NBED 5HL4A 3H1IE 1G8KB 3GTEA 3GOBA 2DE7D 2GBWA 3VMGD 3L74E 4QCKA 1SQQE 3TGUE 1O7NA 4NB9D 1SQBE 1UUWA 5CXMA 4HM7A 1EZVE 1O7HA 2E74D 2HMNA 4EMJB 3GCEA 3H1LE 2ZYLA 4AIVA 3CWBE 4HM6A
chains in the Genus database with same CATH topology
1O7WA 4QDFB 1L0LE 2YFLA 1VM9A 1RIEA 1UUVA 2I7FA 2IBZE 1EG9A 2Q3WA 1JM1A 4H44D 1NYKA 4HM2A 4AAYB 1VF5D 3GL0A 4HM0A 3GKEA 2NVFA 4HM4A 4PD4E 4QUPA 1SQVE 2NVGA 4HM8A 1SJGA 1ZRTE 2NUMA 3BCCE 3L73E 3GB4A 2CKFA 2JZAA 1G8JB 4P1CH 3H1HE 1ULJA 2E4QA 2QJPC 3H1KE 5KLVE 2BCCE 3CX5E 3AZCA 2HMMA 1BE3E 3GL2A 3L72E 1O7PA 4H13D 1NTKE 1KYOE 3GZYA 1RFSA 4NBHD 2HMJA 4NBDD 1L0NE 4QDDA 2QPZA 1KB9E 4QDCA 1PPJE 1NU1E 3EN1A 2A06E 3EQQA 1NTZE 3VCAA 4NBFD 4OGQD 2HMKA 2NVEA 1SQXE 3D89A 5BOKA 3GZXA 2D2CD 4NBCD 1BCCE 3L71E 3GTSA 2YFIA 1ULIA 4HM1A 1WQLA 2E75D 5AEWA 2BMOA 4NBGD 1SQPE 4QURA 1NTME 2FYNC 2XSOA 4U3FE 2NUKA 2HMLA 4PV1D 3L70E 1PP9E 5AEUA 3CXHE 2JO6A 3C0DA 2DE5D 3FOUA 2YVJB 2E4PA 2QJKC 2HMOA 2QJYC 2ZT9D 1FQTA 2XR8A 2GBXA 1O7MA 4HKVA 3N0QA 5KKZC 2BMQA 4H0LD 2BMRA 4QUQA 1Q90C 3VCPA 4QDFA 2B1XA 3VMHD 1O7GA 1P84E 5KLIC 3VMID 3H1JE 4P1BH 4HM5A 4HM3A 4HJLA 2E76D 2YFJA 3L75E 2DE6D 4NBAD 2XRXA 2YIUC 2FYUE 2XSHA 4NB8D 1VCKA 3DQYA 1NDOA 2NWFA 2B24A 4NBBD 4NBED 5HL4A 3H1IE 1G8KB 3GTEA 3GOBA 2DE7D 2GBWA 3VMGD 3L74E 4QCKA 1SQQE 3TGUE 1O7NA 4NB9D 1SQBE 1UUWA 5CXMA 4HM7A 1EZVE 1O7HA 2E74D 2HMNA 4EMJB 3GCEA 3H1LE 2ZYLA 4AIVA 3CWBE 4HM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7W A;  4QDF B;  1L0L E;  2YFL A;  1VM9 A;  1RIE A;  1UUV A;  2I7F A;  2IBZ E;  1EG9 A;  2Q3W A;  1JM1 A;  4H44 D;  1NYK A;  4HM2 A;  4AAY B;  1VF5 D;  3GL0 A;  4HM0 A;  3GKE A;  2NVF A;  4HM4 A;  4PD4 E;  4QUP A;  1SQV E;  2NVG A;  4HM8 A;  1SJG A;  1ZRT E;  2NUM A;  3BCC E;  3L73 E;  3GB4 A;  2CKF A;  2JZA A;  1G8J B;  4P1C H;  3H1H E;  1ULJ A;  2E4Q A;  2QJP C;  3H1K E;  5KLV E;  2BCC E;  3CX5 E;  3AZC A;  2HMM A;  1BE3 E;  3GL2 A;  3L72 E;  1O7P A;  4H13 D;  1NTK E;  1KYO E;  3GZY A;  1RFS A;  4NBH D;  2HMJ A;  4NBD D;  1L0N E;  4QDD A;  2QPZ A;  1KB9 E;  4QDC A;  1PPJ E;  1NU1 E;  3EN1 A;  2A06 E;  3EQQ A;  1NTZ E;  3VCA A;  4NBF D;  4OGQ D;  2HMK A;  2NVE A;  1SQX E;  3D89 A;  5BOK A;  3GZX A;  2D2C D;  4NBC D;  1BCC E;  3L71 E;  3GTS A;  2YFI A;  1ULI A;  4HM1 A;  1WQL A;  2E75 D;  5AEW A;  2BMO A;  4NBG D;  1SQP E;  4QUR A;  1NTM E;  2FYN C;  2XSO A;  4U3F E;  2NUK A;  2HML A;  4PV1 D;  3L70 E;  1PP9 E;  5AEU A;  3CXH E;  2JO6 A;  3C0D A;  2DE5 D;  3FOU A;  2YVJ B;  2E4P A;  2QJK C;  2HMO A;  2QJY C;  2ZT9 D;  1FQT A;  2XR8 A;  2GBX A;  1O7M A;  4HKV A;  3N0Q A;  5KKZ C;  2BMQ A;  4H0L D;  2BMR A;  4QUQ A;  1Q90 C;  3VCP A;  4QDF A;  2B1X A;  3VMH D;  1O7G A;  1P84 E;  5KLI C;  3VMI D;  3H1J E;  4P1B H;  4HM5 A;  4HM3 A;  4HJL A;  2E76 D;  2YFJ A;  3L75 E;  2DE6 D;  4NBA D;  2XRX A;  2YIU C;  2FYU E;  2XSH A;  4NB8 D;  1VCK A;  3DQY A;  1NDO A;  2NWF A;  2B24 A;  4NBB D;  4NBE D;  5HL4 A;  3H1I E;  1G8K B;  3GTE A;  3GOB A;  2DE7 D;  2GBW A;  3VMG D;  3L74 E;  4QCK A;  1SQQ E;  3TGU E;  1O7N A;  4NB9 D;  1SQB E;  1UUW A;  5CXM A;  4HM7 A;  1EZV E;  1O7H A;  2E74 D;  2HMN A;  4EMJ B;  3GCE A;  3H1L E;  2ZYL A;  4AIV A;  3CWB E;  4HM6 A; 
#chains in the Genus database with same CATH topology
 1O7W A;  4QDF B;  1L0L E;  2YFL A;  1VM9 A;  1RIE A;  1UUV A;  2I7F A;  2IBZ E;  1EG9 A;  2Q3W A;  1JM1 A;  4H44 D;  1NYK A;  4HM2 A;  4AAY B;  1VF5 D;  3GL0 A;  4HM0 A;  3GKE A;  2NVF A;  4HM4 A;  4PD4 E;  4QUP A;  1SQV E;  2NVG A;  4HM8 A;  1SJG A;  1ZRT E;  2NUM A;  3BCC E;  3L73 E;  3GB4 A;  2CKF A;  2JZA A;  1G8J B;  4P1C H;  3H1H E;  1ULJ A;  2E4Q A;  2QJP C;  3H1K E;  5KLV E;  2BCC E;  3CX5 E;  3AZC A;  2HMM A;  1BE3 E;  3GL2 A;  3L72 E;  1O7P A;  4H13 D;  1NTK E;  1KYO E;  3GZY A;  1RFS A;  4NBH D;  2HMJ A;  4NBD D;  1L0N E;  4QDD A;  2QPZ A;  1KB9 E;  4QDC A;  1PPJ E;  1NU1 E;  3EN1 A;  2A06 E;  3EQQ A;  1NTZ E;  3VCA A;  4NBF D;  4OGQ D;  2HMK A;  2NVE A;  1SQX E;  3D89 A;  5BOK A;  3GZX A;  2D2C D;  4NBC D;  1BCC E;  3L71 E;  3GTS A;  2YFI A;  1ULI A;  4HM1 A;  1WQL A;  2E75 D;  5AEW A;  2BMO A;  4NBG D;  1SQP E;  4QUR A;  1NTM E;  2FYN C;  2XSO A;  4U3F E;  2NUK A;  2HML A;  4PV1 D;  3L70 E;  1PP9 E;  5AEU A;  3CXH E;  2JO6 A;  3C0D A;  2DE5 D;  3FOU A;  2YVJ B;  2E4P A;  2QJK C;  2HMO A;  2QJY C;  2ZT9 D;  1FQT A;  2XR8 A;  2GBX A;  1O7M A;  4HKV A;  3N0Q A;  5KKZ C;  2BMQ A;  4H0L D;  2BMR A;  4QUQ A;  1Q90 C;  3VCP A;  4QDF A;  2B1X A;  3VMH D;  1O7G A;  1P84 E;  5KLI C;  3VMI D;  3H1J E;  4P1B H;  4HM5 A;  4HM3 A;  4HJL A;  2E76 D;  2YFJ A;  3L75 E;  2DE6 D;  4NBA D;  2XRX A;  2YIU C;  2FYU E;  2XSH A;  4NB8 D;  1VCK A;  3DQY A;  1NDO A;  2NWF A;  2B24 A;  4NBB D;  4NBE D;  5HL4 A;  3H1I E;  1G8K B;  3GTE A;  3GOB A;  2DE7 D;  2GBW A;  3VMG D;  3L74 E;  4QCK A;  1SQQ E;  3TGU E;  1O7N A;  4NB9 D;  1SQB E;  1UUW A;  5CXM A;  4HM7 A;  1EZV E;  1O7H A;  2E74 D;  2HMN A;  4EMJ B;  3GCE A;  3H1L E;  2ZYL A;  4AIV A;  3CWB E;  4HM6 A; 
#chains in the Genus database with same CATH homology
 1O7W A;  4QDF B;  1L0L E;  2YFL A;  1VM9 A;  1RIE A;  1UUV A;  2I7F A;  2IBZ E;  1EG9 A;  2Q3W A;  1JM1 A;  4H44 D;  1NYK A;  4HM2 A;  4AAY B;  1VF5 D;  3GL0 A;  4HM0 A;  3GKE A;  2NVF A;  4HM4 A;  4PD4 E;  4QUP A;  1SQV E;  2NVG A;  4HM8 A;  1SJG A;  1ZRT E;  2NUM A;  3BCC E;  3L73 E;  3GB4 A;  2CKF A;  2JZA A;  1G8J B;  4P1C H;  3H1H E;  1ULJ A;  2E4Q A;  2QJP C;  3H1K E;  5KLV E;  2BCC E;  3CX5 E;  3AZC A;  2HMM A;  1BE3 E;  3GL2 A;  3L72 E;  1O7P A;  4H13 D;  1NTK E;  1KYO E;  3GZY A;  1RFS A;  4NBH D;  2HMJ A;  4NBD D;  1L0N E;  4QDD A;  2QPZ A;  1KB9 E;  4QDC A;  1PPJ E;  1NU1 E;  3EN1 A;  2A06 E;  3EQQ A;  1NTZ E;  3VCA A;  4NBF D;  4OGQ D;  2HMK A;  2NVE A;  1SQX E;  3D89 A;  5BOK A;  3GZX A;  2D2C D;  4NBC D;  1BCC E;  3L71 E;  3GTS A;  2YFI A;  1ULI A;  4HM1 A;  1WQL A;  2E75 D;  5AEW A;  2BMO A;  4NBG D;  1SQP E;  4QUR A;  1NTM E;  2FYN C;  2XSO A;  4U3F E;  2NUK A;  2HML A;  4PV1 D;  3L70 E;  1PP9 E;  5AEU A;  3CXH E;  2JO6 A;  3C0D A;  2DE5 D;  3FOU A;  2YVJ B;  2E4P A;  2QJK C;  2HMO A;  2QJY C;  2ZT9 D;  1FQT A;  2XR8 A;  2GBX A;  1O7M A;  4HKV A;  3N0Q A;  5KKZ C;  2BMQ A;  4H0L D;  2BMR A;  4QUQ A;  1Q90 C;  3VCP A;  4QDF A;  2B1X A;  3VMH D;  1O7G A;  1P84 E;  5KLI C;  3VMI D;  3H1J E;  4P1B H;  4HM5 A;  4HM3 A;  4HJL A;  2E76 D;  2YFJ A;  3L75 E;  2DE6 D;  4NBA D;  2XRX A;  2YIU C;  2FYU E;  2XSH A;  4NB8 D;  1VCK A;  3DQY A;  1NDO A;  2NWF A;  2B24 A;  4NBB D;  4NBE D;  5HL4 A;  3H1I E;  1G8K B;  3GTE A;  3GOB A;  2DE7 D;  2GBW A;  3VMG D;  3L74 E;  4QCK A;  1SQQ E;  3TGU E;  1O7N A;  4NB9 D;  1SQB E;  1UUW A;  5CXM A;  4HM7 A;  1EZV E;  1O7H A;  2E74 D;  2HMN A;  4EMJ B;  3GCE A;  3H1L E;  2ZYL A;  4AIV A;  3CWB E;  4HM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...