1PP9E

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 54
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1pp9E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1pp9E02
1VM9A 3CWBE 4HJLA 5KLIC 2NUKA 2FYNC 1RIEA 1O7MA 1ULIA 2YFIA 2GBWA 3L75E 3VMGD 2E76D 4NBCD 3BCCE 1Q90C 3VCPA 2HMKA 3EN1A 5AEWA 4HM3A 2E74D 1P84E 1UUWA 2XRXA 2CKFA 4NBDD 4NBFD 2ZT9D 3GZXA 4QDFB 1VF5D 2BMQA 4D6TE 4AIVA 4NB8D 4QDDA 1NDOA 1SQXE 2BMRA 1EZVE 3CX5E 4QDFA 4NBGD 5KKZC 2NVFA 1FQTA 1BGYE 2A06E 3C0DA 5KLVE 1EG9A 2BMOA 2IBZE 1RFSA 1ZRTE 1G8JB 4H44D 4HM1A 2JZAA 1O7PA 4HKVA 2JO6A 1BCCE 2NUMA 3FOUA 2NWFA 4OGQD 3VMID 2HMJA 3H1JE 3GTSA 3H1IE 5BOKA 3CXHE 5CXMA 2GBXA 3GZYA 3DQYA 1SQQE 2QJYC 2YFLA 4NBBD 1L0NE 2BCCE 4P1CH 3N0QA 4QUQA 2FYUE 3D89A 4HM8A 1O7HA 1O7NA 2YIUC 2E4PA 3VMHD 3GOBA 1UUVA 2B24A 1SJGA 4NBHD 4HM4A 4QCKA 2QJKC 1SQVE 3L72E 2ZYLA 4PV1D 2XSHA 3EQQA 4U3FE 3L71E 1L0LE 4NBED 1G8KB 2QJPC 3VCAA 1NU1E 2DE5D 4AAYB 3L74E 1NTZE 3L70E 4P1BH 1PP9E 2NVEA 4HM0A 4HM2A 4EMJB 3H1LE 2HMMA 1VCKA 3GTEA 2HMNA 4QUPA 1NTKE 1ULJA 2DE6D 5HL4A 3L73E 2D2CD 1JM1A 1SQPE 1PPJE 3GL2A 1O7GA 5AEUA 4HM6A 1NYKA 4HM7A 4NBAD 2NVGA 2I7FA 2YVJB 4PD4E 1NTME 2QPZA 1KYOE 2Q3WA 2B1XA 2HMOA 3H1KE 4NB9D 4QDCA 1KB9E 3TGUE 1WQLA 3AZCA 4HM5A 1O7WA 4QURA 3GB4A 4H13D 2YFJA 1BE3E 3GKEA 3GL0A 2DE7D 2E4QA 3GCEA 2HMLA 2E75D 3H1HE 2XSOA 2XR8A 4H0LD 1SQBE
chains in the Genus database with same CATH superfamily
3CC4P 1L4AA 5E79E 1HUCA 2H43A 3IFMA 3SWFA 4JPZB 2HODB 2JP3A 1VPCA 4PD4I 3HD7B 3Q5SA 2YO3A 4NBDD 2CKFA 2Y0DA 2N1TB 5APTA 4QDDA 2B87B 1NTMD 3L74J 2IFNA 5AW4B 1RF0C 4EI2A 1FJPA 1O7PA 2V4HA 3AE3C 1IK7A 2JJLA 3H6PA 1BE3J 3Q1MA 1SQBD 2H88C 5CXMA 3KXDA 2YFLA 1SS1A 3G4SP 4L73A 1L0NE 4P1CH 3AEGC 4JF7A 1BDDA 1HF9A 1X8YA 3TGUJ 1AQ5A 3H1IJ 1UUVA 3PJSK 3GHGA 4HB1A 4RO0A 3S4RA 4HM4A 1Q90D 3L73G 4U3FD 3FWNA 4BRYA 1IZNB 1N86A 2ZYDA 1HJBA 3L73J 1LTIC 2JEEA 4LLHA 2ZT9B 3L74E 1NTZE 2XNXA 2IZ0A 3H1LE 1KQSO 2D2CD 4A7PA 3E7KA 4HYTB 1K9MQ 2FXPA 3M0AA 5KAIE 4BRYB 4GOFA 2QEXP 3RK2D 1USEA 5CHXA 1SQXG 3CMAP 2K37A 3CCSP 1SFCA 3L4FA 1O7WA 4QURA 1EDLA 3I5CA 1SQBK 4PV1C 1FBMA 1HTLC 3H1HD 2R3CA 2E75B 1Q2NA 5AW5B 1A02J 1G1JA 2XNDH 3GF3A 1SLQA 2SPZA 3O6QB 5AW1B 3H1KD 3F89A 4JYBA 1Q90C 1OXZA 2WPVB 3L73D 5KAIH 2KNCA 1PFIA 1PZQA 2KK7A 1NDOA 3LW5H 3K5BA 2A45G 4LGDE 5KLVD 5AVYB 2FFDA 3I55P 1N73A 2ZVOB 5AW6B 4C7NA 4GDOA 3HE5B 2QM8A 1JO5A 1VDFA 3VP8A 4I7ZC 1T6AA 5AVWB 2E4PA 1L0NG 3GG2A 1NAYA 2KS1A 3HRNA 1MFZA 5APVA 1BCCG 3IF4A 1PP9E 3GHGB 4DJGA 1TU3F 4H44C 4N78D 2I1KA 3VMXA 1PV3A 1N7SC 2MKVA 3TGUD 1NAFA 1S2EA 5E79H 2YXRB 2FYUJ 1QVGO 2E75D 3H1HE 1RE4C 1E79H 2ZAEB 1VQ4P 1L4AB 4H0LD 1KFNA 3V4QA 3A3YB 3D6ZA 2N1TC 1LTJC 1USDA 3A7OA 3L75E 1RQVA 3VMGD 3CXHI 2NPSA 4BXLA 4NBFD 2ZT9D 2Q6QA 1YJ9P 3RGUA 4JBZA 1PGQA 2NVFA 1QLED 1SQXK 1SVFA 5GTIH 1JMBA 1LT9A 1IO4A 2E42A 3VMID 4IFMA 2LKMA 5KAFE 3RL0g 1H88A 1DH3A 1OW6A 1L0ND 5KJ7C 1M1JC 3PRJA 3I56P 1G2CB 3AE5C 3VMAA 2BCCG 5L8RJ 3L75J 2B24A 1YHQP 1M1JB 1RHZB 2KZJA 3PTZA 3ZDMA 3B5NA 1BCCJ 1S9KE 4MN4C 1T3UA 3E1RA 3RK3D 1ZP0C 3H1JG 1RF1B 1RE3A 4XFJA 1S5LH 3B71A 1URQB 2IPPA 3GL2A 4W80A 4GT1A 1JEKA 1SQXD 1NYKA 2W27A 4NB9D 1DX7A 4HM5A 4Y99C 3HUSB 1S4XA 4H0LB 1PPJD 3AECC 1S3JA 1H8AA 1ZRTD 1YBKA 1NTKJ 1O7MA 1KB9H 1BDCA 1K73Q 3GZXA 3Q5RA 3V5BA 5AVRB 5KJ7D 4QDFA 2FFDB 1YQ4C 1FZGA 5CCHC 2A06E 3B8EB 2L91A 1SQXJ 4I1LA 2HMJA 2RMZA 5APUA 1L0LK 2LXBA 2YO2A 1FDMA 2Q1KA 3H1KJ 5AW8B 4NPDA 4NBBD 2OYOA 4H13B 4EDFA 4I6MC 3L36A 1FZBA 3GOBA 4KJMA 3A0BE 4H13C 5H2FE 2E76B 1RQUA 2R32A 1U7JA 2E74B 2C9LY 1XTGB 4QUPA 3F5HA 1FZEA 1ULJA 3SFEC 3V2RA 1JM1A 2HR3A 1KFMA 2A06G 2O1JA 4GODA 4GKGA 2IX7C 3TGUE 1KQFB 3BASA 4K35A 3WU2H 2WSCJ 2YFJA 2KXPB 1J1EB 2WSEH 5APYA 3VTPC 3TYYA 1ZXGA 4JQ0D 2FKWB 1OX3A 1JCDA 3VOPA 3CWBE 4HJLA 2OARA 3H1LJ 1IFIA 1LTBC 3BCCE 5DJUB 2V7QJ 2WPQA 4AUWA 5KKZC 2NPSB 2IFMA 3MHVA 4IL6X 1ZW0A 1KQGB 1EDJA 1EG9A 3D71A 2E5TA 3L74D 3H32A 2K9YA 1LTTC 1IFMA 2K88A 5KLIB 1RE4A 3H1JE 3H1IE 2AXCA 1IFJA 3R4YA 4PJ0H 3N0QA 5AVSB 1L0NK 3H1KG 2YIUC 3BRTB 2GM4A 3VMHD 3TDKA 1M8OB 4ZKUA 3A2AA 1GL2A 1W2BO 5TISE 3RK3E 1NU1E 1HBWA 4YPCA 1X9VA 4P1BH 1SFCD 1OIPA 1FJKA 3G71P 1O7GA 1KMIZ 1NU1G 3OJAB 3TNUA 4HM7A 4PD4D 3AE7C 3OA7A 1AA0A 3V2NA 2O01J 3HD7C 3NFQA 1AQTA 2R5DA 2D2CC 3UIAA 3B5NC 3A0HH 3CWBJ 3LIEA 4UB6H 1LTJB 1H89A 1EQ7A 2FYNB 4CPGA 1K05A 1Q7YQ 2P2UA 1UUWA 3D6YA 1EDIA 3RL0B 4AIVA 4M3LA 3WMM0 4NBGD 1GMJA 4WB4A 1YTZI 1LT9C 2H8PD 2ITAA 3O6QA 3AEEC 1YTZT 2JKVA 3FGAD 2WZ7A 2ZXEB 2R3SA 4ASVA 2UWJE 2P58A 3M9BA 1SFCC 2BASA 1NHLA 2M5AA 4WY4A 4IL6E 3AEFC 3PH0A 4U3FJ 2FXOA 1KZUB 1LNQA 4I7ZB 2AEJA 1VQKP 3KHUA 1GU4A 2WVRA 3HD7D 1OVUA 3MUDC 1NVOA 4IOIH 1MUUA 3TF5A 1VQNP 3SFDC 3HE5A 1NKZB 4HM6A 2HPCB 1SQQD 3AEAC 1NU1K 4PD4E 1NTME 3P8CE 1KYOE 3N4XA 1JY2P 2Y9ZA 3FXEA 5CBNA 3BATA 2QIWA 2DE7D 5B66E 1SQBG 1X22A 2WSCH 1SQBE 2Z5HA 3CWBD 4PV1B 5KLIC 3L70D 1KTMA 3GHGC 4KT0J 2RH0A 3BCCD 4NBCD 4UB8E 4Y99B 2I1JA 3LW5J 1SQPD 2Y0CA 3B4SA 1OVRA 1NTMJ 4H0LC 4WVZA 2N1TA 3HD7A 3H25A 3ABVC 1VQ6P 3AE8C 1FZFA 2JZAA 3SSUA 2HLOA 2JO6A 1K04A 2ZT9C 1QGKB 2WTYA 5KLVJ 2OTKE 3V2QA 5BOKA 3CXHE 5BU5A 1T3JA 1FOSF 3BCCJ 1HWTC 3TK1A 5GTHE 1PIXA 1L4AD 1EZVI 1QX8A 1JCCA 2YIUB 1EXIA 2ZYAA 1LT9B 3FWLA 4OH8B 1SJGA 4QCKA 3EFFK 5CCGA 1VQ9P 3VN0A 4R4MA 2B9BA 4PV1D 2N9BA 1G8KB 2KIKA 3CI9A 2HMMA 2HMNA 2WT7B 1KILB 1T2KD 3CC2P 4OVNF 2WPRA 2Q3EA 1OMIA 1P84H 1LTGC 2YVJB 2QPZA 1Y9BA 2HFED 4ZNCA 2KS1B 5CJ4A 1DEBA 5M1BA 3Q2YA 2M3BA 1LTJA 2ZYGA 3E1IA 2PAJA 1IC2A 1SQQG 1L4AC 3M0DA 5CCHA 1LP1B 1QL2A 2WSFJ 1HGZA 2YNYA 3OW2O 5KTBA 1FU1A 1R8EA 2WITA 1H0TB 1JNMA 1VF5D 1JUNA 1KYOI 2A45I 3PLNA 4YXWH 3CCJP 2W90A 1NTMG 1IFNA 1FQTA 3CX5H 5AW0B 1RFSA 1G8JB 3T97B 1D7MA 1JOCA 2NUMA 3JCUE 5AW7B 1NTZK 4ZMDA 3GTSA 2WSEJ 1KORA 2GUVA 3W67A 2JO1A 3CXHD 4ASWA 2WWWA 5AVTB 2QE7H 4QUQA 1FOSE 1O7HA 1DD4A 1YIJP 4L74A 3KZIH 1PGOA 2KSEA 3V6IA 3GF7A 1VL2A 2J5UA 2OTJP 3SWYA 5AW9B 3RK2C 3JSVC 1SP4A 4Z1MH 3G6EP 3CD6P 1GK6A 2OYHB 4HM2A 1MV8A 4DT0A 1S1CX 3L73E 2KSJA 2WMMA 4YTPC 2L5GB 1MFTA 3L75D 4OGQB 1CI6B 3N7NA 2B88A 1OZHA 4H13D 2KZIA 2FYUG 2YMYA 2C9NY 3H1ID 2XR8A 1VQ8P 1URQA 3KYQA 1VM9A 5AVQB 2FYNC 2O1KA 1AJYA 1JY3O 3EQ2A 1Q86Q 1FZCB 1SQPK 1S72P 4TT3H 2QJKB 2D2CB 2Q7CA 1S9KD 3C0DA 3H1JJ 4TLFA 1CI6A 5AVZB 2FY8A 2W6JH 1PP9D 3L70J 3NXSA 2QVAA 5CCGD 3MP7B 1KD1Q 1NGMB 2JWDA 5B5EH 2OYIC 2AXTE 4U3FG 2Q3IA 3W68A 1FE6A 2K1AA 3EQQA 1M56D 1WRGA 1KILE 1M1JA 1OW8A 2ZJSE 3AE1C 1JY3N 2NPSD 1ZR4A 1X0TA 1SQPE 2XDJA 2P67A 3QWOC 5DJTB 3HTKA 1L0LG 1KILA 2Z4EA 4GIFA 2KB7P 4WY4C 2QRXA 1JY2N 2G8YA 2IZ1A 1Q82Q 2O3JA 3BVHA 2M0BA 1SQVK 4QMAA 1GZLA 2FYZA 2E4QA 5APWA 1Y8AA 3L71D 2A06D 1URQC 2R5BA 2K9JB 3LIDA 1VQOP 2XKMA 1KQLA 4O9BA 3C8VA 1WMKA 2KP8A 5APSA 3RBXA 3HE4B 1SQPG 4W7ZA 4R4LA 1W5CE 3FX0A 1QVFO 3M0DC 1NKNA 4H44B 2K3RA 1A02F 2NRGA 1JTHB 2XV5A 3U59A 3RK3C 1FAVA 3DQYA 3B5NB 2BCCE 1KYOD 2CPBA 1M1KQ 1N73B 1LWUC 3U1AA 2AXTH 1R5LA 5B5EE 5KKZB 3A5TA 2ZYLA 3MTUE 3GW6A 1U57A 3AE6C 1NOHA 1J2JB 3VMZA 2NVEA 4HM0A 1QL1A 2OYHA 1LTAC 3EWKA 2RN0A 3MD0A 2POHA 1H0TA 2DW3A 3CL3D 3H1KE 1BE3E 3VYIA 1LJ2A 1WT6A 1PGJA 3PHLA 1J1DB 3CCLP 1FZAA 5APXA 2YFIA 1FZCC 2E76D 3H1JD 1LWUB 1T8ZA 1VQLP 2IDBA 2BMQA 3KQGA 1NTKK 2XU6A 3L72J 2W6BA 3CCRP 2KI7B 2IBZE 1ZRTE 1XTCC 5C39A 1RF1A 4HKVA 3L71J 1BCCE 4GOEA 1PL5A 1FS0E 1HGVA 2KLVA 3AEDC 3B5ND 5BVZA 2IYOA 1GL2C 3JC22 2J59M 1ZN5A 3CCMP 1N7SA 3VMYA 4NBHD 2QJYB 3C9IA 4AYCA 1ZMEC 2IBZI 3SWKA 1L0LE 1HVVA 3BRVB 1QEXA 4WY4D 3RL0D 4RESB 4D6TJ 1NTKD 2O01H 2Y9YA 4RKUJ 1L0LJ 3L72G 1NTZJ 2FXMA 2I7FA 2NVGA 2E76C 2Q3WA 3AZCA 4Y28J 3GB4A 1BE3D 3H1LD 1AV1A 1SQVD 2JR8A 3L75G 1CW5A 4NPFX 2XSOA 3II6A 1EC5A 3Q5PA 1J1EC 5BU8B 1RH5B 2E74D 1EZVG 1P84E 2HPCA 4OGQC 4D6TE 1L2PA 1JB0J 1GL2D 1NWQA 3CCQP 4XA4A 3RL0C 1BGYE 2E75C 4HH2A 4C7RA 1X79B 4HM1A 1W2EA 3L74G 3IR9A 3U1CA 3FOUA 2H7HA 2M3EA 1PP9G 3L70G 1M57D 3GLMA 1N8RQ 1SQVJ 3V2PA 2BCCD 1DIPA 2FYUE 4HM8A 1P84I 4LC1A 1KILC 1VF5C 1IFPA 3H1HJ 1RF1C 3CXHH 4IFFA 2PRRA 2BCCJ 5AW2B 3L72D 3CCEP 2XSHA 1KB9I 3P8CD 1NTKG 1L0LD 3RK3B 1VF5B 3G9RA 2AEMA 1SQPJ 3KDPB 3L70E 3GTEA 3L71G 1PPJE 2QJPB 3OAKA 1OW7A 4NBAD 1N7SB 4UB8H 3HE4A 1FDOA 1YJWP 4I2LC 4N6JA 1JY2O 3QH9A 1IK9A 4OWFA 4HKZH 1ZR2A 2G3AA 2CPSA 3KZIE 5AVUB 2HMLA 5B66H 2M8RA 1MZ9A 1YI2P 5CJ0A 2NUKA 5AVVB 1K8AQ 2HMKA 1KC8Q 3JCUH 2M5AB 4WY4B 1G1IA 1Y47A 1T2KC 2C0XA 3M9HA 1SQXE 3CX5E 4EIJA 2HG5D 1BGYD 1KILD 1UIIA 3AE4C 4H44D 2BMOA 5EFWB 2JWAA 2VRSA 3Q3DA 1Z56A 1NU1J 1IJDB 1N7SD 1ZLLA 3M9QA 3NTNA 1G2CA 1NTZG 2GBXA 1SQQE 4JYCA 2OTLP 2FYUD 2I8DA 3AEBC 3CPWO 2WSFH 2Q5UA 5TJHA 5CCGC 1SQQJ 1L0NJ 3S9OA 1VQMP 3D70A 3MZWB 3L71E 2KNCB 5KJ7A 4WWIA 1S5LX 2N1TD 3MUDA 2WT7A 1YQ3C 1OFCX 2LR2A 2OYIA 2YKPA 1NTKE 1EXJA 5HL4A 2BEQD 2B89A 2QA4P 2BEZF 1OVVA 5AVXB 1GK4A 1LWUA 2P10A 4B86A 4QDCA 2FBWC 1AFOA 3R2PA 3ITKA 2IBZD 1MKMA 4UB6E 3P7KA 3GCEA 1KV4A 5GTHH 2FYUK 3AE9C 2MJZA 2YKOA 2AEFA 3IN6A 4N3YB 1RIEA 1JMMA 2ZFCA 1U7MA 3EN1A 5AEWA 3CCUP 2XRXA 4QDFB 1VQ5P 4D6TG 2IYPA 3GMAA 1M7LA 1EZVE 1URQD 3CX5D 1CSBA 2ZXXA 2HODA 1NH4A 2K9JA 4RJTA 4AQRD 1RF0A 5TISH 2OYHC 2HYNA 1LTSC 3T97A 1UIXA 2WQYC 2WSSH 4IFDK 3CC7P 3WUUA 3D89A 1ZV8A 2P7JA 1O7NA 3CLQA 2W83C 3HUSC 2XZRA 4KHXA 3L35A 1LGHB 4L75A 2Y0EA 4BWNA 1OWAA 3MIWA 1SQVE 2OGUA 1NYHA 3H1IG 3L72E 1SQQK 1KYOH 2A45H 4PD4H 3H1LG 2NZ2A 3M06A 1AVYA 1GTWA 1PPJG 4EMJB 3CMEP 2KYVA 3PP5A 2O01N 1P84D 2W8ZA 1JTHA 1YYCA 4D6TD 5KLVG 1PP9J 2PFXA 3BCCG 2QSIA 2HMOA 1EDKA 1KB9D 3G3ZA 3MGNA 1GW4A 1BCCD 3CWBG 3P8MC 4IL6H 4DZOA 2C0WA 1AVOA 1GU5A 3NMDA 3EFGA 5CBOA 1NU1D 2N9YB 1JY3P 1NTZD 1RE3C 2IBZG 1ULIA 2R44A 3VCPA 4HM3A 1BGYJ 4L76A 1NO4A 4N78E 4NPEA 2NPSC 3RBZA 4DOJA 1NTMK 1SFCB 1BGYG 3TSIA 1FZCA 1EZVD 4HJGH 2B87A 1BSNA 3S1KA 1GD2E 2JDIH 1N73C 2RKLA 2NWFA 2OQQA 1IFDA 1PGPA 2KLUA 3A0BH 1BE3G 2QJYC 1ZOYC 5AW3B 2KOGA 3A0HE 1M90Q 3VP9A 1CZQA 1HJ0A 4U3FE 3V4WA 4NBED 1VQ7P 2QJPC 3VCAA 1BSHA 2DE5D 2YMKA 1LT1A 2V7QH 1GL2B 2GA1A 2OYIB 5AEUA 3RK2B 2CK3H 1KB9E 5CCHD 1NJIQ 4DCKA 1SQBJ 2Z5IA 2W6AA 4ZKPA 1YITP 3GKEA 4PJ0E 5CMZA 2LXCB 3H32B 1HH0A 2PGDA 1J1DC 2FFDC 2GUSA 4K3AA 2GBWA 3AE2C 3HUSA 1Q81Q 4EYYQ 3M91A 2QM7A 3FXDA 3L37A 1RY3A 4NB8D 3WUTA 1DEEG 2BMRA 5KLVK 1S5LE 5KLVE 1LP1A 2YKQA 4OGQD 2ZVNB 1VQPP 1FC2C 2H89C 3IAOA 3GZYA 3KPEA 4C7NB 2J58A 2E5YA 1E5WA 2PP6A 3CX5I 2E74C 1SQVG 2E43A 1FDIA 1GDTA 1R5SA 3WU2E 5KAFH 1JM0A 3USSA 3TGUG 2QJKC 4XE5B 2QG4A 1N7LA 2WPSA 4C46A 3HTKB 5GTIE 3TNUB 3C1LA 4AAYB 4U7JA 4EOTA 3CCVP 3WUVA 1VCKA 2DE6D 1KN7A 2YXQB 5K5GB 4WBAA 3O8ZA 3P32A 1N2DC 2B1XA 1WQLA 5H2FH 4YXDC 2P1JA 4W7YA 2Q9IA 1YJNP 5APQA 2KUBA 3GL0A 1GW3A 1DD3A 3H1HG
chains in the Genus database with same CATH topology
1VM9A 3CWBE 4HJLA 5KLIC 2NUKA 2FYNC 1RIEA 1O7MA 1ULIA 2YFIA 2GBWA 3L75E 3VMGD 2E76D 4NBCD 3BCCE 1Q90C 3VCPA 2HMKA 3EN1A 5AEWA 4HM3A 2E74D 1P84E 1UUWA 2XRXA 2CKFA 4NBDD 4NBFD 2ZT9D 3GZXA 4QDFB 1VF5D 2BMQA 4D6TE 4AIVA 4NB8D 4QDDA 1NDOA 1SQXE 2BMRA 1EZVE 3CX5E 4QDFA 4NBGD 5KKZC 2NVFA 1FQTA 1BGYE 2A06E 3C0DA 5KLVE 1EG9A 2BMOA 2IBZE 1RFSA 1ZRTE 1G8JB 4H44D 4HM1A 2JZAA 1O7PA 4HKVA 2JO6A 1BCCE 2NUMA 3FOUA 2NWFA 4OGQD 3VMID 2HMJA 3H1JE 3GTSA 3H1IE 5BOKA 3CXHE 5CXMA 2GBXA 3GZYA 3DQYA 1SQQE 2QJYC 2YFLA 4NBBD 1L0NE 2BCCE 4P1CH 3N0QA 4QUQA 2FYUE 3D89A 4HM8A 1O7HA 1O7NA 2YIUC 2E4PA 3VMHD 3GOBA 1UUVA 2B24A 1SJGA 4NBHD 4HM4A 4QCKA 2QJKC 1SQVE 3L72E 2ZYLA 4PV1D 2XSHA 3EQQA 4U3FE 3L71E 1L0LE 4NBED 1G8KB 2QJPC 3VCAA 1NU1E 2DE5D 4AAYB 3L74E 1NTZE 3L70E 4P1BH 1PP9E 2NVEA 4HM0A 4HM2A 4EMJB 3H1LE 2HMMA 1VCKA 3GTEA 2HMNA 4QUPA 1NTKE 1ULJA 2DE6D 5HL4A 3L73E 2D2CD 1JM1A 1SQPE 1PPJE 3GL2A 1O7GA 5AEUA 4HM6A 1NYKA 4HM7A 4NBAD 2NVGA 2I7FA 2YVJB 4PD4E 1NTME 2QPZA 1KYOE 2Q3WA 2B1XA 2HMOA 3H1KE 4NB9D 4QDCA 1KB9E 3TGUE 1WQLA 3AZCA 4HM5A 1O7WA 4QURA 3GB4A 4H13D 2YFJA 1BE3E 3GKEA 3GL0A 2DE7D 2E4QA 3GCEA 2HMLA 2E75D 3H1HE 2XSOA 2XR8A 4H0LD 1SQBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VM9 A;  3CWB E;  4HJL A;  5KLI C;  2NUK A;  2FYN C;  1RIE A;  1O7M A;  1ULI A;  2YFI A;  2GBW A;  3L75 E;  3VMG D;  2E76 D;  4NBC D;  3BCC E;  1Q90 C;  3VCP A;  2HMK A;  3EN1 A;  5AEW A;  4HM3 A;  2E74 D;  1P84 E;  1UUW A;  2XRX A;  2CKF A;  4NBD D;  4NBF D;  2ZT9 D;  3GZX A;  4QDF B;  1VF5 D;  2BMQ A;  4D6T E;  4AIV A;  4NB8 D;  4QDD A;  1NDO A;  1SQX E;  2BMR A;  1EZV E;  3CX5 E;  4QDF A;  4NBG D;  5KKZ C;  2NVF A;  1FQT A;  1BGY E;  2A06 E;  3C0D A;  5KLV E;  1EG9 A;  2BMO A;  2IBZ E;  1RFS A;  1ZRT E;  1G8J B;  4H44 D;  4HM1 A;  2JZA A;  1O7P A;  4HKV A;  2JO6 A;  1BCC E;  2NUM A;  3FOU A;  2NWF A;  4OGQ D;  3VMI D;  2HMJ A;  3H1J E;  3GTS A;  3H1I E;  5BOK A;  3CXH E;  5CXM A;  2GBX A;  3GZY A;  3DQY A;  1SQQ E;  2QJY C;  2YFL A;  4NBB D;  1L0N E;  2BCC E;  4P1C H;  3N0Q A;  4QUQ A;  2FYU E;  3D89 A;  4HM8 A;  1O7H A;  1O7N A;  2YIU C;  2E4P A;  3VMH D;  3GOB A;  1UUV A;  2B24 A;  1SJG A;  4NBH D;  4HM4 A;  4QCK A;  2QJK C;  1SQV E;  3L72 E;  2ZYL A;  4PV1 D;  2XSH A;  3EQQ A;  4U3F E;  3L71 E;  1L0L E;  4NBE D;  1G8K B;  2QJP C;  3VCA A;  1NU1 E;  2DE5 D;  4AAY B;  3L74 E;  1NTZ E;  3L70 E;  4P1B H;  1PP9 E;  2NVE A;  4HM0 A;  4HM2 A;  4EMJ B;  3H1L E;  2HMM A;  1VCK A;  3GTE A;  2HMN A;  4QUP A;  1NTK E;  1ULJ A;  2DE6 D;  5HL4 A;  3L73 E;  2D2C D;  1JM1 A;  1SQP E;  1PPJ E;  3GL2 A;  1O7G A;  5AEU A;  4HM6 A;  1NYK A;  4HM7 A;  4NBA D;  2NVG A;  2I7F A;  2YVJ B;  4PD4 E;  1NTM E;  2QPZ A;  1KYO E;  2Q3W A;  2B1X A;  2HMO A;  3H1K E;  4NB9 D;  4QDC A;  1KB9 E;  3TGU E;  1WQL A;  3AZC A;  4HM5 A;  1O7W A;  4QUR A;  3GB4 A;  4H13 D;  2YFJ A;  1BE3 E;  3GKE A;  3GL0 A;  2DE7 D;  2E4Q A;  3GCE A;  2HML A;  2E75 D;  3H1H E;  2XSO A;  2XR8 A;  4H0L D;  1SQB E; 
#chains in the Genus database with same CATH topology
 3CC4 P;  1L4A A;  5E79 E;  1HUC A;  2H43 A;  3IFM A;  3SWF A;  4JPZ B;  2HOD B;  2JP3 A;  1VPC A;  4PD4 I;  3HD7 B;  3Q5S A;  2YO3 A;  4NBD D;  2CKF A;  2Y0D A;  2N1T B;  5APT A;  4QDD A;  2B87 B;  1NTM D;  3L74 J;  2IFN A;  5AW4 B;  1RF0 C;  4EI2 A;  1FJP A;  1O7P A;  2V4H A;  3AE3 C;  1IK7 A;  2JJL A;  3H6P A;  1BE3 J;  3Q1M A;  1SQB D;  2H88 C;  5CXM A;  3KXD A;  2YFL A;  1SS1 A;  3G4S P;  4L73 A;  1L0N E;  4P1C H;  3AEG C;  4JF7 A;  1BDD A;  1HF9 A;  1X8Y A;  3TGU J;  1AQ5 A;  3H1I J;  1UUV A;  3PJS K;  3GHG A;  4HB1 A;  4RO0 A;  3S4R A;  4HM4 A;  1Q90 D;  3L73 G;  4U3F D;  3FWN A;  4BRY A;  1IZN B;  1N86 A;  2ZYD A;  1HJB A;  3L73 J;  1LTI C;  2JEE A;  4LLH A;  2ZT9 B;  3L74 E;  1NTZ E;  2XNX A;  2IZ0 A;  3H1L E;  1KQS O;  2D2C D;  4A7P A;  3E7K A;  4HYT B;  1K9M Q;  2FXP A;  3M0A A;  5KAI E;  4BRY B;  4GOF A;  2QEX P;  3RK2 D;  1USE A;  5CHX A;  1SQX G;  3CMA P;  2K37 A;  3CCS P;  1SFC A;  3L4F A;  1O7W A;  4QUR A;  1EDL A;  3I5C A;  1SQB K;  4PV1 C;  1FBM A;  1HTL C;  3H1H D;  2R3C A;  2E75 B;  1Q2N A;  5AW5 B;  1A02 J;  1G1J A;  2XND H;  3GF3 A;  1SLQ A;  2SPZ A;  3O6Q B;  5AW1 B;  3H1K D;  3F89 A;  4JYB A;  1Q90 C;  1OXZ A;  2WPV B;  3L73 D;  5KAI H;  2KNC A;  1PFI A;  1PZQ A;  2KK7 A;  1NDO A;  3LW5 H;  3K5B A;  2A45 G;  4LGD E;  5KLV D;  5AVY B;  2FFD A;  3I55 P;  1N73 A;  2ZVO B;  5AW6 B;  4C7N A;  4GDO A;  3HE5 B;  2QM8 A;  1JO5 A;  1VDF A;  3VP8 A;  4I7Z C;  1T6A A;  5AVW B;  2E4P A;  1L0N G;  3GG2 A;  1NAY A;  2KS1 A;  3HRN A;  1MFZ A;  5APV A;  1BCC G;  3IF4 A;  1PP9 E;  3GHG B;  4DJG A;  1TU3 F;  4H44 C;  4N78 D;  2I1K A;  3VMX A;  1PV3 A;  1N7S C;  2MKV A;  3TGU D;  1NAF A;  1S2E A;  5E79 H;  2YXR B;  2FYU J;  1QVG O;  2E75 D;  3H1H E;  1RE4 C;  1E79 H;  2ZAE B;  1VQ4 P;  1L4A B;  4H0L D;  1KFN A;  3V4Q A;  3A3Y B;  3D6Z A;  2N1T C;  1LTJ C;  1USD A;  3A7O A;  3L75 E;  1RQV A;  3VMG D;  3CXH I;  2NPS A;  4BXL A;  4NBF D;  2ZT9 D;  2Q6Q A;  1YJ9 P;  3RGU A;  4JBZ A;  1PGQ A;  2NVF A;  1QLE D;  1SQX K;  1SVF A;  5GTI H;  1JMB A;  1LT9 A;  1IO4 A;  2E42 A;  3VMI D;  4IFM A;  2LKM A;  5KAF E;  3RL0 g;  1H88 A;  1DH3 A;  1OW6 A;  1L0N D;  5KJ7 C;  1M1J C;  3PRJ A;  3I56 P;  1G2C B;  3AE5 C;  3VMA A;  2BCC G;  5L8R J;  3L75 J;  2B24 A;  1YHQ P;  1M1J B;  1RHZ B;  2KZJ A;  3PTZ A;  3ZDM A;  3B5N A;  1BCC J;  1S9K E;  4MN4 C;  1T3U A;  3E1R A;  3RK3 D;  1ZP0 C;  3H1J G;  1RF1 B;  1RE3 A;  4XFJ A;  1S5L H;  3B71 A;  1URQ B;  2IPP A;  3GL2 A;  4W80 A;  4GT1 A;  1JEK A;  1SQX D;  1NYK A;  2W27 A;  4NB9 D;  1DX7 A;  4HM5 A;  4Y99 C;  3HUS B;  1S4X A;  4H0L B;  1PPJ D;  3AEC C;  1S3J A;  1H8A A;  1ZRT D;  1YBK A;  1NTK J;  1O7M A;  1KB9 H;  1BDC A;  1K73 Q;  3GZX A;  3Q5R A;  3V5B A;  5AVR B;  5KJ7 D;  4QDF A;  2FFD B;  1YQ4 C;  1FZG A;  5CCH C;  2A06 E;  3B8E B;  2L91 A;  1SQX J;  4I1L A;  2HMJ A;  2RMZ A;  5APU A;  1L0L K;  2LXB A;  2YO2 A;  1FDM A;  2Q1K A;  3H1K J;  5AW8 B;  4NPD A;  4NBB D;  2OYO A;  4H13 B;  4EDF A;  4I6M C;  3L36 A;  1FZB A;  3GOB A;  4KJM A;  3A0B E;  4H13 C;  5H2F E;  2E76 B;  1RQU A;  2R32 A;  1U7J A;  2E74 B;  2C9L Y;  1XTG B;  4QUP A;  3F5H A;  1FZE A;  1ULJ A;  3SFE C;  3V2R A;  1JM1 A;  2HR3 A;  1KFM A;  2A06 G;  2O1J A;  4GOD A;  4GKG A;  2IX7 C;  3TGU E;  1KQF B;  3BAS A;  4K35 A;  3WU2 H;  2WSC J;  2YFJ A;  2KXP B;  1J1E B;  2WSE H;  5APY A;  3VTP C;  3TYY A;  1ZXG A;  4JQ0 D;  2FKW B;  1OX3 A;  1JCD A;  3VOP A;  3CWB E;  4HJL A;  2OAR A;  3H1L J;  1IFI A;  1LTB C;  3BCC E;  5DJU B;  2V7Q J;  2WPQ A;  4AUW A;  5KKZ C;  2NPS B;  2IFM A;  3MHV A;  4IL6 X;  1ZW0 A;  1KQG B;  1EDJ A;  1EG9 A;  3D71 A;  2E5T A;  3L74 D;  3H32 A;  2K9Y A;  1LTT C;  1IFM A;  2K88 A;  5KLI B;  1RE4 A;  3H1J E;  3H1I E;  2AXC A;  1IFJ A;  3R4Y A;  4PJ0 H;  3N0Q A;  5AVS B;  1L0N K;  3H1K G;  2YIU C;  3BRT B;  2GM4 A;  3VMH D;  3TDK A;  1M8O B;  4ZKU A;  3A2A A;  1GL2 A;  1W2B O;  5TIS E;  3RK3 E;  1NU1 E;  1HBW A;  4YPC A;  1X9V A;  4P1B H;  1SFC D;  1OIP A;  1FJK A;  3G71 P;  1O7G A;  1KMI Z;  1NU1 G;  3OJA B;  3TNU A;  4HM7 A;  4PD4 D;  3AE7 C;  3OA7 A;  1AA0 A;  3V2N A;  2O01 J;  3HD7 C;  3NFQ A;  1AQT A;  2R5D A;  2D2C C;  3UIA A;  3B5N C;  3A0H H;  3CWB J;  3LIE A;  4UB6 H;  1LTJ B;  1H89 A;  1EQ7 A;  2FYN B;  4CPG A;  1K05 A;  1Q7Y Q;  2P2U A;  1UUW A;  3D6Y A;  1EDI A;  3RL0 B;  4AIV A;  4M3L A;  3WMM 0;  4NBG D;  1GMJ A;  4WB4 A;  1YTZ I;  1LT9 C;  2H8P D;  2ITA A;  3O6Q A;  3AEE C;  1YTZ T;  2JKV A;  3FGA D;  2WZ7 A;  2ZXE B;  2R3S A;  4ASV A;  2UWJ E;  2P58 A;  3M9B A;  1SFC C;  2BAS A;  1NHL A;  2M5A A;  4WY4 A;  4IL6 E;  3AEF C;  3PH0 A;  4U3F J;  2FXO A;  1KZU B;  1LNQ A;  4I7Z B;  2AEJ A;  1VQK P;  3KHU A;  1GU4 A;  2WVR A;  3HD7 D;  1OVU A;  3MUD C;  1NVO A;  4IOI H;  1MUU A;  3TF5 A;  1VQN P;  3SFD C;  3HE5 A;  1NKZ B;  4HM6 A;  2HPC B;  1SQQ D;  3AEA C;  1NU1 K;  4PD4 E;  1NTM E;  3P8C E;  1KYO E;  3N4X A;  1JY2 P;  2Y9Z A;  3FXE A;  5CBN A;  3BAT A;  2QIW A;  2DE7 D;  5B66 E;  1SQB G;  1X22 A;  2WSC H;  1SQB E;  2Z5H A;  3CWB D;  4PV1 B;  5KLI C;  3L70 D;  1KTM A;  3GHG C;  4KT0 J;  2RH0 A;  3BCC D;  4NBC D;  4UB8 E;  4Y99 B;  2I1J A;  3LW5 J;  1SQP D;  2Y0C A;  3B4S A;  1OVR A;  1NTM J;  4H0L C;  4WVZ A;  2N1T A;  3HD7 A;  3H25 A;  3ABV C;  1VQ6 P;  3AE8 C;  1FZF A;  2JZA A;  3SSU A;  2HLO A;  2JO6 A;  1K04 A;  2ZT9 C;  1QGK B;  2WTY A;  5KLV J;  2OTK E;  3V2Q A;  5BOK A;  3CXH E;  5BU5 A;  1T3J A;  1FOS F;  3BCC J;  1HWT C;  3TK1 A;  5GTH E;  1PIX A;  1L4A D;  1EZV I;  1QX8 A;  1JCC A;  2YIU B;  1EXI A;  2ZYA A;  1LT9 B;  3FWL A;  4OH8 B;  1SJG A;  4QCK A;  3EFF K;  5CCG A;  1VQ9 P;  3VN0 A;  4R4M A;  2B9B A;  4PV1 D;  2N9B A;  1G8K B;  2KIK A;  3CI9 A;  2HMM A;  2HMN A;  2WT7 B;  1KIL B;  1T2K D;  3CC2 P;  4OVN F;  2WPR A;  2Q3E A;  1OMI A;  1P84 H;  1LTG C;  2YVJ B;  2QPZ A;  1Y9B A;  2HFE D;  4ZNC A;  2KS1 B;  5CJ4 A;  1DEB A;  5M1B A;  3Q2Y A;  2M3B A;  1LTJ A;  2ZYG A;  3E1I A;  2PAJ A;  1IC2 A;  1SQQ G;  1L4A C;  3M0D A;  5CCH A;  1LP1 B;  1QL2 A;  2WSF J;  1HGZ A;  2YNY A;  3OW2 O;  5KTB A;  1FU1 A;  1R8E A;  2WIT A;  1H0T B;  1JNM A;  1VF5 D;  1JUN A;  1KYO I;  2A45 I;  3PLN A;  4YXW H;  3CCJ P;  2W90 A;  1NTM G;  1IFN A;  1FQT A;  3CX5 H;  5AW0 B;  1RFS A;  1G8J B;  3T97 B;  1D7M A;  1JOC A;  2NUM A;  3JCU E;  5AW7 B;  1NTZ K;  4ZMD A;  3GTS A;  2WSE J;  1KOR A;  2GUV A;  3W67 A;  2JO1 A;  3CXH D;  4ASW A;  2WWW A;  5AVT B;  2QE7 H;  4QUQ A;  1FOS E;  1O7H A;  1DD4 A;  1YIJ P;  4L74 A;  3KZI H;  1PGO A;  2KSE A;  3V6I A;  3GF7 A;  1VL2 A;  2J5U A;  2OTJ P;  3SWY A;  5AW9 B;  3RK2 C;  3JSV C;  1SP4 A;  4Z1M H;  3G6E P;  3CD6 P;  1GK6 A;  2OYH B;  4HM2 A;  1MV8 A;  4DT0 A;  1S1C X;  3L73 E;  2KSJ A;  2WMM A;  4YTP C;  2L5G B;  1MFT A;  3L75 D;  4OGQ B;  1CI6 B;  3N7N A;  2B88 A;  1OZH A;  4H13 D;  2KZI A;  2FYU G;  2YMY A;  2C9N Y;  3H1I D;  2XR8 A;  1VQ8 P;  1URQ A;  3KYQ A;  1VM9 A;  5AVQ B;  2FYN C;  2O1K A;  1AJY A;  1JY3 O;  3EQ2 A;  1Q86 Q;  1FZC B;  1SQP K;  1S72 P;  4TT3 H;  2QJK B;  2D2C B;  2Q7C A;  1S9K D;  3C0D A;  3H1J J;  4TLF A;  1CI6 A;  5AVZ B;  2FY8 A;  2W6J H;  1PP9 D;  3L70 J;  3NXS A;  2QVA A;  5CCG D;  3MP7 B;  1KD1 Q;  1NGM B;  2JWD A;  5B5E H;  2OYI C;  2AXT E;  4U3F G;  2Q3I A;  3W68 A;  1FE6 A;  2K1A A;  3EQQ A;  1M56 D;  1WRG A;  1KIL E;  1M1J A;  1OW8 A;  2ZJS E;  3AE1 C;  1JY3 N;  2NPS D;  1ZR4 A;  1X0T A;  1SQP E;  2XDJ A;  2P67 A;  3QWO C;  5DJT B;  3HTK A;  1L0L G;  1KIL A;  2Z4E A;  4GIF A;  2KB7 P;  4WY4 C;  2QRX A;  1JY2 N;  2G8Y A;  2IZ1 A;  1Q82 Q;  2O3J A;  3BVH A;  2M0B A;  1SQV K;  4QMA A;  1GZL A;  2FYZ A;  2E4Q A;  5APW A;  1Y8A A;  3L71 D;  2A06 D;  1URQ C;  2R5B A;  2K9J B;  3LID A;  1VQO P;  2XKM A;  1KQL A;  4O9B A;  3C8V A;  1WMK A;  2KP8 A;  5APS A;  3RBX A;  3HE4 B;  1SQP G;  4W7Z A;  4R4L A;  1W5C E;  3FX0 A;  1QVF O;  3M0D C;  1NKN A;  4H44 B;  2K3R A;  1A02 F;  2NRG A;  1JTH B;  2XV5 A;  3U59 A;  3RK3 C;  1FAV A;  3DQY A;  3B5N B;  2BCC E;  1KYO D;  2CPB A;  1M1K Q;  1N73 B;  1LWU C;  3U1A A;  2AXT H;  1R5L A;  5B5E E;  5KKZ B;  3A5T A;  2ZYL A;  3MTU E;  3GW6 A;  1U57 A;  3AE6 C;  1NOH A;  1J2J B;  3VMZ A;  2NVE A;  4HM0 A;  1QL1 A;  2OYH A;  1LTA C;  3EWK A;  2RN0 A;  3MD0 A;  2POH A;  1H0T A;  2DW3 A;  3CL3 D;  3H1K E;  1BE3 E;  3VYI A;  1LJ2 A;  1WT6 A;  1PGJ A;  3PHL A;  1J1D B;  3CCL P;  1FZA A;  5APX A;  2YFI A;  1FZC C;  2E76 D;  3H1J D;  1LWU B;  1T8Z A;  1VQL P;  2IDB A;  2BMQ A;  3KQG A;  1NTK K;  2XU6 A;  3L72 J;  2W6B A;  3CCR P;  2KI7 B;  2IBZ E;  1ZRT E;  1XTC C;  5C39 A;  1RF1 A;  4HKV A;  3L71 J;  1BCC E;  4GOE A;  1PL5 A;  1FS0 E;  1HGV A;  2KLV A;  3AED C;  3B5N D;  5BVZ A;  2IYO A;  1GL2 C;  3JC2 2;  2J59 M;  1ZN5 A;  3CCM P;  1N7S A;  3VMY A;  4NBH D;  2QJY B;  3C9I A;  4AYC A;  1ZME C;  2IBZ I;  3SWK A;  1L0L E;  1HVV A;  3BRV B;  1QEX A;  4WY4 D;  3RL0 D;  4RES B;  4D6T J;  1NTK D;  2O01 H;  2Y9Y A;  4RKU J;  1L0L J;  3L72 G;  1NTZ J;  2FXM A;  2I7F A;  2NVG A;  2E76 C;  2Q3W A;  3AZC A;  4Y28 J;  3GB4 A;  1BE3 D;  3H1L D;  1AV1 A;  1SQV D;  2JR8 A;  3L75 G;  1CW5 A;  4NPF X;  2XSO A;  3II6 A;  1EC5 A;  3Q5P A;  1J1E C;  5BU8 B;  1RH5 B;  2E74 D;  1EZV G;  1P84 E;  2HPC A;  4OGQ C;  4D6T E;  1L2P A;  1JB0 J;  1GL2 D;  1NWQ A;  3CCQ P;  4XA4 A;  3RL0 C;  1BGY E;  2E75 C;  4HH2 A;  4C7R A;  1X79 B;  4HM1 A;  1W2E A;  3L74 G;  3IR9 A;  3U1C A;  3FOU A;  2H7H A;  2M3E A;  1PP9 G;  3L70 G;  1M57 D;  3GLM A;  1N8R Q;  1SQV J;  3V2P A;  2BCC D;  1DIP A;  2FYU E;  4HM8 A;  1P84 I;  4LC1 A;  1KIL C;  1VF5 C;  1IFP A;  3H1H J;  1RF1 C;  3CXH H;  4IFF A;  2PRR A;  2BCC J;  5AW2 B;  3L72 D;  3CCE P;  2XSH A;  1KB9 I;  3P8C D;  1NTK G;  1L0L D;  3RK3 B;  1VF5 B;  3G9R A;  2AEM A;  1SQP J;  3KDP B;  3L70 E;  3GTE A;  3L71 G;  1PPJ E;  2QJP B;  3OAK A;  1OW7 A;  4NBA D;  1N7S B;  4UB8 H;  3HE4 A;  1FDO A;  1YJW P;  4I2L C;  4N6J A;  1JY2 O;  3QH9 A;  1IK9 A;  4OWF A;  4HKZ H;  1ZR2 A;  2G3A A;  2CPS A;  3KZI E;  5AVU B;  2HML A;  5B66 H;  2M8R A;  1MZ9 A;  1YI2 P;  5CJ0 A;  2NUK A;  5AVV B;  1K8A Q;  2HMK A;  1KC8 Q;  3JCU H;  2M5A B;  4WY4 B;  1G1I A;  1Y47 A;  1T2K C;  2C0X A;  3M9H A;  1SQX E;  3CX5 E;  4EIJ A;  2HG5 D;  1BGY D;  1KIL D;  1UII A;  3AE4 C;  4H44 D;  2BMO A;  5EFW B;  2JWA A;  2VRS A;  3Q3D A;  1Z56 A;  1NU1 J;  1IJD B;  1N7S D;  1ZLL A;  3M9Q A;  3NTN A;  1G2C A;  1NTZ G;  2GBX A;  1SQQ E;  4JYC A;  2OTL P;  2FYU D;  2I8D A;  3AEB C;  3CPW O;  2WSF H;  2Q5U A;  5TJH A;  5CCG C;  1SQQ J;  1L0N J;  3S9O A;  1VQM P;  3D70 A;  3MZW B;  3L71 E;  2KNC B;  5KJ7 A;  4WWI A;  1S5L X;  2N1T D;  3MUD A;  2WT7 A;  1YQ3 C;  1OFC X;  2LR2 A;  2OYI A;  2YKP A;  1NTK E;  1EXJ A;  5HL4 A;  2BEQ D;  2B89 A;  2QA4 P;  2BEZ F;  1OVV A;  5AVX B;  1GK4 A;  1LWU A;  2P10 A;  4B86 A;  4QDC A;  2FBW C;  1AFO A;  3R2P A;  3ITK A;  2IBZ D;  1MKM A;  4UB6 E;  3P7K A;  3GCE A;  1KV4 A;  5GTH H;  2FYU K;  3AE9 C;  2MJZ A;  2YKO A;  2AEF A;  3IN6 A;  4N3Y B;  1RIE A;  1JMM A;  2ZFC A;  1U7M A;  3EN1 A;  5AEW A;  3CCU P;  2XRX A;  4QDF B;  1VQ5 P;  4D6T G;  2IYP A;  3GMA A;  1M7L A;  1EZV E;  1URQ D;  3CX5 D;  1CSB A;  2ZXX A;  2HOD A;  1NH4 A;  2K9J A;  4RJT A;  4AQR D;  1RF0 A;  5TIS H;  2OYH C;  2HYN A;  1LTS C;  3T97 A;  1UIX A;  2WQY C;  2WSS H;  4IFD K;  3CC7 P;  3WUU A;  3D89 A;  1ZV8 A;  2P7J A;  1O7N A;  3CLQ A;  2W83 C;  3HUS C;  2XZR A;  4KHX A;  3L35 A;  1LGH B;  4L75 A;  2Y0E A;  4BWN A;  1OWA A;  3MIW A;  1SQV E;  2OGU A;  1NYH A;  3H1I G;  3L72 E;  1SQQ K;  1KYO H;  2A45 H;  4PD4 H;  3H1L G;  2NZ2 A;  3M06 A;  1AVY A;  1GTW A;  1PPJ G;  4EMJ B;  3CME P;  2KYV A;  3PP5 A;  2O01 N;  1P84 D;  2W8Z A;  1JTH A;  1YYC A;  4D6T D;  5KLV G;  1PP9 J;  2PFX A;  3BCC G;  2QSI A;  2HMO A;  1EDK A;  1KB9 D;  3G3Z A;  3MGN A;  1GW4 A;  1BCC D;  3CWB G;  3P8M C;  4IL6 H;  4DZO A;  2C0W A;  1AVO A;  1GU5 A;  3NMD A;  3EFG A;  5CBO A;  1NU1 D;  2N9Y B;  1JY3 P;  1NTZ D;  1RE3 C;  2IBZ G;  1ULI A;  2R44 A;  3VCP A;  4HM3 A;  1BGY J;  4L76 A;  1NO4 A;  4N78 E;  4NPE A;  2NPS C;  3RBZ A;  4DOJ A;  1NTM K;  1SFC B;  1BGY G;  3TSI A;  1FZC A;  1EZV D;  4HJG H;  2B87 A;  1BSN A;  3S1K A;  1GD2 E;  2JDI H;  1N73 C;  2RKL A;  2NWF A;  2OQQ A;  1IFD A;  1PGP A;  2KLU A;  3A0B H;  1BE3 G;  2QJY C;  1ZOY C;  5AW3 B;  2KOG A;  3A0H E;  1M90 Q;  3VP9 A;  1CZQ A;  1HJ0 A;  4U3F E;  3V4W A;  4NBE D;  1VQ7 P;  2QJP C;  3VCA A;  1BSH A;  2DE5 D;  2YMK A;  1LT1 A;  2V7Q H;  1GL2 B;  2GA1 A;  2OYI B;  5AEU A;  3RK2 B;  2CK3 H;  1KB9 E;  5CCH D;  1NJI Q;  4DCK A;  1SQB J;  2Z5I A;  2W6A A;  4ZKP A;  1YIT P;  3GKE A;  4PJ0 E;  5CMZ A;  2LXC B;  3H32 B;  1HH0 A;  2PGD A;  1J1D C;  2FFD C;  2GUS A;  4K3A A;  2GBW A;  3AE2 C;  3HUS A;  1Q81 Q;  4EYY Q;  3M91 A;  2QM7 A;  3FXD A;  3L37 A;  1RY3 A;  4NB8 D;  3WUT A;  1DEE G;  2BMR A;  5KLV K;  1S5L E;  5KLV E;  1LP1 A;  2YKQ A;  4OGQ D;  2ZVN B;  1VQP P;  1FC2 C;  2H89 C;  3IAO A;  3GZY A;  3KPE A;  4C7N B;  2J58 A;  2E5Y A;  1E5W A;  2PP6 A;  3CX5 I;  2E74 C;  1SQV G;  2E43 A;  1FDI A;  1GDT A;  1R5S A;  3WU2 E;  5KAF H;  1JM0 A;  3USS A;  3TGU G;  2QJK C;  4XE5 B;  2QG4 A;  1N7L A;  2WPS A;  4C46 A;  3HTK B;  5GTI E;  3TNU B;  3C1L A;  4AAY B;  4U7J A;  4EOT A;  3CCV P;  3WUV A;  1VCK A;  2DE6 D;  1KN7 A;  2YXQ B;  5K5G B;  4WBA A;  3O8Z A;  3P32 A;  1N2D C;  2B1X A;  1WQL A;  5H2F H;  4YXD C;  2P1J A;  4W7Y A;  2Q9I A;  1YJN P;  5APQ A;  2KUB A;  3GL0 A;  1GW3 A;  1DD3 A;  3H1H G; 
#chains in the Genus database with same CATH homology
 1VM9 A;  3CWB E;  4HJL A;  5KLI C;  2NUK A;  2FYN C;  1RIE A;  1O7M A;  1ULI A;  2YFI A;  2GBW A;  3L75 E;  3VMG D;  2E76 D;  4NBC D;  3BCC E;  1Q90 C;  3VCP A;  2HMK A;  3EN1 A;  5AEW A;  4HM3 A;  2E74 D;  1P84 E;  1UUW A;  2XRX A;  2CKF A;  4NBD D;  4NBF D;  2ZT9 D;  3GZX A;  4QDF B;  1VF5 D;  2BMQ A;  4D6T E;  4AIV A;  4NB8 D;  4QDD A;  1NDO A;  1SQX E;  2BMR A;  1EZV E;  3CX5 E;  4QDF A;  4NBG D;  5KKZ C;  2NVF A;  1FQT A;  1BGY E;  2A06 E;  3C0D A;  5KLV E;  1EG9 A;  2BMO A;  2IBZ E;  1RFS A;  1ZRT E;  1G8J B;  4H44 D;  4HM1 A;  2JZA A;  1O7P A;  4HKV A;  2JO6 A;  1BCC E;  2NUM A;  3FOU A;  2NWF A;  4OGQ D;  3VMI D;  2HMJ A;  3H1J E;  3GTS A;  3H1I E;  5BOK A;  3CXH E;  5CXM A;  2GBX A;  3GZY A;  3DQY A;  1SQQ E;  2QJY C;  2YFL A;  4NBB D;  1L0N E;  2BCC E;  4P1C H;  3N0Q A;  4QUQ A;  2FYU E;  3D89 A;  4HM8 A;  1O7H A;  1O7N A;  2YIU C;  2E4P A;  3VMH D;  3GOB A;  1UUV A;  2B24 A;  1SJG A;  4NBH D;  4HM4 A;  4QCK A;  2QJK C;  1SQV E;  3L72 E;  2ZYL A;  4PV1 D;  2XSH A;  3EQQ A;  4U3F E;  3L71 E;  1L0L E;  4NBE D;  1G8K B;  2QJP C;  3VCA A;  1NU1 E;  2DE5 D;  4AAY B;  3L74 E;  1NTZ E;  3L70 E;  4P1B H;  1PP9 E;  2NVE A;  4HM0 A;  4HM2 A;  4EMJ B;  3H1L E;  2HMM A;  1VCK A;  3GTE A;  2HMN A;  4QUP A;  1NTK E;  1ULJ A;  2DE6 D;  5HL4 A;  3L73 E;  2D2C D;  1JM1 A;  1SQP E;  1PPJ E;  3GL2 A;  1O7G A;  5AEU A;  4HM6 A;  1NYK A;  4HM7 A;  4NBA D;  2NVG A;  2I7F A;  2YVJ B;  4PD4 E;  1NTM E;  2QPZ A;  1KYO E;  2Q3W A;  2B1X A;  2HMO A;  3H1K E;  4NB9 D;  4QDC A;  1KB9 E;  3TGU E;  1WQL A;  3AZC A;  4HM5 A;  1O7W A;  4QUR A;  3GB4 A;  4H13 D;  2YFJ A;  1BE3 E;  3GKE A;  3GL0 A;  2DE7 D;  2E4Q A;  3GCE A;  2HML A;  2E75 D;  3H1H E;  2XSO A;  2XR8 A;  4H0L D;  1SQB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...