1PP9E

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 54
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1pp9E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1pp9E02
3C0DA 1KYOE 4QDFA 4QURA 2DE6D 4U3FE 3CX5E 1SQVE 2JO6A 1VM9A 2YIUC 3L73E 3TGUE 2ZT9D 1PPJE 3BCCE 3L72E 2XR8A 3L71E 3L75E 3H1KE 2E4QA 1NTZE 1SJGA 1NYKA 5HL4A 1P84E 1NDOA 1G8JB 3H1JE 2NUKA 3H1LE 4NBBD 5AEUA 1L0LE 1G8KB 2YFJA 3D89A 3GTEA 3GTSA 4EMJB 1O7GA 2QJYC 4HM8A 2QJPC 1ULJA 3CXHE 4NBDD 4QDDA 4QDCA 1JM1A 3H1IE 3EN1A 2YFIA 1ZRTE 3VCPA 2YVJB 3H1HE 3GZXA 4QUPA 1SQPE 4NB9D 4OGQD 1RIEA 3FOUA 1SQQE 1ULIA 4H44D 2YFLA 4NBGD 2NVEA 2FYUE 1NTKE 4PV1D 2QPZA 4QCKA 5BOKA 3L74E 1WQLA 4HM5A 4HM0A 2NUMA 2GBXA 2ZYLA 1BE3E 2IBZE 3EQQA 2DE5D 1EG9A 2E4PA 1SQBE 4H0LD 5KLIC 2B1XA 2Q3WA 4NBFD 1KB9E 3GL0A 4HM2A 1O7MA 4HM6A 2CKFA 2XSOA 4H13D 4QDFB 4D6TE 2DE7D 2QJKC 4HM7A 1UUWA 2A06E 2NVGA 3DQYA 4NBED 1NU1E 2E75D 2HMKA 1SQXE 2HMOA 3GCEA 3GZYA 2BMRA 2D2CD 2E74D 2I7FA 2XSHA 5KKZC 5CXMA 3VMHD 3VMID 1VF5D 3VMGD 2JZAA 2BMOA 2BMQA 1VCKA 2B24A 4HJLA 1UUVA 2XRXA 5AEWA 4PD4E 4P1CH 3VCAA 1NTME 3AZCA 3GB4A 5KLVE 2NVFA 1EZVE 2HMNA 1PP9E 2GBWA 4HM4A 1O7WA 4QUQA 1FQTA 2HMLA 4P1BH 4NBHD 4NBCD 1O7HA 3L70E 4AAYB 4HKVA 2BCCE 3CWBE 3GL2A 3GOBA 1Q90C 1O7PA 4AIVA 1O7NA 2E76D 1BGYE 2FYNC 1L0NE 2HMMA 2HMJA 1RFSA 1BCCE 4NBAD 4NB8D 4HM1A 3N0QA 4HM3A 2NWFA 3GKEA
chains in the Genus database with same CATH superfamily
4HB1A 2WSSH 1LT9B 3EQ2A 2N9YB 3P7KA 4ASWA 3H1KG 1YITP 1NTZG 1LTAC 1N7LA 1FOSE 3H1KE 1NTZE 1FJKA 1P84E 1URQB 5GTHH 2QG4A 4H13C 2GUSA 2ITAA 1M8OB 5B5EE 4IFDK 2J59M 2OGUA 3RK3D 3M0DC 3FOUA 4H44D 4PV1D 5K5GB 1T8ZA 1YIJP 1PV3A 3O6QB 1QVGO 2KXPB 2DE5D 4TT3H 1DD4A 3S9OA 1SQVD 1GK4A 1PP9D 4GODA 1LGHB 1VQ7P 2HMOA 4BRYB 1WRGA 3O6QA 2P7JA 3MD0A 1NHLA 1KFMA 5E79E 5CCHD 2OQQA 3IF4A 4GKGA 1SQVG 1PP9G 5APXA 3GB4A 1PP9E 1OW8A 1NTKD 4D6TJ 3O8ZA 2A45H 3II6A 2H88C 3UIAA 1JB0J 3D70A 1NAFA 5CBOA 1DD3A 3P32A 1SFCC 4C7NB 1N86A 3GHGC 2Z4EA 1NTKG 3BATA 2K9JB 1HH0A 4YXDC 2POHA 3G71P 3GF7A 1Z56A 1L0LK 1VQ8P 3H1JE 1YQ3C 1X0TA 2IBZD 1AJYA 5CCHA 2RKLA 1USDA 1Q7YQ 5B66H 3V4WA 1KZUB 3HUSB 2BEZF 2E74C 2N1TC 5CHXA 1M56D 3KPEA 3TNUA 2KNCB 3OAKA 3MGNA 4RKUJ 1YHQP 1JO5A 2IBZG 3H1KJ 4DJGA 1NTZJ 2K37A 5BU5A 3AEBC 2ZYLA 2FKWB 2IBZE 4Y28J 1P84H 2XNXA 4N6JA 1DEEG 1S9KE 5TISE 1M1KQ 1KQFB 1J1EB 1KILA 3RK2C 4C46A 4N78D 5KLIB 3D71A 2HMKA 2BEQD 2YMYA 1EXIA 3CCLP 3AEAC 1G2CA 3H1LD 2ZYGA 3VP8A 3VMID 2E76B 1IFIA 3HRNA 1GU5A 4ZMDA 2CK3H 4K35A 3CCEP 1LT1A 3PLNA 2QRXA 1ZMEC 3KHUA 1N73B 1CZQA 3TGUD 1IFJA 1Y9BA 3EFFK 3H1LG 1EXJA 2JP3A 3A3YB 3GG2A 4DOJA 2B9BA 3CC7P 1LWUC 3CMEP 3NFQA 5CCGD 3A0HE 4HM3A 3GKEA 3I5CA 3HTKB 5AW1B 1D7MA 4JYBA 1YYCA 5E79H 5AW6B 3TGUG 1M1JA 3FXEA 4WBAA 4L73A 3CCQP 3TGUE 4OGQB 4NPFX 1SJGA 4JBZA 1RE3A 1OZHA 3MTUE 1QL1A 1A02F 1UIIA 2GM4A 1RE4C 1EZVD 4QDCA 1FZCC 1PGPA 2YO3A 1KB9I 2FYUG 5AW0B 1JCCA 5KJ7C 2FYUE 1KD1Q 1GD2E 3H1JJ 2H89C 3EQQA 2XKMA 5CCGA 3H25A 1EZVG 4H0LB 4H13D 2XSOA 1VQ9P 1PPJD 3BCCD 2WPRA 5GTIE 2OYIA 2I7FA 4WY4B 1EDLA 3RL0C 4L75A 5AVQB 5DJTB 1QLED 3AE1C 1UUVA 1JM0A 5APVA 1BSNA 1PPJG 3BCCG 1JNMA 5TISH 4HM4A 1O7PA 3F5HA 2N9BA 1IK7A 3B71A 3AE5C 3N0QA 2FFDA 3C8VA 1SQVK 4QDFA 1GMJA 1E5WA 4QURA 4KT0J 1YTZI 3V2RA 3PRJA 3SSUA 3OW2O 1NDOA 1S5LH 2JWAA 1OW7A 3CD6P 1NTMD 2FYNB 3PHLA 1SFCD 2D2CC 3NTNA 3A0HH 2QM7A 4PV1C 4QUPA 3TF5A 2QPZA 2VRSA 1BGYD 1YJWP 4UB8E 2ZAEB 2J58A 1NVOA 2QSIA 2GA1A 1M7LA 1NH4A 3U1CA 1KYOI 2Q3WA 3JSVC 1QVFO 1NOHA 2Q3EA 1MKMA 4NPEA 1LNQA 2OTJP 1GU4A 3CX5I 3IAOA 4KJMA 2AEFA 3DQYA 3L70D 1BGYG 2P10A 3GZYA 2E74D 2N1TD 2Y0EA 1L0NK 1LTJA 4GIFA 2FYUJ 4A7PA 3KXDA 2H8PD 2KUBA 3WUTA 1EC5A 3VMGD 3MZWB 1W2BO 4YXWH 4ZKUA 1EDJA 2Y0CA 1VQLP 3B5NB 3VCAA 1ZW0A 1FE6A 3H6PA 2AEJA 4AQRD 3PH0A 3RGUA 3L70G 1SQQD 1N2DC 3L70E 1K9MQ 1VQ6P 3RK2D 1BCCG 3N7NA 3W67A 5GTIH 1H8AA 1BCCE 1ZOYC 1JY3P 3HD7A 1KILC 1ZRTD 1OVUA 3NXSA 3L72G 3VP9A 1H0TA 2YIUC 3CCSP 3L72E 1RF1B 4XE5B 3HE4B 1L0LG 3G6EP 3G4SP 1G8JB 1L0LE 2XDJA 4GOEA 4PD4D 2IX7C 5KAFE 1IFNA 1SQXK 3V5BA 1ZRTE 1AVYA 1RF1A 2HPCA 3HE4A 3L74G 1S72P 2E5TA 1KQSO 1VF5C 3L74E 3M91A 2KB7P 2P58A 3LIEA 4YTPC 2BASA 1CI6A 2JO1A 1N73C 1PGJA 2E4PA 2ZVOB 3GL0A 3P8CD 4LGDE 1M1JC 3TDKA 1MUUA 4NBED 2KI7B 1RE3C 5KJ7D 2QJKB 1G1IA 1HGVA 1GL2B 2MKVA 3A5TA 2BMOA 1LTSC 3CMAP 1LWUA 3USSA 1KFNA 3P8CE 1O7WA 2G3AA 3AE7C 3E1RA 1S2EA 3L71D 2HODA 4I7ZB 1Q90C 1ZV8A 3M06A 2HMJA 4NBAD 4XFJA 3KDPB 3N4XA 3RL0D 1KYOE 1K05A 1IC2A 1RQVA 2XNDH 3CX5E 3L71G 4WWIA 5KJ7A 3L71E 3S1KA 1FZEA 1ZXGA 3RBZA 4H0LC 4CPGA 2H43A 1BCCJ 1AVOA 1U57A 2IBZI 2Q5UA 1KTMA 5H2FE 1SQPK 3HE5B 4RO0A 2YVJB 2E43A 5KLVJ 1IJDB 4HH2A 2WSEJ 2YKOA 3CWBD 3L72J 2WSEH 2HG5D 3PJSK 1RHZB 4AUWA 1L0LJ 2FFDC 1CSBA 1LT9A 4NBFD 3A2AA 2H7HA 5KAFH 1VQNP 3CWBG 2DE7D 1EQ7A 2NVGA 1IO4A 1ZN5A 2D2CD 1H89A 1KMIZ 3LW5J 1URQA 3L74J 2HR3A 2OTLP 3LW5H 3VN0A 1BDCA 1NTMK 2RN0A 2QVAA 4QUQA 4NBCD 3RK3E 4HKVA 2M0BA 1O7NA 2FYNC 2R44A 3F89A 2XU6A 2A06D 1NU1D 1SQVE 4BRYA 1PGOA 3E1IA 1LTJC 1YBKA 3K5BA 2NUKA 3PP5A 4Y99B 1FDMA 3D89A 3GTEA 4XA4A 4JF7A 4OVNF 1IZNB 3H32B 3EN1A 1S4XA 1EZVI 3R2PA 1SQQK 3GZXA 2QJPB 1KYOH 1KILD 4NB9D 2CPSA 3R4YA 1NTKE 3CX5H 2P1JA 3L71J 1L0ND 2AXTE 1VPCA 2NPSB 2ZJSE 3B5NC 4C7NA 1PIXA 3HD7C 2K9JA 5H2FH 4IL6X 4HM7A 3GCEA 1KILE 2W27A 1L0NG 1FZAA 1S5LX 1VQKP 1X22A 1VF5D 3OJAB 3CCRP 5KKZB 3HUSA 2YXQB 1KQGB 3M9HA 2B24A 1NYHA 2NVFA 2HMNA 1RF1C 5CJ4A 2KNCA 2GBWA 4DCKA 4ZNCA 2M5AB 3VMAA 1E79H 2Q6QA 5B5EH 3V4QA 3Q2YA 1SQBD 4ASVA 3B8EB 5APTA 1FOSF 2M5AA 2DE6D 1SQXD 3Q1MA 2KOGA 1PZQA 3B4SA 4N78E 3AEGC 1FZFA 2DW3A 3H1LE 2KSEA 3U1AA 3Q5PA 1HVVA 1Q90D 1Q82Q 4N3YB 1N73A 2IFMA 2E75C 1SQXG 2QJYB 2IPPA 4EIJA 1SQVJ 1GL2C 1PP9J 2BCCD 1OXZA 2Y9YA 1QL2A 1WQLA 1Y47A 4W7ZA 2R5BA 1M90Q 2KS1B 4BWNA 3HTKA 2OYHB 4H0LD 1FDOA 3AE2C 1JEKA 2WQYC 3L75D 3WU2E 1VQMP 2RMZA 1LTGC 1UIXA 1NTKJ 1T6AA 4LC1A 2IDBA 2WSCJ 1EDIA 2LXCB 2R3SA 1FZGA 2AXTH 2WSCH 4HJLA 3TK1A 3H1ID 1M57D 1Q81Q 3Q5SA 1QX8A 2P2UA 1EZVE 2OTKE 3VOPA 3L75G 3CCMP 2HMLA 5AVVB 1HF9A 4Z1MH 4U7JA 1R8EA 1BDDA 1LT9C 3SFDC 2JEEA 4K3AA 2ZYDA 1NO4A 3KZIE 3V2QA 1SQPD 5AW2B 1X9VA 4M3LA 4W80A 1VM9A 2Y0DA 1PPJE 2ZT9B 3BCCE 1URQC 4WY4A 2WT7B 5AVUB 1J1DB 1AQ5A 4EMJB 3CL3D 2L91A 4HM8A 4PD4I 1SQPG 3RL0g 1KORA 3CI9A 4KHXA 1GW4A 3AE9C 1YJNP 2B87B 1SQPE 3JC22 2V4HA 2C9NY 2JR8A 2YFLA 5BOKA 3AE4C 2WPVB 3H1LJ 3JCUE 1NKNA 1EG9A 4C7RA 1VQ4P 2W83C 2FBWC 1YJ9P 1MV8A 3VTPC 3BRTB 1NU1K 2C0WA 2CKFA 4DZOA 3SWFA 2YO2A 3D6ZA 3TGUJ 3AEEC 2WITA 3P8MC 3FX0A 2Q9IA 1NTMG 3B5ND 2K88A 2XRXA 4HYTB 1VQOP 1NTME 1JY2O 3HD7D 1R5SA 1T2KC 5APQA 1JY2N 4JPZB 3CCJP 1T3JA 1LTBC 4P1BH 4Y99C 2SPZA 1H88A 3GL2A 4AIVA 3WU2H 1BGYE 2W6AA 4L74A 5AVXB 2JDIH 1YTZT 1L2PA 3FGAD 1U7MA 1SFCB 2KLUA 4I1LA 3GHGB 1VDFA 1WT6A 2JWDA 2KIKA 1L4AB 1BE3D 3HUSC 3FWLA 3GTSA 1HGZA 3B5NA 3T97B 3VCPA 1SQQG 2W8ZA 1RIEA 3KZIH 1SQQE 4WB4A 2E74B 2N1TB 2NVEA 3BCCJ 1BE3G 2ZYAA 1XTGB 3I55P 1BE3E 1SQBK 1J1EC 2CPBA 2I8DA 1N7SB 5KLIC 3VYIA 1XTCC 1JTHB 1HBWA 4RJTA 1LP1B 1IFPA 3MUDA 3V6IA 3VMYA 1SQPJ 2E75D 4W7YA 2E76C 3RK2B 3M9BA 1GL2D 3CLQA 2JZAA 1VCKA 2WPSA 2ZXXA 3ZDMA 1OX3A 3JCUH 2AXCA 1LTTC 4PD4E 1DH3A 4UB6E 1PFIA 1JMBA 2WMMA 3A0BE 1RFSA 1TU3F 4UB8H 2ZFCA 3C0DA 4OGQC 1NTMJ 4D6TD 2Y9ZA 1QEXA 1OMIA 1W2EA 1GL2A 3D6YA 1BGYJ 4R4LA 2LR2A 1FC2C 1ULJA 1JM1A 1X8YA 2YFIA 2IFNA 1FZCB 1GZLA 2O01N 4EOTA 3L70J 5KTBA 4HM5A 2K1AA 2GBXA 1URQD 2PAJA 1BSHA 2HLOA 2HFED 2Q3IA 1Q2NA 3MHVA 1Y8AA 1JY3N 2Q1KA 4PJ0E 4WY4C 1AA0A 3H1KD 2QA4P 1SQQJ 1QGKB 2Q7CA 2XSHA 5CXMA 1AV1A 1VQPP 1NWQA 1BE3J 1K73Q 3RL0B 2I1KA 2XV5A 3HE5A 3AEFC 2ZT9C 3A7OA 4U3FD 1HTLC 4HJGH 1J1DC 1O7HA 3CWBE 5CBNA 5AW7B 3EWKA 2WTYA 4GT1A 3CXHD 4EDFA 4U3FG 1FBMA 3GMAA 4U3FE 4PD4H 2I1JA 1HUCA 3SWKA 1SS1A 4UB6H 1T2KD 1NYKA 1JOCA 2KSJA 2AEMA 2R5DA 4IOIH 3SFEC 2W6BA 5AEUA 2YKQA 2YFJA 2B89A 3A0BH 1K8AQ 1OIPA 3CXHE 2KYVA 2IZ0A 2R32A 1RY3A 3RK3B 4NBGD 2D2CB 2WZ7A 4H44B 4PV1B 4OWFA 3BRVB 2O3JA 2WSFJ 2NPSD 2O1KA 5L8RJ 1VL2A 3WUUA 2WSFH 4AYCA 1HWTC 4QMAA 2A06G 1NU1G 1O7MA 1UUWA 2A06E 3GF3A 1NU1E 3MIWA 3Q3DA 3H1JD 5AW3B 4JQ0D 2M3EA 4TLFA 3H32A 2PFXA 2R3CA 5KLVK 4RESB 3AZCA 3VMXA 2Z5HA 5AW9B 2P67A 1SVFA 1L4AC 3LIDA 3H1JG 4EYYQ 3TNUB 2NPSA 4PJ0H 3GOBA 2E76D 1L0NE 1S9KD 1YQ4C 1LJ2A 1SLQA 5AW5B 3MUDC 3W68A 2IYOA 1KILB 5KAIE 3KYQA 3L36A 2YIUB 3CWBJ 1N7SC 1G2CB 3G9RA 4EI2A 1HJ0A 1ZR4A 3WUVA 4NBDD 3CC4P 4I2LC 4U3FJ 4OGQD 1FS0E 5AW4B 2NUMA 1N8RQ 1SQBG 1FJPA 5APWA 1RF0A 1VF5B 2ZXEB 2O1JA 1SQBE 1KC8Q 4YPCA 2G8YA 3QH9A 1KV4A 4IL6E 2L5GB 1NKZB 1A02J 1FAVA 2KP8A 3AECC 3CXHH 2QJKC 1M1JB 1S5LE 1SQXE 1GTWA 5AW8B 2V7QJ 2FXMA 2V7QH 1OVVA 2BMQA 2UWJE 5TJHA 1VQ5P 4P1CH 2JJLA 4IFFA 2WPQA 4I7ZC 3S4RA 2FYUD 2BCCG 2JKVA 1X79B 2QE7H 1NU1J 2MJZA 4AAYB 2BCCE 3TSIA 4WY4D 2KS1A 3C9IA 3WMM0 3NMDA 2M8RA 2OYHA 4NB8D 4B86A 3CCVP 4IFMA 2IZ1A 3M0AA 1JY2P 1U7JA 2QM8A 2O01J 2OARA 2E42A 3H1HD 1GK6A 2O01H 1RQUA 2FXPA 1NTZK 2ZT9D 4LLHA 3M9QA 3L75E 1OVRA 5APYA 4GOFA 3QWOC 2OYIB 4L76A 1GW3A 1L0NJ 5AVWB 3ITKA 3H1IG 2LXBA 4QDDA 3H1HG 4O9BA 1HJBA 2FXOA 3H1IE 2KLVA 3IFMA 3H1HE 3EFGA 2YXRB 4GDOA 4QCKA 3TYYA 1YI2P 1OFCX 3VMZA 5APUA 1LTIC 5KAIH 4HM0A 1MZ9A 3CC2P 3I56P 2FY8A 2C0XA 3AE8C 3L37A 2NRGA 3FXDA 2FFDB 5EFWB 3AE6C 4HM6A 4QDFB 3G3ZA 4H13B 2YKPA 2WT7A 3V2PA 2BMRA 1CW5A 1NAYA 5AVYB 1MFTA 1W5CE 1SQBJ 2B87A 5AVZB 3Q5RA 1KN7A 3L73D 2J5UA 4ZKPA 4NBHD 4IL6H 1SQXJ 3M0DA 3E7KA 2QEXP 5AVRB 5APSA 1MFZA 1AQTA 2B88A 5AVTB 2W90A 3RK3C 2A45I 2E5YA 4H44C 3L73G 1NTKK 2JO6A 3L35A 3L73E 3CCUP 1PGQA 2PP6A 1L4AD 2BCCJ 1LTJB 3L4FA 4NBBD 5CMZA 1O7GA 3FWNA 2QJPC 1KB9D 2KZIA 3GLMA 2NPSC 1NJIQ 3CPWO 3L75J 2XZRA 1JCDA 1RH5B 1BCCD 5CCHC 5CJ0A 1FU1A 2YMKA 4OH8B 1N7SD 2YNYA 5BVZA 1SFCA 5KLVD 1KB9E 1JUNA 3H1IJ 3HD7B 1DX7A 3GHGA 2PRRA 3V2NA 1IFMA 3H1HJ 2C9LY 3L72D 1FDIA 1S1CX 1L4AA 1H0TB 1OWAA 5KKZC 1P84I 1L0LD 1K04A 3SWYA 4R4MA 3T97A 3BVHA 5BU8B 1Q86Q 5KLVG 2RH0A 2WVRA 3U59A 1NGMB 5KLVE 5AVSB 1KQLA 2N1TA 4MN4C 1IK9A 1J2JB 1JMMA 1S3JA 3L74D 2HPCB 1GDTA 2ZVNB 4DT0A 1RF0C 5GTHE 2M3BA 1N7SA 2PGDA 1SP4A 1CI6B 1PL5A 1JTHA 4WVZA 2NWFA 1LP1A 2IYPA 3CXHI 2LKMA 1T3UA 1R5LA 3BASA 2HYNA 2W6JH 3AEDC 2XR8A 2E4QA 5C39A 5HL4A 3MP7B 1G8KB 1WMKA 2QJYC 3RBXA 3KQGA 1LWUB 2KZJA 2OYOA 2FYUK 4BXLA 2E75B 1ULIA 3L73J 1AFOA 2OYHC 4HKZH 2HODB 2K3RA 2K9YA 4JYCA 1KYOD 2A45G 2B1XA 4D6TG 4HM2A 3CX5D 3GW6A 3IR9A 4D6TE 2WWWA 3C1LA 3PTZA 1G1JA 3VMHD 5CCGC 1EDKA 1OW6A 1ZP0C 1ZLLA 3IN6A 2Z5IA 4NPDA 2QIWA 5AEWA 3AE3C 1RE4A 1JY3O 1FZCA 1DEBA 3ABVC 2OYIC 1KB9H 2GUVA 1FQTA 2FYZA 1DIPA 1NTZD 1FZBA 3OA7A 1P84D 2KK7A 5DJUB 5B66E 2HMMA 2NZ2A 1ZR2A 4I6MC 4HM1A 5M1BA 1IFDA 1USEA
chains in the Genus database with same CATH topology
3C0DA 1KYOE 4QDFA 4QURA 2DE6D 4U3FE 3CX5E 1SQVE 2JO6A 1VM9A 2YIUC 3L73E 3TGUE 2ZT9D 1PPJE 3BCCE 3L72E 2XR8A 3L71E 3L75E 3H1KE 2E4QA 1NTZE 1SJGA 1NYKA 5HL4A 1P84E 1NDOA 1G8JB 3H1JE 2NUKA 3H1LE 4NBBD 5AEUA 1L0LE 1G8KB 2YFJA 3D89A 3GTEA 3GTSA 4EMJB 1O7GA 2QJYC 4HM8A 2QJPC 1ULJA 3CXHE 4NBDD 4QDDA 4QDCA 1JM1A 3H1IE 3EN1A 2YFIA 1ZRTE 3VCPA 2YVJB 3H1HE 3GZXA 4QUPA 1SQPE 4NB9D 4OGQD 1RIEA 3FOUA 1SQQE 1ULIA 4H44D 2YFLA 4NBGD 2NVEA 2FYUE 1NTKE 4PV1D 2QPZA 4QCKA 5BOKA 3L74E 1WQLA 4HM5A 4HM0A 2NUMA 2GBXA 2ZYLA 1BE3E 2IBZE 3EQQA 2DE5D 1EG9A 2E4PA 1SQBE 4H0LD 5KLIC 2B1XA 2Q3WA 4NBFD 1KB9E 3GL0A 4HM2A 1O7MA 4HM6A 2CKFA 2XSOA 4H13D 4QDFB 4D6TE 2DE7D 2QJKC 4HM7A 1UUWA 2A06E 2NVGA 3DQYA 4NBED 1NU1E 2E75D 2HMKA 1SQXE 2HMOA 3GCEA 3GZYA 2BMRA 2D2CD 2E74D 2I7FA 2XSHA 5KKZC 5CXMA 3VMHD 3VMID 1VF5D 3VMGD 2JZAA 2BMOA 2BMQA 1VCKA 2B24A 4HJLA 1UUVA 2XRXA 5AEWA 4PD4E 4P1CH 3VCAA 1NTME 3AZCA 3GB4A 5KLVE 2NVFA 1EZVE 2HMNA 1PP9E 2GBWA 4HM4A 1O7WA 4QUQA 1FQTA 2HMLA 4P1BH 4NBHD 4NBCD 1O7HA 3L70E 4AAYB 4HKVA 2BCCE 3CWBE 3GL2A 3GOBA 1Q90C 1O7PA 4AIVA 1O7NA 2E76D 1BGYE 2FYNC 1L0NE 2HMMA 2HMJA 1RFSA 1BCCE 4NBAD 4NB8D 4HM1A 3N0QA 4HM3A 2NWFA 3GKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0D A;  1KYO E;  4QDF A;  4QUR A;  2DE6 D;  4U3F E;  3CX5 E;  1SQV E;  2JO6 A;  1VM9 A;  2YIU C;  3L73 E;  3TGU E;  2ZT9 D;  1PPJ E;  3BCC E;  3L72 E;  2XR8 A;  3L71 E;  3L75 E;  3H1K E;  2E4Q A;  1NTZ E;  1SJG A;  1NYK A;  5HL4 A;  1P84 E;  1NDO A;  1G8J B;  3H1J E;  2NUK A;  3H1L E;  4NBB D;  5AEU A;  1L0L E;  1G8K B;  2YFJ A;  3D89 A;  3GTE A;  3GTS A;  4EMJ B;  1O7G A;  2QJY C;  4HM8 A;  2QJP C;  1ULJ A;  3CXH E;  4NBD D;  4QDD A;  4QDC A;  1JM1 A;  3H1I E;  3EN1 A;  2YFI A;  1ZRT E;  3VCP A;  2YVJ B;  3H1H E;  3GZX A;  4QUP A;  1SQP E;  4NB9 D;  4OGQ D;  1RIE A;  3FOU A;  1SQQ E;  1ULI A;  4H44 D;  2YFL A;  4NBG D;  2NVE A;  2FYU E;  1NTK E;  4PV1 D;  2QPZ A;  4QCK A;  5BOK A;  3L74 E;  1WQL A;  4HM5 A;  4HM0 A;  2NUM A;  2GBX A;  2ZYL A;  1BE3 E;  2IBZ E;  3EQQ A;  2DE5 D;  1EG9 A;  2E4P A;  1SQB E;  4H0L D;  5KLI C;  2B1X A;  2Q3W A;  4NBF D;  1KB9 E;  3GL0 A;  4HM2 A;  1O7M A;  4HM6 A;  2CKF A;  2XSO A;  4H13 D;  4QDF B;  4D6T E;  2DE7 D;  2QJK C;  4HM7 A;  1UUW A;  2A06 E;  2NVG A;  3DQY A;  4NBE D;  1NU1 E;  2E75 D;  2HMK A;  1SQX E;  2HMO A;  3GCE A;  3GZY A;  2BMR A;  2D2C D;  2E74 D;  2I7F A;  2XSH A;  5KKZ C;  5CXM A;  3VMH D;  3VMI D;  1VF5 D;  3VMG D;  2JZA A;  2BMO A;  2BMQ A;  1VCK A;  2B24 A;  4HJL A;  1UUV A;  2XRX A;  5AEW A;  4PD4 E;  4P1C H;  3VCA A;  1NTM E;  3AZC A;  3GB4 A;  5KLV E;  2NVF A;  1EZV E;  2HMN A;  1PP9 E;  2GBW A;  4HM4 A;  1O7W A;  4QUQ A;  1FQT A;  2HML A;  4P1B H;  4NBH D;  4NBC D;  1O7H A;  3L70 E;  4AAY B;  4HKV A;  2BCC E;  3CWB E;  3GL2 A;  3GOB A;  1Q90 C;  1O7P A;  4AIV A;  1O7N A;  2E76 D;  1BGY E;  2FYN C;  1L0N E;  2HMM A;  2HMJ A;  1RFS A;  1BCC E;  4NBA D;  4NB8 D;  4HM1 A;  3N0Q A;  4HM3 A;  2NWF A;  3GKE A; 
#chains in the Genus database with same CATH topology
 4HB1 A;  2WSS H;  1LT9 B;  3EQ2 A;  2N9Y B;  3P7K A;  4ASW A;  3H1K G;  1YIT P;  1NTZ G;  1LTA C;  1N7L A;  1FOS E;  3H1K E;  1NTZ E;  1FJK A;  1P84 E;  1URQ B;  5GTH H;  2QG4 A;  4H13 C;  2GUS A;  2ITA A;  1M8O B;  5B5E E;  4IFD K;  2J59 M;  2OGU A;  3RK3 D;  3M0D C;  3FOU A;  4H44 D;  4PV1 D;  5K5G B;  1T8Z A;  1YIJ P;  1PV3 A;  3O6Q B;  1QVG O;  2KXP B;  2DE5 D;  4TT3 H;  1DD4 A;  3S9O A;  1SQV D;  1GK4 A;  1PP9 D;  4GOD A;  1LGH B;  1VQ7 P;  2HMO A;  4BRY B;  1WRG A;  3O6Q A;  2P7J A;  3MD0 A;  1NHL A;  1KFM A;  5E79 E;  5CCH D;  2OQQ A;  3IF4 A;  4GKG A;  1SQV G;  1PP9 G;  5APX A;  3GB4 A;  1PP9 E;  1OW8 A;  1NTK D;  4D6T J;  3O8Z A;  2A45 H;  3II6 A;  2H88 C;  3UIA A;  1JB0 J;  3D70 A;  1NAF A;  5CBO A;  1DD3 A;  3P32 A;  1SFC C;  4C7N B;  1N86 A;  3GHG C;  2Z4E A;  1NTK G;  3BAT A;  2K9J B;  1HH0 A;  4YXD C;  2POH A;  3G71 P;  3GF7 A;  1Z56 A;  1L0L K;  1VQ8 P;  3H1J E;  1YQ3 C;  1X0T A;  2IBZ D;  1AJY A;  5CCH A;  2RKL A;  1USD A;  1Q7Y Q;  5B66 H;  3V4W A;  1KZU B;  3HUS B;  2BEZ F;  2E74 C;  2N1T C;  5CHX A;  1M56 D;  3KPE A;  3TNU A;  2KNC B;  3OAK A;  3MGN A;  4RKU J;  1YHQ P;  1JO5 A;  2IBZ G;  3H1K J;  4DJG A;  1NTZ J;  2K37 A;  5BU5 A;  3AEB C;  2ZYL A;  2FKW B;  2IBZ E;  4Y28 J;  1P84 H;  2XNX A;  4N6J A;  1DEE G;  1S9K E;  5TIS E;  1M1K Q;  1KQF B;  1J1E B;  1KIL A;  3RK2 C;  4C46 A;  4N78 D;  5KLI B;  3D71 A;  2HMK A;  2BEQ D;  2YMY A;  1EXI A;  3CCL P;  3AEA C;  1G2C A;  3H1L D;  2ZYG A;  3VP8 A;  3VMI D;  2E76 B;  1IFI A;  3HRN A;  1GU5 A;  4ZMD A;  2CK3 H;  4K35 A;  3CCE P;  1LT1 A;  3PLN A;  2QRX A;  1ZME C;  3KHU A;  1N73 B;  1CZQ A;  3TGU D;  1IFJ A;  1Y9B A;  3EFF K;  3H1L G;  1EXJ A;  2JP3 A;  3A3Y B;  3GG2 A;  4DOJ A;  2B9B A;  3CC7 P;  1LWU C;  3CME P;  3NFQ A;  5CCG D;  3A0H E;  4HM3 A;  3GKE A;  3I5C A;  3HTK B;  5AW1 B;  1D7M A;  4JYB A;  1YYC A;  5E79 H;  5AW6 B;  3TGU G;  1M1J A;  3FXE A;  4WBA A;  4L73 A;  3CCQ P;  3TGU E;  4OGQ B;  4NPF X;  1SJG A;  4JBZ A;  1RE3 A;  1OZH A;  3MTU E;  1QL1 A;  1A02 F;  1UII A;  2GM4 A;  1RE4 C;  1EZV D;  4QDC A;  1FZC C;  1PGP A;  2YO3 A;  1KB9 I;  2FYU G;  5AW0 B;  1JCC A;  5KJ7 C;  2FYU E;  1KD1 Q;  1GD2 E;  3H1J J;  2H89 C;  3EQQ A;  2XKM A;  5CCG A;  3H25 A;  1EZV G;  4H0L B;  4H13 D;  2XSO A;  1VQ9 P;  1PPJ D;  3BCC D;  2WPR A;  5GTI E;  2OYI A;  2I7F A;  4WY4 B;  1EDL A;  3RL0 C;  4L75 A;  5AVQ B;  5DJT B;  1QLE D;  3AE1 C;  1UUV A;  1JM0 A;  5APV A;  1BSN A;  1PPJ G;  3BCC G;  1JNM A;  5TIS H;  4HM4 A;  1O7P A;  3F5H A;  2N9B A;  1IK7 A;  3B71 A;  3AE5 C;  3N0Q A;  2FFD A;  3C8V A;  1SQV K;  4QDF A;  1GMJ A;  1E5W A;  4QUR A;  4KT0 J;  1YTZ I;  3V2R A;  3PRJ A;  3SSU A;  3OW2 O;  1NDO A;  1S5L H;  2JWA A;  1OW7 A;  3CD6 P;  1NTM D;  2FYN B;  3PHL A;  1SFC D;  2D2C C;  3NTN A;  3A0H H;  2QM7 A;  4PV1 C;  4QUP A;  3TF5 A;  2QPZ A;  2VRS A;  1BGY D;  1YJW P;  4UB8 E;  2ZAE B;  2J58 A;  1NVO A;  2QSI A;  2GA1 A;  1M7L A;  1NH4 A;  3U1C A;  1KYO I;  2Q3W A;  3JSV C;  1QVF O;  1NOH A;  2Q3E A;  1MKM A;  4NPE A;  1LNQ A;  2OTJ P;  1GU4 A;  3CX5 I;  3IAO A;  4KJM A;  2AEF A;  3DQY A;  3L70 D;  1BGY G;  2P10 A;  3GZY A;  2E74 D;  2N1T D;  2Y0E A;  1L0N K;  1LTJ A;  4GIF A;  2FYU J;  4A7P A;  3KXD A;  2H8P D;  2KUB A;  3WUT A;  1EC5 A;  3VMG D;  3MZW B;  1W2B O;  4YXW H;  4ZKU A;  1EDJ A;  2Y0C A;  1VQL P;  3B5N B;  3VCA A;  1ZW0 A;  1FE6 A;  3H6P A;  2AEJ A;  4AQR D;  3PH0 A;  3RGU A;  3L70 G;  1SQQ D;  1N2D C;  3L70 E;  1K9M Q;  1VQ6 P;  3RK2 D;  1BCC G;  3N7N A;  3W67 A;  5GTI H;  1H8A A;  1BCC E;  1ZOY C;  1JY3 P;  3HD7 A;  1KIL C;  1ZRT D;  1OVU A;  3NXS A;  3L72 G;  3VP9 A;  1H0T A;  2YIU C;  3CCS P;  3L72 E;  1RF1 B;  4XE5 B;  3HE4 B;  1L0L G;  3G6E P;  3G4S P;  1G8J B;  1L0L E;  2XDJ A;  4GOE A;  4PD4 D;  2IX7 C;  5KAF E;  1IFN A;  1SQX K;  3V5B A;  1ZRT E;  1AVY A;  1RF1 A;  2HPC A;  3HE4 A;  3L74 G;  1S72 P;  2E5T A;  1KQS O;  1VF5 C;  3L74 E;  3M91 A;  2KB7 P;  2P58 A;  3LIE A;  4YTP C;  2BAS A;  1CI6 A;  2JO1 A;  1N73 C;  1PGJ A;  2E4P A;  2ZVO B;  3GL0 A;  3P8C D;  4LGD E;  1M1J C;  3TDK A;  1MUU A;  4NBE D;  2KI7 B;  1RE3 C;  5KJ7 D;  2QJK B;  1G1I A;  1HGV A;  1GL2 B;  2MKV A;  3A5T A;  2BMO A;  1LTS C;  3CMA P;  1LWU A;  3USS A;  1KFN A;  3P8C E;  1O7W A;  2G3A A;  3AE7 C;  3E1R A;  1S2E A;  3L71 D;  2HOD A;  4I7Z B;  1Q90 C;  1ZV8 A;  3M06 A;  2HMJ A;  4NBA D;  4XFJ A;  3KDP B;  3N4X A;  3RL0 D;  1KYO E;  1K05 A;  1IC2 A;  1RQV A;  2XND H;  3CX5 E;  3L71 G;  4WWI A;  5KJ7 A;  3L71 E;  3S1K A;  1FZE A;  1ZXG A;  3RBZ A;  4H0L C;  4CPG A;  2H43 A;  1BCC J;  1AVO A;  1U57 A;  2IBZ I;  2Q5U A;  1KTM A;  5H2F E;  1SQP K;  3HE5 B;  4RO0 A;  2YVJ B;  2E43 A;  5KLV J;  1IJD B;  4HH2 A;  2WSE J;  2YKO A;  3CWB D;  3L72 J;  2WSE H;  2HG5 D;  3PJS K;  1RHZ B;  4AUW A;  1L0L J;  2FFD C;  1CSB A;  1LT9 A;  4NBF D;  3A2A A;  2H7H A;  5KAF H;  1VQN P;  3CWB G;  2DE7 D;  1EQ7 A;  2NVG A;  1IO4 A;  1ZN5 A;  2D2C D;  1H89 A;  1KMI Z;  3LW5 J;  1URQ A;  3L74 J;  2HR3 A;  2OTL P;  3LW5 H;  3VN0 A;  1BDC A;  1NTM K;  2RN0 A;  2QVA A;  4QUQ A;  4NBC D;  3RK3 E;  4HKV A;  2M0B A;  1O7N A;  2FYN C;  2R44 A;  3F89 A;  2XU6 A;  2A06 D;  1NU1 D;  1SQV E;  4BRY A;  1PGO A;  3E1I A;  1LTJ C;  1YBK A;  3K5B A;  2NUK A;  3PP5 A;  4Y99 B;  1FDM A;  3D89 A;  3GTE A;  4XA4 A;  4JF7 A;  4OVN F;  1IZN B;  3H32 B;  3EN1 A;  1S4X A;  1EZV I;  3R2P A;  1SQQ K;  3GZX A;  2QJP B;  1KYO H;  1KIL D;  4NB9 D;  2CPS A;  3R4Y A;  1NTK E;  3CX5 H;  2P1J A;  3L71 J;  1L0N D;  2AXT E;  1VPC A;  2NPS B;  2ZJS E;  3B5N C;  4C7N A;  1PIX A;  3HD7 C;  2K9J A;  5H2F H;  4IL6 X;  4HM7 A;  3GCE A;  1KIL E;  2W27 A;  1L0N G;  1FZA A;  1S5L X;  1VQK P;  1X22 A;  1VF5 D;  3OJA B;  3CCR P;  5KKZ B;  3HUS A;  2YXQ B;  1KQG B;  3M9H A;  2B24 A;  1NYH A;  2NVF A;  2HMN A;  1RF1 C;  5CJ4 A;  2KNC A;  2GBW A;  4DCK A;  4ZNC A;  2M5A B;  3VMA A;  1E79 H;  2Q6Q A;  5B5E H;  3V4Q A;  3Q2Y A;  1SQB D;  4ASV A;  3B8E B;  5APT A;  1FOS F;  2M5A A;  2DE6 D;  1SQX D;  3Q1M A;  2KOG A;  1PZQ A;  3B4S A;  4N78 E;  3AEG C;  1FZF A;  2DW3 A;  3H1L E;  2KSE A;  3U1A A;  3Q5P A;  1HVV A;  1Q90 D;  1Q82 Q;  4N3Y B;  1N73 A;  2IFM A;  2E75 C;  1SQX G;  2QJY B;  2IPP A;  4EIJ A;  1SQV J;  1GL2 C;  1PP9 J;  2BCC D;  1OXZ A;  2Y9Y A;  1QL2 A;  1WQL A;  1Y47 A;  4W7Z A;  2R5B A;  1M90 Q;  2KS1 B;  4BWN A;  3HTK A;  2OYH B;  4H0L D;  1FDO A;  3AE2 C;  1JEK A;  2WQY C;  3L75 D;  3WU2 E;  1VQM P;  2RMZ A;  1LTG C;  1UIX A;  1NTK J;  1T6A A;  4LC1 A;  2IDB A;  2WSC J;  1EDI A;  2LXC B;  2R3S A;  1FZG A;  2AXT H;  2WSC H;  4HJL A;  3TK1 A;  3H1I D;  1M57 D;  1Q81 Q;  3Q5S A;  1QX8 A;  2P2U A;  1EZV E;  2OTK E;  3VOP A;  3L75 G;  3CCM P;  2HML A;  5AVV B;  1HF9 A;  4Z1M H;  4U7J A;  1R8E A;  1BDD A;  1LT9 C;  3SFD C;  2JEE A;  4K3A A;  2ZYD A;  1NO4 A;  3KZI E;  3V2Q A;  1SQP D;  5AW2 B;  1X9V A;  4M3L A;  4W80 A;  1VM9 A;  2Y0D A;  1PPJ E;  2ZT9 B;  3BCC E;  1URQ C;  4WY4 A;  2WT7 B;  5AVU B;  1J1D B;  1AQ5 A;  4EMJ B;  3CL3 D;  2L91 A;  4HM8 A;  4PD4 I;  1SQP G;  3RL0 g;  1KOR A;  3CI9 A;  4KHX A;  1GW4 A;  3AE9 C;  1YJN P;  2B87 B;  1SQP E;  3JC2 2;  2V4H A;  2C9N Y;  2JR8 A;  2YFL A;  5BOK A;  3AE4 C;  2WPV B;  3H1L J;  3JCU E;  1NKN A;  1EG9 A;  4C7R A;  1VQ4 P;  2W83 C;  2FBW C;  1YJ9 P;  1MV8 A;  3VTP C;  3BRT B;  1NU1 K;  2C0W A;  2CKF A;  4DZO A;  3SWF A;  2YO2 A;  3D6Z A;  3TGU J;  3AEE C;  2WIT A;  3P8M C;  3FX0 A;  2Q9I A;  1NTM G;  3B5N D;  2K88 A;  2XRX A;  4HYT B;  1VQO P;  1NTM E;  1JY2 O;  3HD7 D;  1R5S A;  1T2K C;  5APQ A;  1JY2 N;  4JPZ B;  3CCJ P;  1T3J A;  1LTB C;  4P1B H;  4Y99 C;  2SPZ A;  1H88 A;  3GL2 A;  4AIV A;  3WU2 H;  1BGY E;  2W6A A;  4L74 A;  5AVX B;  2JDI H;  1YTZ T;  1L2P A;  3FGA D;  1U7M A;  1SFC B;  2KLU A;  4I1L A;  3GHG B;  1VDF A;  1WT6 A;  2JWD A;  2KIK A;  1L4A B;  1BE3 D;  3HUS C;  3FWL A;  3GTS A;  1HGZ A;  3B5N A;  3T97 B;  3VCP A;  1SQQ G;  2W8Z A;  1RIE A;  3KZI H;  1SQQ E;  4WB4 A;  2E74 B;  2N1T B;  2NVE A;  3BCC J;  1BE3 G;  2ZYA A;  1XTG B;  3I55 P;  1BE3 E;  1SQB K;  1J1E C;  2CPB A;  2I8D A;  1N7S B;  5KLI C;  3VYI A;  1XTC C;  1JTH B;  1HBW A;  4RJT A;  1LP1 B;  1IFP A;  3MUD A;  3V6I A;  3VMY A;  1SQP J;  2E75 D;  4W7Y A;  2E76 C;  3RK2 B;  3M9B A;  1GL2 D;  3CLQ A;  2JZA A;  1VCK A;  2WPS A;  2ZXX A;  3ZDM A;  1OX3 A;  3JCU H;  2AXC A;  1LTT C;  4PD4 E;  1DH3 A;  4UB6 E;  1PFI A;  1JMB A;  2WMM A;  3A0B E;  1RFS A;  1TU3 F;  4UB8 H;  2ZFC A;  3C0D A;  4OGQ C;  1NTM J;  4D6T D;  2Y9Z A;  1QEX A;  1OMI A;  1W2E A;  1GL2 A;  3D6Y A;  1BGY J;  4R4L A;  2LR2 A;  1FC2 C;  1ULJ A;  1JM1 A;  1X8Y A;  2YFI A;  2IFN A;  1FZC B;  1GZL A;  2O01 N;  4EOT A;  3L70 J;  5KTB A;  4HM5 A;  2K1A A;  2GBX A;  1URQ D;  2PAJ A;  1BSH A;  2HLO A;  2HFE D;  2Q3I A;  1Q2N A;  3MHV A;  1Y8A A;  1JY3 N;  2Q1K A;  4PJ0 E;  4WY4 C;  1AA0 A;  3H1K D;  2QA4 P;  1SQQ J;  1QGK B;  2Q7C A;  2XSH A;  5CXM A;  1AV1 A;  1VQP P;  1NWQ A;  1BE3 J;  1K73 Q;  3RL0 B;  2I1K A;  2XV5 A;  3HE5 A;  3AEF C;  2ZT9 C;  3A7O A;  4U3F D;  1HTL C;  4HJG H;  1J1D C;  1O7H A;  3CWB E;  5CBN A;  5AW7 B;  3EWK A;  2WTY A;  4GT1 A;  3CXH D;  4EDF A;  4U3F G;  1FBM A;  3GMA A;  4U3F E;  4PD4 H;  2I1J A;  1HUC A;  3SWK A;  1SS1 A;  4UB6 H;  1T2K D;  1NYK A;  1JOC A;  2KSJ A;  2AEM A;  2R5D A;  4IOI H;  3SFE C;  2W6B A;  5AEU A;  2YKQ A;  2YFJ A;  2B89 A;  3A0B H;  1K8A Q;  1OIP A;  3CXH E;  2KYV A;  2IZ0 A;  2R32 A;  1RY3 A;  3RK3 B;  4NBG D;  2D2C B;  2WZ7 A;  4H44 B;  4PV1 B;  4OWF A;  3BRV B;  2O3J A;  2WSF J;  2NPS D;  2O1K A;  5L8R J;  1VL2 A;  3WUU A;  2WSF H;  4AYC A;  1HWT C;  4QMA A;  2A06 G;  1NU1 G;  1O7M A;  1UUW A;  2A06 E;  3GF3 A;  1NU1 E;  3MIW A;  3Q3D A;  3H1J D;  5AW3 B;  4JQ0 D;  2M3E A;  4TLF A;  3H32 A;  2PFX A;  2R3C A;  5KLV K;  4RES B;  3AZC A;  3VMX A;  2Z5H A;  5AW9 B;  2P67 A;  1SVF A;  1L4A C;  3LID A;  3H1J G;  4EYY Q;  3TNU B;  2NPS A;  4PJ0 H;  3GOB A;  2E76 D;  1L0N E;  1S9K D;  1YQ4 C;  1LJ2 A;  1SLQ A;  5AW5 B;  3MUD C;  3W68 A;  2IYO A;  1KIL B;  5KAI E;  3KYQ A;  3L36 A;  2YIU B;  3CWB J;  1N7S C;  1G2C B;  3G9R A;  4EI2 A;  1HJ0 A;  1ZR4 A;  3WUV A;  4NBD D;  3CC4 P;  4I2L C;  4U3F J;  4OGQ D;  1FS0 E;  5AW4 B;  2NUM A;  1N8R Q;  1SQB G;  1FJP A;  5APW A;  1RF0 A;  1VF5 B;  2ZXE B;  2O1J A;  1SQB E;  1KC8 Q;  4YPC A;  2G8Y A;  3QH9 A;  1KV4 A;  4IL6 E;  2L5G B;  1NKZ B;  1A02 J;  1FAV A;  2KP8 A;  3AEC C;  3CXH H;  2QJK C;  1M1J B;  1S5L E;  1SQX E;  1GTW A;  5AW8 B;  2V7Q J;  2FXM A;  2V7Q H;  1OVV A;  2BMQ A;  2UWJ E;  5TJH A;  1VQ5 P;  4P1C H;  2JJL A;  4IFF A;  2WPQ A;  4I7Z C;  3S4R A;  2FYU D;  2BCC G;  2JKV A;  1X79 B;  2QE7 H;  1NU1 J;  2MJZ A;  4AAY B;  2BCC E;  3TSI A;  4WY4 D;  2KS1 A;  3C9I A;  3WMM 0;  3NMD A;  2M8R A;  2OYH A;  4NB8 D;  4B86 A;  3CCV P;  4IFM A;  2IZ1 A;  3M0A A;  1JY2 P;  1U7J A;  2QM8 A;  2O01 J;  2OAR A;  2E42 A;  3H1H D;  1GK6 A;  2O01 H;  1RQU A;  2FXP A;  1NTZ K;  2ZT9 D;  4LLH A;  3M9Q A;  3L75 E;  1OVR A;  5APY A;  4GOF A;  3QWO C;  2OYI B;  4L76 A;  1GW3 A;  1L0N J;  5AVW B;  3ITK A;  3H1I G;  2LXB A;  4QDD A;  3H1H G;  4O9B A;  1HJB A;  2FXO A;  3H1I E;  2KLV A;  3IFM A;  3H1H E;  3EFG A;  2YXR B;  4GDO A;  4QCK A;  3TYY A;  1YI2 P;  1OFC X;  3VMZ A;  5APU A;  1LTI C;  5KAI H;  4HM0 A;  1MZ9 A;  3CC2 P;  3I56 P;  2FY8 A;  2C0X A;  3AE8 C;  3L37 A;  2NRG A;  3FXD A;  2FFD B;  5EFW B;  3AE6 C;  4HM6 A;  4QDF B;  3G3Z A;  4H13 B;  2YKP A;  2WT7 A;  3V2P A;  2BMR A;  1CW5 A;  1NAY A;  5AVY B;  1MFT A;  1W5C E;  1SQB J;  2B87 A;  5AVZ B;  3Q5R A;  1KN7 A;  3L73 D;  2J5U A;  4ZKP A;  4NBH D;  4IL6 H;  1SQX J;  3M0D A;  3E7K A;  2QEX P;  5AVR B;  5APS A;  1MFZ A;  1AQT A;  2B88 A;  5AVT B;  2W90 A;  3RK3 C;  2A45 I;  2E5Y A;  4H44 C;  3L73 G;  1NTK K;  2JO6 A;  3L35 A;  3L73 E;  3CCU P;  1PGQ A;  2PP6 A;  1L4A D;  2BCC J;  1LTJ B;  3L4F A;  4NBB D;  5CMZ A;  1O7G A;  3FWN A;  2QJP C;  1KB9 D;  2KZI A;  3GLM A;  2NPS C;  1NJI Q;  3CPW O;  3L75 J;  2XZR A;  1JCD A;  1RH5 B;  1BCC D;  5CCH C;  5CJ0 A;  1FU1 A;  2YMK A;  4OH8 B;  1N7S D;  2YNY A;  5BVZ A;  1SFC A;  5KLV D;  1KB9 E;  1JUN A;  3H1I J;  3HD7 B;  1DX7 A;  3GHG A;  2PRR A;  3V2N A;  1IFM A;  3H1H J;  2C9L Y;  3L72 D;  1FDI A;  1S1C X;  1L4A A;  1H0T B;  1OWA A;  5KKZ C;  1P84 I;  1L0L D;  1K04 A;  3SWY A;  4R4M A;  3T97 A;  3BVH A;  5BU8 B;  1Q86 Q;  5KLV G;  2RH0 A;  2WVR A;  3U59 A;  1NGM B;  5KLV E;  5AVS B;  1KQL A;  2N1T A;  4MN4 C;  1IK9 A;  1J2J B;  1JMM A;  1S3J A;  3L74 D;  2HPC B;  1GDT A;  2ZVN B;  4DT0 A;  1RF0 C;  5GTH E;  2M3B A;  1N7S A;  2PGD A;  1SP4 A;  1CI6 B;  1PL5 A;  1JTH A;  4WVZ A;  2NWF A;  1LP1 A;  2IYP A;  3CXH I;  2LKM A;  1T3U A;  1R5L A;  3BAS A;  2HYN A;  2W6J H;  3AED C;  2XR8 A;  2E4Q A;  5C39 A;  5HL4 A;  3MP7 B;  1G8K B;  1WMK A;  2QJY C;  3RBX A;  3KQG A;  1LWU B;  2KZJ A;  2OYO A;  2FYU K;  4BXL A;  2E75 B;  1ULI A;  3L73 J;  1AFO A;  2OYH C;  4HKZ H;  2HOD B;  2K3R A;  2K9Y A;  4JYC A;  1KYO D;  2A45 G;  2B1X A;  4D6T G;  4HM2 A;  3CX5 D;  3GW6 A;  3IR9 A;  4D6T E;  2WWW A;  3C1L A;  3PTZ A;  1G1J A;  3VMH D;  5CCG C;  1EDK A;  1OW6 A;  1ZP0 C;  1ZLL A;  3IN6 A;  2Z5I A;  4NPD A;  2QIW A;  5AEW A;  3AE3 C;  1RE4 A;  1JY3 O;  1FZC A;  1DEB A;  3ABV C;  2OYI C;  1KB9 H;  2GUV A;  1FQT A;  2FYZ A;  1DIP A;  1NTZ D;  1FZB A;  3OA7 A;  1P84 D;  2KK7 A;  5DJU B;  5B66 E;  2HMM A;  2NZ2 A;  1ZR2 A;  4I6M C;  4HM1 A;  5M1B A;  1IFD A;  1USE A; 
#chains in the Genus database with same CATH homology
 3C0D A;  1KYO E;  4QDF A;  4QUR A;  2DE6 D;  4U3F E;  3CX5 E;  1SQV E;  2JO6 A;  1VM9 A;  2YIU C;  3L73 E;  3TGU E;  2ZT9 D;  1PPJ E;  3BCC E;  3L72 E;  2XR8 A;  3L71 E;  3L75 E;  3H1K E;  2E4Q A;  1NTZ E;  1SJG A;  1NYK A;  5HL4 A;  1P84 E;  1NDO A;  1G8J B;  3H1J E;  2NUK A;  3H1L E;  4NBB D;  5AEU A;  1L0L E;  1G8K B;  2YFJ A;  3D89 A;  3GTE A;  3GTS A;  4EMJ B;  1O7G A;  2QJY C;  4HM8 A;  2QJP C;  1ULJ A;  3CXH E;  4NBD D;  4QDD A;  4QDC A;  1JM1 A;  3H1I E;  3EN1 A;  2YFI A;  1ZRT E;  3VCP A;  2YVJ B;  3H1H E;  3GZX A;  4QUP A;  1SQP E;  4NB9 D;  4OGQ D;  1RIE A;  3FOU A;  1SQQ E;  1ULI A;  4H44 D;  2YFL A;  4NBG D;  2NVE A;  2FYU E;  1NTK E;  4PV1 D;  2QPZ A;  4QCK A;  5BOK A;  3L74 E;  1WQL A;  4HM5 A;  4HM0 A;  2NUM A;  2GBX A;  2ZYL A;  1BE3 E;  2IBZ E;  3EQQ A;  2DE5 D;  1EG9 A;  2E4P A;  1SQB E;  4H0L D;  5KLI C;  2B1X A;  2Q3W A;  4NBF D;  1KB9 E;  3GL0 A;  4HM2 A;  1O7M A;  4HM6 A;  2CKF A;  2XSO A;  4H13 D;  4QDF B;  4D6T E;  2DE7 D;  2QJK C;  4HM7 A;  1UUW A;  2A06 E;  2NVG A;  3DQY A;  4NBE D;  1NU1 E;  2E75 D;  2HMK A;  1SQX E;  2HMO A;  3GCE A;  3GZY A;  2BMR A;  2D2C D;  2E74 D;  2I7F A;  2XSH A;  5KKZ C;  5CXM A;  3VMH D;  3VMI D;  1VF5 D;  3VMG D;  2JZA A;  2BMO A;  2BMQ A;  1VCK A;  2B24 A;  4HJL A;  1UUV A;  2XRX A;  5AEW A;  4PD4 E;  4P1C H;  3VCA A;  1NTM E;  3AZC A;  3GB4 A;  5KLV E;  2NVF A;  1EZV E;  2HMN A;  1PP9 E;  2GBW A;  4HM4 A;  1O7W A;  4QUQ A;  1FQT A;  2HML A;  4P1B H;  4NBH D;  4NBC D;  1O7H A;  3L70 E;  4AAY B;  4HKV A;  2BCC E;  3CWB E;  3GL2 A;  3GOB A;  1Q90 C;  1O7P A;  4AIV A;  1O7N A;  2E76 D;  1BGY E;  2FYN C;  1L0N E;  2HMM A;  2HMJ A;  1RFS A;  1BCC E;  4NBA D;  4NB8 D;  4HM1 A;  3N0Q A;  4HM3 A;  2NWF A;  3GKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...