1PP9E

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
molecule tags Oxidoreductase
total genus 54
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1pp9E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1pp9E02
3H1HE 4QUPA 1NTZE 2FYNC 5AEUA 4HJLA 2YFLA 3EQQA 4H13D 1NTKE 1RIEA 4QCKA 4U3FE 3D89A 1KB9E 2E75D 2DE7D 3GB4A 2GBXA 4EMJB 4NB8D 3N0QA 4QDCA 3GCEA 1NYKA 5KLVE 5CXMA 2ZYLA 1SQBE 4HM7A 2A06E 1UUVA 1SQPE 2GBWA 1ULJA 4PV1D 1PP9E 4NBAD 4OGQD 1PPJE 3L72E 4HM0A 3TGUE 3H1IE 3VCPA 3BCCE 5HL4A 2QPZA 1BE3E 2BMOA 1SQXE 2JO6A 2YVJB 2HMMA 3C0DA 3GZYA 1FQTA 2YFJA 1ULIA 3CXHE 4NBBD 2DE5D 2XR8A 1VCKA 4HKVA 1O7HA 2ZT9D 1EZVE 4P1CH 2YIUC 1L0NE 3FOUA 2E4QA 3DQYA 1BGYE 2HMNA 3GTSA 2NUMA 1EG9A 2JZAA 2HMJA 2HMKA 2NVFA 4NBHD 2E74D 4HM6A 2DE6D 4QDDA 5KKZC 4NBED 1VM9A 3H1JE 3GTEA 1JM1A 2B1XA 1SQVE 1G8KB 3VMID 3GL0A 4AIVA 1KYOE 1SJGA 3L74E 1O7PA 2XSOA 4D6TE 3GZXA 5BOKA 1O7MA 2NWFA 1UUWA 5KLIC 4HM1A 3EN1A 4QDFA 3VMGD 2NUKA 3L70E 4PD4E 1O7GA 3H1LE 1O7NA 2NVEA 1WQLA 4HM4A 1P84E 2BMRA 3GL2A 1VF5D 3L71E 2Q3WA 4AAYB 4HM5A 4HM8A 3CWBE 3H1KE 2NVGA 1G8JB 1L0LE 2HMOA 2E4PA 2BMQA 1BCCE 1RFSA 4NBCD 3L73E 2D2CD 1NTME 1NDOA 2FYUE 3AZCA 4NB9D 4H44D 4NBDD 4P1BH 4H0LD 5AEWA 2BCCE 3GKEA 2XRXA 4NBFD 2QJKC 2QJPC 2HMLA 4QURA 1NU1E 2B24A 1Q90C 1SQQE 1ZRTE 2QJYC 2CKFA 3CX5E 3L75E 2E76D 4HM3A 2YFIA 4QDFB 2I7FA 4QUQA 4NBGD 2XSHA 3GOBA 3VMHD 2IBZE 1O7WA 3VCAA 4HM2A
chains in the Genus database with same CATH superfamily
1R5LA 1JY2O 4QCKA 4ASVA 3TSIA 3CC4P 3EFFK 1KQFB 3VTPC 4EOTA 4LLHA 3WU2E 2QEXP 3HUSA 1IK7A 4HM0A 3D6ZA 1QL1A 1SQBK 1SQXE 1QGKB 2HMMA 5KTBA 1X22A 1FQTA 1ULIA 1K8AQ 4JYBA 2V7QH 2YMKA 1QX8A 1GL2B 1JM0A 1Y9BA 2KYVA 4R4LA 2OTLP 1KN7A 3A2AA 1M1JB 3H32B 3D70A 2Q9IA 4A7PA 2Q3IA 1NTKG 4AIVA 1IFJA 1T2KD 3A7OA 4N3YB 4DZOA 1ZR4A 1T3UA 1IFIA 1LT9C 1O7GA 2JR8A 4WY4D 2YO3A 1N73A 2CPSA 1EDJA 3IAOA 4AAYB 3CWBE 3U59A 3CPWO 2E4PA 2BMQA 1LTIC 2QM7A 1GU4A 4KT0J 4Z1MH 2ZXEB 3TGUG 1QVFO 2QJKC 3VMXA 3OAKA 3JC22 5BU8B 3B5NC 1EZVD 1YYCA 3AE6C 5BU5A 1KORA 1YJ9P 4Y28J 2ZVOB 2O01H 2R5DA 4I2LC 2W27A 1MUUA 3M9HA 2HPCA 1HUCA 2KB7P 3SWKA 1IK9A 5KLVE 4NPDA 2KZIA 3VMZA 2L91A 2KIKA 3L4FA 1GTWA 1BDDA 2HLOA 2AEMA 1VPCA 3L71J 2YO2A 2G8YA 3L73G 3H1KJ 1PGJA 3H1HJ 4GT1A 3SFDC 1P84H 3GZYA 2DE5D 2FYUJ 5CCGD 2BCCJ 4H0LC 1BGYE 1E5WA 2N9YB 3MTUE 5CCGA 3V4WA 4L74A 3D71A 2K1AA 4HM6A 1IZNB 3HUSC 2QE7H 2B1XA 3VMID 2OYIA 1LTAC 3RL0g 1KD1Q 3VYIA 2NWFA 3EN1A 4QDFA 1SQBG 4HKZH 1LP1B 3UIAA 1M57D 2B87B 3PP5A 2DW3A 5AW9B 1RQVA 3AE3C 4L75A 1OIPA 3CL3D 1VQ6P 3HUSB 3WUTA 2OGUA 5AW2B 1DEEG 1IFMA 1D7MA 1GK4A 3N7NA 1LTTC 1SLQA 4GDOA 2RMZA 4LGDE 1N73C 2GUVA 2Q7CA 3VCAA 2Y9ZA 3L37A 2FY8A 2LR2A 3KXDA 1Q2NA 2Q1KA 1UUVA 3VMAA 4OGQD 1L0LD 1L2PA 2YMYA 3U1AA 1CW5A 1NTMD 1ZOYC 4L76A 4WY4B 2RH0A 4PD4H 1KB9D 2XZRA 1S3JA 2YVJB 2AEJA 1J2JB 5KJ7D 4DCKA 3BVHA 1EZVE 3ITKA 4LC1A 2DE6D 1ZP0C 3WUVA 3AEBC 3HRNA 3H1HG 3TK1A 1LTJA 1YQ4C 2KLUA 1PV3A 1SJGA 3GZXA 3H1IJ 2NPSD 1IFNA 3HE5A 1L0LK 1OVUA 2HPCB 1EC5A 1NTMK 4BRYB 2XDJA 2KS1A 2LKMA 4YXDC 1N86A 1L0NJ 5CCGC 1VQMP 1SVFA 2R32A 1EXJA 1M8OB 5AEWA 5M1BA 2OYIC 2E43A 3CC7P 3CXHD 1FDIA 2W83C 2V4HA 3BCCJ 4ASWA 4UB6H 3RK3C 3V5BA 1BSHA 3JCUE 1ZW0A 2O1JA 4D6TJ 3M0DA 1AV1A 4HM2A 5B5EE 1VDFA 1SP4A 3EQQA 3MGNA 3LW5H 1FJPA 1A02F 5AW4B 5CXMA 4UB8H 3L70G 4HM7A 1E79H 1FOSE 1BCCD 3G4SP 4RKUJ 3N4XA 1N7SA 3PLNA 3VMYA 1YJNP 3HD7D 4HKVA 3GW6A 2HODA 1O7HA 3CX5D 1N2DC 2A06D 4Y99C 1SQVK 2OTJP 1SQQJ 4JBZA 2Q3EA 1NTZD 3E1RA 1WRGA 2P58A 2ZYAA 1IJDB 2J58A 2XKMA 5BOKA 1VQ8P 5E79E 4HM1A 2AXTE 1XTGB 1WQLA 3CMAP 1RF1A 1VL2A 3KQGA 1NO4A 1HGZA 1L0LE 1PPJG 1KILA 2D2CD 1AVYA 1NTME 4NBDD 1JY3P 1FZGA 3KZIE 1OWAA 3KPEA 3CCQP 1LTJC 1BE3D 3V2NA 4OGQB 2QJPB 2W90A 2ZXXA 4GOFA 1DIPA 1URQD 1EQ7A 3L74J 1YHQP 4N78E 5EFWB 2WTYA 1MZ9A 4JYCA 5AVSB 2CPBA 1FU1A 2C0XA 4HJLA 2K9JA 1G2CB 1RIEA 5APUA 2IDBA 1KYOD 1JY2P 2E74C 2G3AA 1MFTA 3GCEA 4MN4C 3H32A 1NOHA 3CCLP 3FX0A 3AEGC 3M0DC 2K88A 1RY3A 2PFXA 3CCRP 1QLED 2KS1B 1R8EA 2FYZA 2QPZA 4C46A 1NU1D 2YFJA 3CXHE 4PJ0E 3DQYA 1YJWP 1S5LE 5GTHE 4YXWH 2FXMA 4NBED 2IX7C 3H1JE 1SQXK 5KKZB 3RK2D 3W67A 1SQVE 3AE9C 3K5BA 1T3JA 5B66H 3CCEP 1HGVA 3LIDA 3NTNA 1N7SC 1KQLA 1T8ZA 2BEQD 2FBWC 3A0BH 2YKOA 2GM4A 2IFMA 1PP9D 2WSCJ 3L72D 1FAVA 1BCCE 3H1JG 1NU1K 1NDOA 4W80A 1SQVG 3B71A 2QIWA 2B24A 1LTBC 3MUDC 5AW0B 3L35A 3H1LD 3CX5E 2YFIA 2P10A 3NMDA 1S5LX 3TYYA 2AEFA 1VQNP 2HODB 3QWOC 1CZQA 1RF1C 3V4QA 3HD7B 1FOSF 1NTZE 1S9KD 2IPPA 2FYNB 3CWBJ 1KILC 1VQ4P 3GB4A 1USDA 3JSVC 4KHXA 1Z56A 4RO0A 1NKZB 3MP7B 2IYPA 3VOPA 1KILE 3ZDMA 2E5YA 2VRSA 1WT6A 4KJMA 2HR3A 2A45I 1G1JA 2WITA 3IFMA 5KLVK 3JCUH 1BE3E 1KILB 1S2EA 1GZLA 1LP1A 3L73J 3LIEA 1JUNA 2ZT9D 2B87A 2KSEA 2D2CB 1GL2C 3FOUA 5KAIE 5K5GB 2E4QA 3GTSA 2M5AB 2IBZD 4NBHD 5H2FH 3Q5SA 1M1JC 3GTEA 1URQB 1Q81Q 1KYOE 1PIXA 2YKQA 1VQ9P 5CBOA 1UUWA 2K9JB 5KLIB 2RKLA 5AW1B 1Y8AA 2NVEA 3SWYA 1SQPD 2BMRA 1VF5D 1VQKP 1CSBA 4HM8A 2NVGA 1SQBJ 4W7YA 5AVYB 1KQGB 1FS0E 1VQ7P 1PGOA 3AZCA 3IF4A 2XV5A 5AVRB 2JDIH 1HBWA 4C7NB 1SQXG 1OMIA 1NU1E 1Q90C 3A0HE 3P8CD 3FWLA 4RESB 2QJYB 4HM3A 3RL0D 4ZKUA 2C9NY 1H8AA 1KZUB 4WY4A 3WUUA 1NHLA 1N8RQ 2ZYGA 5APWA 4U3FE 1SQPK 1YTZT 3OW2O 3M0AA 3RK2B 2WSEH 3CCSP 3L71D 1ULJA 1PP9E 3KZIH 3H1KD 3L72E 3CWBG 2OARA 1OW8A 3TNUA 2KNCB 3VCPA 3AEFC 2FYUD 2BCCD 5HL4A 4U3FG 1QL2A 3CCUP 2P7JA 2XR8A 1VCKA 1J1EB 4BRYA 1FJKA 1J1DB 3R4YA 1EG9A 2R44A 2WZ7A 1H89A 1DX7A 2A45G 1RE4A 1M1KQ 1SFCD 3CI9A 3RBXA 3RGUA 3M06A 5KLVG 1EZVI 2YKPA 3H25A 2WPRA 3I5CA 4TT3H 5APQA 2QA4P 3V6IA 2R3CA 4IOIH 2Q6QA 5GTIE 2OTKE 2PP6A 4HYTB 1BGYG 3AEEC 1GW3A 2JWDA 1EDIA 2IBZE 1ZXGA 3GHGA 1YI2P 1KMIZ 1PZQA 2ZT9B 3NFQA 1NYHA 5CCHD 2NZ2A 1PL5A 4GIFA 1ZV8A 3F5HA 4IL6E 1AQ5A 2SPZA 3I56P 1T2KC 1SQPE 3BASA 3L70J 1KV4A 1NH4A 1ZN5A 4WY4C 2B89A 4WVZA 2H88C 5APSA 1M56D 3KYQA 5AVQB 1H88A 1X9VA 3P8CE 3L75D 3AEAC 2RN0A 5TISH 2NVFA 4JQ0D 3P32A 3H1ID 1W2BO 1KFMA 1LGHB 3KDPB 3O6QB 1LT1A 3RL0B 1O7PA 2WT7B 2FXOA 1OXZA 1FZCB 4CPGA 1L0ND 4IL6X 3AE2C 4GODA 1JCDA 5KJ7A 3U1CA 3L71E 4WBAA 4GKGA 3H1KE 1DEBA 1G2CA 4WB4A 5DJUB 5KAFE 3VP8A 2FYUE 3BCCD 2BCCE 3SWFA 3WU2H 1QVGO 2HMLA 4D6TD 4M3LA 1RE4C 2QG4A 3TNUB 2ITAA 5DJTB 2JO1A 1JO5A 5AW3B 1EZVG 2NPSA 2KOGA 3MIWA 2W6BA 4XFJA 1JTHA 3AE7C 3HE4A 1M7LA 2ZJSE 2WSFH 5AW5B 1L0LJ 5CJ4A 2WSCH 2WSEJ 1NTMJ 1HJBA 5AW6B 3G3ZA 2WPVB 2ZYLA 4DT0A 1P84D 3FWNA 3OA7A 1SFCB 4YPCA 1UIXA 5APYA 4R4MA 3PRJA 2J5UA 4HB1A 4I7ZB 2H43A 1SQQD 3BATA 2YIUB 3GF3A 1DD3A 1G8KB 2WPSA 3GHGB 1VQ5P 3VMGD 2QRXA 3OJAB 1L4AD 3CXHI 5CHXA 3GLMA 2A45H 4IFMA 3HD7A 3Q5RA 2FXPA 4ZNCA 5AVTB 1RF0A 4P1BH 3L74D 4OGQC 2QJPC 5AW8B 3H1JJ 1NGMB 2GUSA 2PAJA 1SQVJ 1RQUA 3R2PA 3CCJP 3L75E 1GDTA 1X0TA 2E76D 2O3JA 4QUQA 5KJ7C 3AE8C 3G9RA 2YFLA 4H13D 5AVVB 4NPFX 3QH9A 1G1IA 2P2UA 1BCCJ 1KB9E 2E75D 1ZRTD 2N1TD 3A3YB 2M5AA 4PD4D 1RH5B 2N1TA 3CX5I 2E5TA 1NTZK 1AA0A 1URQA 1JNMA 4NBAD 2NPSC 1Q86Q 1L0LG 3BCCE 1NTMG 2UWJE 2BMOA 2IFNA 3C1LA 5APVA 3AECC 4OVNF 2KSJA 1Q7YQ 2WQYC 2M0BA 3E1IA 2OQQA 2K3RA 5KKZC 2JEEA 2NPSB 2PGDA 1NAFA 4C7NA 1NTKD 1JTHB 3HE4B 2R3SA 1CI6A 1SS1A 2OYHA 1EDLA 3GF7A 1IFPA 1P84E 2AXCA 4TLFA 1NVOA 4HM5A 1YQ3C 2HMOA 3IR9A 4NBCD 3H6PA 1LJ2A 3RBZA 3TGUD 1FDOA 1KYOI 2I1KA 3FGAD 1SQQE 2H8PD 1SQXJ 2K9YA 2WSFJ 1OW7A 1WMKA 1NTKK 2B9BA 2KNCA 3GOBA 3HD7C 2XNXA 2FYNC 1VQOP 2ZYDA 2H7HA 1RF0C 1NWQA 2Z4EA 1LT9A 1JY3N 2GBXA 1FBMA 2M3BA 2J59M 1NYKA 1K9MQ 1HH0A 3S1KA 1JCCA 2A06E 2ZVNB 3FXEA 1NU1J 5KAFH 1S72P 1L4AB 1BCCG 3B5ND 3L73D 2ZAEB 5AW7B 1GU5A 2Y9YA 3PTZA 1JY2N 2D2CC 1HTLC 4U3FJ 2A06G 2HMNA 2NUMA 3MZWB 1URQC 1NTZG 2E76B 1FZBA 3GL0A 1H0TB 1W2EA 2HYNA 2O01N 5KLIC 4C7RA 1T6AA 2NUKA 1SQBD 4PD4E 3CMEP 1VQPP 3D6YA 1YTZI 4H13B 5B5EH 3I55P 2E75B 5KLVJ 2N1TB 1AFOA 2M8RA 4BWNA 3HTKB 2JWAA 1GW4A 4H44D 4H0LD 2FFDB 1BE3G 2QJYC 2OYHC 1KQSO 1A02J 1TU3F 2I1JA 2B88A 4XE5B 2Y0EA 1YITP 1BGYJ 1BSNA 1NTKE 1PFIA 1K73Q 2DE7D 1MKMA 1FZEA 3RK2C 1CI6B 1ZR2A 3Q5PA 2OYHB 2GBWA 4UB6E 3O6QA 2IBZI 1JMBA 4JF7A 5E79H 3TGUE 1KTMA 2WT7A 2AXTH 2KI7B 1OVRA 4YTPC 1FZCA 2QVAA 1K05A 1J1EC 1EXIA 1J1DC 1NU1G 1S4XA 3BRTB 1KFNA 4UB8E 2N9BA 1KB9H 4AQRD 3H1HD 1SQPJ 2I8DA 1IFDA 2JP3A 1OVVA 4OWFA 1LWUA 3NXSA 3V2QA 2Y0CA 2O1KA 3BRVB 2WSSH 3H1LE 2C0WA 1LT9B 3PJSK 1PP9G 3IN6A 3L72G 3L73E 3GG2A 1S9KE 4NB9D 3E7KA 2QJKB 4QURA 1SFCA 3B5NB 1U57A 3H1LG 3CLQA 3C8VA 1U7JA 2FYUK 3VMHD 3EQ2A 1FZFA 1JEKA 3M91A 2ZT9C 5AVXB 3CXHH 1USEA 4PJ0H 3VN0A 1JB0J 1S5LH 2GA1A 5GTHH 4NB8D 4H44C 3L70D 1S1CX 2BASA 1LTSC 1SQBE 3WMM0 3MHVA 3P8MC 1OZHA 2XU6A 3PHLA 3S4RA 3RK3D 5AVZB 1IC2A 1N7LA 1JOCA 1VF5C 4HH2A 3C0DA 2W8ZA 5CCHA 4EDFA 4XA4A 4P1CH 1YBKA 2YXRB 4H44B 4H0LB 1KC8Q 2POHA 2MJZA 3G71P 3KHUA 2IBZG 4NPEA 4EIJA 1MV8A 4BXLA 5APTA 1X8YA 3RL0C 1ZMEC 3CX5H 4IFDK 4RJTA 2NRGA 1VF5B 2Q5UA 1FZCC 1RE3A 2Z5HA 1GK6A 3B4SA 4DOJA 2ZFCA 2CK3H 4HM4A 2P67A 3GL2A 1SQPG 1PPJD 2HFED 1RFSA 1LNQA 5BVZA 1LWUC 4WWIA 1M90Q 4AYCA 3W68A 5B66E 3Q1MA 3CCVP 2QSIA 3M9QA 3O8ZA 3A0BE 1RHZB 1N73B 3H1HE 3S9OA 5AEUA 1AQTA 2V7QJ 1FE6A 3L36A 5KAIH 1AJYA 4I1LA 4QDCA 3N0QA 1LWUB 4N78D 4JPZB 1OFCX 1NAYA 1SFCC 1FC2C 2BEZF 2M3EA 3L71G 3L75J 1KYOH 3H1KG 3EWKA 2KLVA 1EDKA 2KXPB 2FYUG 4I7ZC 2BCCG 1L0NK 4ZMDA 4U7JA 3CC2P 1KB9I 5CJ0A 4NBBD 2YIUC 3G6EP 2JZAA 2E74D 1NKNA 1VM9A 2JKVA 1JM1A 2JJLA 3A0HH 3GHGC 3V2PA 5CBNA 2XSOA 5APXA 2HG5D 3CCMP 3AE1C 3L70E 2QM8A 1NJIQ 5CCHC 2O01J 1MFZA 1OW6A 3H1JD 1DH3A 2YXQB 1SQVD 3RK3E 1PGPA 5H2FE 4NBFD 4OH8B 1XTCC 2YNYA 2OYIB 4EI2A 1RE3C 3RK3B 3T97A 2E42A 2LXCB 3VP9A 1FDMA 4QDFB 4L73A 1P84I 1HJ0A 1L4AA 3AEDC 1N7SD 1SQQK 3A5TA 2C9LY 4ZKPA 4EMJB 2MKVA 4PV1D 1W5CE 2KK7A 1PPJE 1H0TA 3H1IE 1DD4A 1LTGC 3MUDA 1FZAA 2L5GB 3AE5C 4N6JA 1IO4A 2KZJA 1L0NE 3L75G 3FXDA 4Y99B 1AVOA 1KILD 2KUBA 1PGQA 2HMJA 3HTKA 4QDDA 1VQLP 1K04A 2FFDA 4B86A 1HVVA 3H1IG 1ZLLA 3EFGA 5GTIH 1QEXA 1X79B 1OX3A 3SSUA 3B8EB 4D6TE 1NTZJ 3SFEC 5L8RJ 2WPQA 4GOEA 3F89A 1L0NG 4HJGH 3AE4C 3V2RA 2KP8A 2W6AA 2WWWA 2WMMA 1HF9A 1GMJA 4DJGA 3GMAA 1GL2D 5CMZA 3BCCG 4IL6H 2XRXA 3GKEA 2IZ0A 1SQXD 1LTJB 4D6TG 1GL2A 3TDKA 3Q3DA 2CKFA 1BE3J 4PD4I 4W7ZA 1M1JA 2I7FA 3HE5B 1UIIA 2W6JH 4QUPA 2PRRA 4I6MC 1Q82Q 3M9BA 4QMAA 1U7MA 4K35A 3PH0A 3D89A 2E74B 3P7KA 1JMMA 2IYOA 2OYOA 2WVRA 3CWBD 4K3AA 1L4AC 2IZ1A 1Q90D 3MD0A 1Y47A 2XNDH 3II6A 4U3FD 2JO6A 3ABVC 1HWTC 1NTKJ 1SQQG 1GD2E 2P1JA 3TF5A 2FKWB 2HMKA 2K37A 3T97B 1YIJP 2E76C 1R5SA 2R5BA 4PV1C 3CD6P 3L74E 3B5NA 2Z5IA 3TGUJ 1O7MA 1N7SB 5KLVD 5AVWB 4H13C 1O7NA 3C9IA 2E75C 4EYYQ 2Q3WA 1BDCA 2N1TC 5AVUB 1G8JB 3LW5J 1JY3O 5TISE 3Q2YA 4IFFA 1PP9J 2FFDC 3L72J 4O9BA 2Y0DA 4PV1B 3L74G 3USSA 2LXBA 1ZRTE 5C39A 2H89C 1BGYD 5TJHA 4NBGD 2XSHA 1O7WA 3H1LJ 4AUWA 1RF1B
chains in the Genus database with same CATH topology
3H1HE 4QUPA 1NTZE 2FYNC 5AEUA 4HJLA 2YFLA 3EQQA 4H13D 1NTKE 1RIEA 4QCKA 4U3FE 3D89A 1KB9E 2E75D 2DE7D 3GB4A 2GBXA 4EMJB 4NB8D 3N0QA 4QDCA 3GCEA 1NYKA 5KLVE 5CXMA 2ZYLA 1SQBE 4HM7A 2A06E 1UUVA 1SQPE 2GBWA 1ULJA 4PV1D 1PP9E 4NBAD 4OGQD 1PPJE 3L72E 4HM0A 3TGUE 3H1IE 3VCPA 3BCCE 5HL4A 2QPZA 1BE3E 2BMOA 1SQXE 2JO6A 2YVJB 2HMMA 3C0DA 3GZYA 1FQTA 2YFJA 1ULIA 3CXHE 4NBBD 2DE5D 2XR8A 1VCKA 4HKVA 1O7HA 2ZT9D 1EZVE 4P1CH 2YIUC 1L0NE 3FOUA 2E4QA 3DQYA 1BGYE 2HMNA 3GTSA 2NUMA 1EG9A 2JZAA 2HMJA 2HMKA 2NVFA 4NBHD 2E74D 4HM6A 2DE6D 4QDDA 5KKZC 4NBED 1VM9A 3H1JE 3GTEA 1JM1A 2B1XA 1SQVE 1G8KB 3VMID 3GL0A 4AIVA 1KYOE 1SJGA 3L74E 1O7PA 2XSOA 4D6TE 3GZXA 5BOKA 1O7MA 2NWFA 1UUWA 5KLIC 4HM1A 3EN1A 4QDFA 3VMGD 2NUKA 3L70E 4PD4E 1O7GA 3H1LE 1O7NA 2NVEA 1WQLA 4HM4A 1P84E 2BMRA 3GL2A 1VF5D 3L71E 2Q3WA 4AAYB 4HM5A 4HM8A 3CWBE 3H1KE 2NVGA 1G8JB 1L0LE 2HMOA 2E4PA 2BMQA 1BCCE 1RFSA 4NBCD 3L73E 2D2CD 1NTME 1NDOA 2FYUE 3AZCA 4NB9D 4H44D 4NBDD 4P1BH 4H0LD 5AEWA 2BCCE 3GKEA 2XRXA 4NBFD 2QJKC 2QJPC 2HMLA 4QURA 1NU1E 2B24A 1Q90C 1SQQE 1ZRTE 2QJYC 2CKFA 3CX5E 3L75E 2E76D 4HM3A 2YFIA 4QDFB 2I7FA 4QUQA 4NBGD 2XSHA 3GOBA 3VMHD 2IBZE 1O7WA 3VCAA 4HM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H E;  4QUP A;  1NTZ E;  2FYN C;  5AEU A;  4HJL A;  2YFL A;  3EQQ A;  4H13 D;  1NTK E;  1RIE A;  4QCK A;  4U3F E;  3D89 A;  1KB9 E;  2E75 D;  2DE7 D;  3GB4 A;  2GBX A;  4EMJ B;  4NB8 D;  3N0Q A;  4QDC A;  3GCE A;  1NYK A;  5KLV E;  5CXM A;  2ZYL A;  1SQB E;  4HM7 A;  2A06 E;  1UUV A;  1SQP E;  2GBW A;  1ULJ A;  4PV1 D;  1PP9 E;  4NBA D;  4OGQ D;  1PPJ E;  3L72 E;  4HM0 A;  3TGU E;  3H1I E;  3VCP A;  3BCC E;  5HL4 A;  2QPZ A;  1BE3 E;  2BMO A;  1SQX E;  2JO6 A;  2YVJ B;  2HMM A;  3C0D A;  3GZY A;  1FQT A;  2YFJ A;  1ULI A;  3CXH E;  4NBB D;  2DE5 D;  2XR8 A;  1VCK A;  4HKV A;  1O7H A;  2ZT9 D;  1EZV E;  4P1C H;  2YIU C;  1L0N E;  3FOU A;  2E4Q A;  3DQY A;  1BGY E;  2HMN A;  3GTS A;  2NUM A;  1EG9 A;  2JZA A;  2HMJ A;  2HMK A;  2NVF A;  4NBH D;  2E74 D;  4HM6 A;  2DE6 D;  4QDD A;  5KKZ C;  4NBE D;  1VM9 A;  3H1J E;  3GTE A;  1JM1 A;  2B1X A;  1SQV E;  1G8K B;  3VMI D;  3GL0 A;  4AIV A;  1KYO E;  1SJG A;  3L74 E;  1O7P A;  2XSO A;  4D6T E;  3GZX A;  5BOK A;  1O7M A;  2NWF A;  1UUW A;  5KLI C;  4HM1 A;  3EN1 A;  4QDF A;  3VMG D;  2NUK A;  3L70 E;  4PD4 E;  1O7G A;  3H1L E;  1O7N A;  2NVE A;  1WQL A;  4HM4 A;  1P84 E;  2BMR A;  3GL2 A;  1VF5 D;  3L71 E;  2Q3W A;  4AAY B;  4HM5 A;  4HM8 A;  3CWB E;  3H1K E;  2NVG A;  1G8J B;  1L0L E;  2HMO A;  2E4P A;  2BMQ A;  1BCC E;  1RFS A;  4NBC D;  3L73 E;  2D2C D;  1NTM E;  1NDO A;  2FYU E;  3AZC A;  4NB9 D;  4H44 D;  4NBD D;  4P1B H;  4H0L D;  5AEW A;  2BCC E;  3GKE A;  2XRX A;  4NBF D;  2QJK C;  2QJP C;  2HML A;  4QUR A;  1NU1 E;  2B24 A;  1Q90 C;  1SQQ E;  1ZRT E;  2QJY C;  2CKF A;  3CX5 E;  3L75 E;  2E76 D;  4HM3 A;  2YFI A;  4QDF B;  2I7F A;  4QUQ A;  4NBG D;  2XSH A;  3GOB A;  3VMH D;  2IBZ E;  1O7W A;  3VCA A;  4HM2 A; 
#chains in the Genus database with same CATH topology
 1R5L A;  1JY2 O;  4QCK A;  4ASV A;  3TSI A;  3CC4 P;  3EFF K;  1KQF B;  3VTP C;  4EOT A;  4LLH A;  3WU2 E;  2QEX P;  3HUS A;  1IK7 A;  4HM0 A;  3D6Z A;  1QL1 A;  1SQB K;  1SQX E;  1QGK B;  2HMM A;  5KTB A;  1X22 A;  1FQT A;  1ULI A;  1K8A Q;  4JYB A;  2V7Q H;  2YMK A;  1QX8 A;  1GL2 B;  1JM0 A;  1Y9B A;  2KYV A;  4R4L A;  2OTL P;  1KN7 A;  3A2A A;  1M1J B;  3H32 B;  3D70 A;  2Q9I A;  4A7P A;  2Q3I A;  1NTK G;  4AIV A;  1IFJ A;  1T2K D;  3A7O A;  4N3Y B;  4DZO A;  1ZR4 A;  1T3U A;  1IFI A;  1LT9 C;  1O7G A;  2JR8 A;  4WY4 D;  2YO3 A;  1N73 A;  2CPS A;  1EDJ A;  3IAO A;  4AAY B;  3CWB E;  3U59 A;  3CPW O;  2E4P A;  2BMQ A;  1LTI C;  2QM7 A;  1GU4 A;  4KT0 J;  4Z1M H;  2ZXE B;  3TGU G;  1QVF O;  2QJK C;  3VMX A;  3OAK A;  3JC2 2;  5BU8 B;  3B5N C;  1EZV D;  1YYC A;  3AE6 C;  5BU5 A;  1KOR A;  1YJ9 P;  4Y28 J;  2ZVO B;  2O01 H;  2R5D A;  4I2L C;  2W27 A;  1MUU A;  3M9H A;  2HPC A;  1HUC A;  2KB7 P;  3SWK A;  1IK9 A;  5KLV E;  4NPD A;  2KZI A;  3VMZ A;  2L91 A;  2KIK A;  3L4F A;  1GTW A;  1BDD A;  2HLO A;  2AEM A;  1VPC A;  3L71 J;  2YO2 A;  2G8Y A;  3L73 G;  3H1K J;  1PGJ A;  3H1H J;  4GT1 A;  3SFD C;  1P84 H;  3GZY A;  2DE5 D;  2FYU J;  5CCG D;  2BCC J;  4H0L C;  1BGY E;  1E5W A;  2N9Y B;  3MTU E;  5CCG A;  3V4W A;  4L74 A;  3D71 A;  2K1A A;  4HM6 A;  1IZN B;  3HUS C;  2QE7 H;  2B1X A;  3VMI D;  2OYI A;  1LTA C;  3RL0 g;  1KD1 Q;  3VYI A;  2NWF A;  3EN1 A;  4QDF A;  1SQB G;  4HKZ H;  1LP1 B;  3UIA A;  1M57 D;  2B87 B;  3PP5 A;  2DW3 A;  5AW9 B;  1RQV A;  3AE3 C;  4L75 A;  1OIP A;  3CL3 D;  1VQ6 P;  3HUS B;  3WUT A;  2OGU A;  5AW2 B;  1DEE G;  1IFM A;  1D7M A;  1GK4 A;  3N7N A;  1LTT C;  1SLQ A;  4GDO A;  2RMZ A;  4LGD E;  1N73 C;  2GUV A;  2Q7C A;  3VCA A;  2Y9Z A;  3L37 A;  2FY8 A;  2LR2 A;  3KXD A;  1Q2N A;  2Q1K A;  1UUV A;  3VMA A;  4OGQ D;  1L0L D;  1L2P A;  2YMY A;  3U1A A;  1CW5 A;  1NTM D;  1ZOY C;  4L76 A;  4WY4 B;  2RH0 A;  4PD4 H;  1KB9 D;  2XZR A;  1S3J A;  2YVJ B;  2AEJ A;  1J2J B;  5KJ7 D;  4DCK A;  3BVH A;  1EZV E;  3ITK A;  4LC1 A;  2DE6 D;  1ZP0 C;  3WUV A;  3AEB C;  3HRN A;  3H1H G;  3TK1 A;  1LTJ A;  1YQ4 C;  2KLU A;  1PV3 A;  1SJG A;  3GZX A;  3H1I J;  2NPS D;  1IFN A;  3HE5 A;  1L0L K;  1OVU A;  2HPC B;  1EC5 A;  1NTM K;  4BRY B;  2XDJ A;  2KS1 A;  2LKM A;  4YXD C;  1N86 A;  1L0N J;  5CCG C;  1VQM P;  1SVF A;  2R32 A;  1EXJ A;  1M8O B;  5AEW A;  5M1B A;  2OYI C;  2E43 A;  3CC7 P;  3CXH D;  1FDI A;  2W83 C;  2V4H A;  3BCC J;  4ASW A;  4UB6 H;  3RK3 C;  3V5B A;  1BSH A;  3JCU E;  1ZW0 A;  2O1J A;  4D6T J;  3M0D A;  1AV1 A;  4HM2 A;  5B5E E;  1VDF A;  1SP4 A;  3EQQ A;  3MGN A;  3LW5 H;  1FJP A;  1A02 F;  5AW4 B;  5CXM A;  4UB8 H;  3L70 G;  4HM7 A;  1E79 H;  1FOS E;  1BCC D;  3G4S P;  4RKU J;  3N4X A;  1N7S A;  3PLN A;  3VMY A;  1YJN P;  3HD7 D;  4HKV A;  3GW6 A;  2HOD A;  1O7H A;  3CX5 D;  1N2D C;  2A06 D;  4Y99 C;  1SQV K;  2OTJ P;  1SQQ J;  4JBZ A;  2Q3E A;  1NTZ D;  3E1R A;  1WRG A;  2P58 A;  2ZYA A;  1IJD B;  2J58 A;  2XKM A;  5BOK A;  1VQ8 P;  5E79 E;  4HM1 A;  2AXT E;  1XTG B;  1WQL A;  3CMA P;  1RF1 A;  1VL2 A;  3KQG A;  1NO4 A;  1HGZ A;  1L0L E;  1PPJ G;  1KIL A;  2D2C D;  1AVY A;  1NTM E;  4NBD D;  1JY3 P;  1FZG A;  3KZI E;  1OWA A;  3KPE A;  3CCQ P;  1LTJ C;  1BE3 D;  3V2N A;  4OGQ B;  2QJP B;  2W90 A;  2ZXX A;  4GOF A;  1DIP A;  1URQ D;  1EQ7 A;  3L74 J;  1YHQ P;  4N78 E;  5EFW B;  2WTY A;  1MZ9 A;  4JYC A;  5AVS B;  2CPB A;  1FU1 A;  2C0X A;  4HJL A;  2K9J A;  1G2C B;  1RIE A;  5APU A;  2IDB A;  1KYO D;  1JY2 P;  2E74 C;  2G3A A;  1MFT A;  3GCE A;  4MN4 C;  3H32 A;  1NOH A;  3CCL P;  3FX0 A;  3AEG C;  3M0D C;  2K88 A;  1RY3 A;  2PFX A;  3CCR P;  1QLE D;  2KS1 B;  1R8E A;  2FYZ A;  2QPZ A;  4C46 A;  1NU1 D;  2YFJ A;  3CXH E;  4PJ0 E;  3DQY A;  1YJW P;  1S5L E;  5GTH E;  4YXW H;  2FXM A;  4NBE D;  2IX7 C;  3H1J E;  1SQX K;  5KKZ B;  3RK2 D;  3W67 A;  1SQV E;  3AE9 C;  3K5B A;  1T3J A;  5B66 H;  3CCE P;  1HGV A;  3LID A;  3NTN A;  1N7S C;  1KQL A;  1T8Z A;  2BEQ D;  2FBW C;  3A0B H;  2YKO A;  2GM4 A;  2IFM A;  1PP9 D;  2WSC J;  3L72 D;  1FAV A;  1BCC E;  3H1J G;  1NU1 K;  1NDO A;  4W80 A;  1SQV G;  3B71 A;  2QIW A;  2B24 A;  1LTB C;  3MUD C;  5AW0 B;  3L35 A;  3H1L D;  3CX5 E;  2YFI A;  2P10 A;  3NMD A;  1S5L X;  3TYY A;  2AEF A;  1VQN P;  2HOD B;  3QWO C;  1CZQ A;  1RF1 C;  3V4Q A;  3HD7 B;  1FOS F;  1NTZ E;  1S9K D;  2IPP A;  2FYN B;  3CWB J;  1KIL C;  1VQ4 P;  3GB4 A;  1USD A;  3JSV C;  4KHX A;  1Z56 A;  4RO0 A;  1NKZ B;  3MP7 B;  2IYP A;  3VOP A;  1KIL E;  3ZDM A;  2E5Y A;  2VRS A;  1WT6 A;  4KJM A;  2HR3 A;  2A45 I;  1G1J A;  2WIT A;  3IFM A;  5KLV K;  3JCU H;  1BE3 E;  1KIL B;  1S2E A;  1GZL A;  1LP1 A;  3L73 J;  3LIE A;  1JUN A;  2ZT9 D;  2B87 A;  2KSE A;  2D2C B;  1GL2 C;  3FOU A;  5KAI E;  5K5G B;  2E4Q A;  3GTS A;  2M5A B;  2IBZ D;  4NBH D;  5H2F H;  3Q5S A;  1M1J C;  3GTE A;  1URQ B;  1Q81 Q;  1KYO E;  1PIX A;  2YKQ A;  1VQ9 P;  5CBO A;  1UUW A;  2K9J B;  5KLI B;  2RKL A;  5AW1 B;  1Y8A A;  2NVE A;  3SWY A;  1SQP D;  2BMR A;  1VF5 D;  1VQK P;  1CSB A;  4HM8 A;  2NVG A;  1SQB J;  4W7Y A;  5AVY B;  1KQG B;  1FS0 E;  1VQ7 P;  1PGO A;  3AZC A;  3IF4 A;  2XV5 A;  5AVR B;  2JDI H;  1HBW A;  4C7N B;  1SQX G;  1OMI A;  1NU1 E;  1Q90 C;  3A0H E;  3P8C D;  3FWL A;  4RES B;  2QJY B;  4HM3 A;  3RL0 D;  4ZKU A;  2C9N Y;  1H8A A;  1KZU B;  4WY4 A;  3WUU A;  1NHL A;  1N8R Q;  2ZYG A;  5APW A;  4U3F E;  1SQP K;  1YTZ T;  3OW2 O;  3M0A A;  3RK2 B;  2WSE H;  3CCS P;  3L71 D;  1ULJ A;  1PP9 E;  3KZI H;  3H1K D;  3L72 E;  3CWB G;  2OAR A;  1OW8 A;  3TNU A;  2KNC B;  3VCP A;  3AEF C;  2FYU D;  2BCC D;  5HL4 A;  4U3F G;  1QL2 A;  3CCU P;  2P7J A;  2XR8 A;  1VCK A;  1J1E B;  4BRY A;  1FJK A;  1J1D B;  3R4Y A;  1EG9 A;  2R44 A;  2WZ7 A;  1H89 A;  1DX7 A;  2A45 G;  1RE4 A;  1M1K Q;  1SFC D;  3CI9 A;  3RBX A;  3RGU A;  3M06 A;  5KLV G;  1EZV I;  2YKP A;  3H25 A;  2WPR A;  3I5C A;  4TT3 H;  5APQ A;  2QA4 P;  3V6I A;  2R3C A;  4IOI H;  2Q6Q A;  5GTI E;  2OTK E;  2PP6 A;  4HYT B;  1BGY G;  3AEE C;  1GW3 A;  2JWD A;  1EDI A;  2IBZ E;  1ZXG A;  3GHG A;  1YI2 P;  1KMI Z;  1PZQ A;  2ZT9 B;  3NFQ A;  1NYH A;  5CCH D;  2NZ2 A;  1PL5 A;  4GIF A;  1ZV8 A;  3F5H A;  4IL6 E;  1AQ5 A;  2SPZ A;  3I56 P;  1T2K C;  1SQP E;  3BAS A;  3L70 J;  1KV4 A;  1NH4 A;  1ZN5 A;  4WY4 C;  2B89 A;  4WVZ A;  2H88 C;  5APS A;  1M56 D;  3KYQ A;  5AVQ B;  1H88 A;  1X9V A;  3P8C E;  3L75 D;  3AEA C;  2RN0 A;  5TIS H;  2NVF A;  4JQ0 D;  3P32 A;  3H1I D;  1W2B O;  1KFM A;  1LGH B;  3KDP B;  3O6Q B;  1LT1 A;  3RL0 B;  1O7P A;  2WT7 B;  2FXO A;  1OXZ A;  1FZC B;  4CPG A;  1L0N D;  4IL6 X;  3AE2 C;  4GOD A;  1JCD A;  5KJ7 A;  3U1C A;  3L71 E;  4WBA A;  4GKG A;  3H1K E;  1DEB A;  1G2C A;  4WB4 A;  5DJU B;  5KAF E;  3VP8 A;  2FYU E;  3BCC D;  2BCC E;  3SWF A;  3WU2 H;  1QVG O;  2HML A;  4D6T D;  4M3L A;  1RE4 C;  2QG4 A;  3TNU B;  2ITA A;  5DJT B;  2JO1 A;  1JO5 A;  5AW3 B;  1EZV G;  2NPS A;  2KOG A;  3MIW A;  2W6B A;  4XFJ A;  1JTH A;  3AE7 C;  3HE4 A;  1M7L A;  2ZJS E;  2WSF H;  5AW5 B;  1L0L J;  5CJ4 A;  2WSC H;  2WSE J;  1NTM J;  1HJB A;  5AW6 B;  3G3Z A;  2WPV B;  2ZYL A;  4DT0 A;  1P84 D;  3FWN A;  3OA7 A;  1SFC B;  4YPC A;  1UIX A;  5APY A;  4R4M A;  3PRJ A;  2J5U A;  4HB1 A;  4I7Z B;  2H43 A;  1SQQ D;  3BAT A;  2YIU B;  3GF3 A;  1DD3 A;  1G8K B;  2WPS A;  3GHG B;  1VQ5 P;  3VMG D;  2QRX A;  3OJA B;  1L4A D;  3CXH I;  5CHX A;  3GLM A;  2A45 H;  4IFM A;  3HD7 A;  3Q5R A;  2FXP A;  4ZNC A;  5AVT B;  1RF0 A;  4P1B H;  3L74 D;  4OGQ C;  2QJP C;  5AW8 B;  3H1J J;  1NGM B;  2GUS A;  2PAJ A;  1SQV J;  1RQU A;  3R2P A;  3CCJ P;  3L75 E;  1GDT A;  1X0T A;  2E76 D;  2O3J A;  4QUQ A;  5KJ7 C;  3AE8 C;  3G9R A;  2YFL A;  4H13 D;  5AVV B;  4NPF X;  3QH9 A;  1G1I A;  2P2U A;  1BCC J;  1KB9 E;  2E75 D;  1ZRT D;  2N1T D;  3A3Y B;  2M5A A;  4PD4 D;  1RH5 B;  2N1T A;  3CX5 I;  2E5T A;  1NTZ K;  1AA0 A;  1URQ A;  1JNM A;  4NBA D;  2NPS C;  1Q86 Q;  1L0L G;  3BCC E;  1NTM G;  2UWJ E;  2BMO A;  2IFN A;  3C1L A;  5APV A;  3AEC C;  4OVN F;  2KSJ A;  1Q7Y Q;  2WQY C;  2M0B A;  3E1I A;  2OQQ A;  2K3R A;  5KKZ C;  2JEE A;  2NPS B;  2PGD A;  1NAF A;  4C7N A;  1NTK D;  1JTH B;  3HE4 B;  2R3S A;  1CI6 A;  1SS1 A;  2OYH A;  1EDL A;  3GF7 A;  1IFP A;  1P84 E;  2AXC A;  4TLF A;  1NVO A;  4HM5 A;  1YQ3 C;  2HMO A;  3IR9 A;  4NBC D;  3H6P A;  1LJ2 A;  3RBZ A;  3TGU D;  1FDO A;  1KYO I;  2I1K A;  3FGA D;  1SQQ E;  2H8P D;  1SQX J;  2K9Y A;  2WSF J;  1OW7 A;  1WMK A;  1NTK K;  2B9B A;  2KNC A;  3GOB A;  3HD7 C;  2XNX A;  2FYN C;  1VQO P;  2ZYD A;  2H7H A;  1RF0 C;  1NWQ A;  2Z4E A;  1LT9 A;  1JY3 N;  2GBX A;  1FBM A;  2M3B A;  2J59 M;  1NYK A;  1K9M Q;  1HH0 A;  3S1K A;  1JCC A;  2A06 E;  2ZVN B;  3FXE A;  1NU1 J;  5KAF H;  1S72 P;  1L4A B;  1BCC G;  3B5N D;  3L73 D;  2ZAE B;  5AW7 B;  1GU5 A;  2Y9Y A;  3PTZ A;  1JY2 N;  2D2C C;  1HTL C;  4U3F J;  2A06 G;  2HMN A;  2NUM A;  3MZW B;  1URQ C;  1NTZ G;  2E76 B;  1FZB A;  3GL0 A;  1H0T B;  1W2E A;  2HYN A;  2O01 N;  5KLI C;  4C7R A;  1T6A A;  2NUK A;  1SQB D;  4PD4 E;  3CME P;  1VQP P;  3D6Y A;  1YTZ I;  4H13 B;  5B5E H;  3I55 P;  2E75 B;  5KLV J;  2N1T B;  1AFO A;  2M8R A;  4BWN A;  3HTK B;  2JWA A;  1GW4 A;  4H44 D;  4H0L D;  2FFD B;  1BE3 G;  2QJY C;  2OYH C;  1KQS O;  1A02 J;  1TU3 F;  2I1J A;  2B88 A;  4XE5 B;  2Y0E A;  1YIT P;  1BGY J;  1BSN A;  1NTK E;  1PFI A;  1K73 Q;  2DE7 D;  1MKM A;  1FZE A;  3RK2 C;  1CI6 B;  1ZR2 A;  3Q5P A;  2OYH B;  2GBW A;  4UB6 E;  3O6Q A;  2IBZ I;  1JMB A;  4JF7 A;  5E79 H;  3TGU E;  1KTM A;  2WT7 A;  2AXT H;  2KI7 B;  1OVR A;  4YTP C;  1FZC A;  2QVA A;  1K05 A;  1J1E C;  1EXI A;  1J1D C;  1NU1 G;  1S4X A;  3BRT B;  1KFN A;  4UB8 E;  2N9B A;  1KB9 H;  4AQR D;  3H1H D;  1SQP J;  2I8D A;  1IFD A;  2JP3 A;  1OVV A;  4OWF A;  1LWU A;  3NXS A;  3V2Q A;  2Y0C A;  2O1K A;  3BRV B;  2WSS H;  3H1L E;  2C0W A;  1LT9 B;  3PJS K;  1PP9 G;  3IN6 A;  3L72 G;  3L73 E;  3GG2 A;  1S9K E;  4NB9 D;  3E7K A;  2QJK B;  4QUR A;  1SFC A;  3B5N B;  1U57 A;  3H1L G;  3CLQ A;  3C8V A;  1U7J A;  2FYU K;  3VMH D;  3EQ2 A;  1FZF A;  1JEK A;  3M91 A;  2ZT9 C;  5AVX B;  3CXH H;  1USE A;  4PJ0 H;  3VN0 A;  1JB0 J;  1S5L H;  2GA1 A;  5GTH H;  4NB8 D;  4H44 C;  3L70 D;  1S1C X;  2BAS A;  1LTS C;  1SQB E;  3WMM 0;  3MHV A;  3P8M C;  1OZH A;  2XU6 A;  3PHL A;  3S4R A;  3RK3 D;  5AVZ B;  1IC2 A;  1N7L A;  1JOC A;  1VF5 C;  4HH2 A;  3C0D A;  2W8Z A;  5CCH A;  4EDF A;  4XA4 A;  4P1C H;  1YBK A;  2YXR B;  4H44 B;  4H0L B;  1KC8 Q;  2POH A;  2MJZ A;  3G71 P;  3KHU A;  2IBZ G;  4NPE A;  4EIJ A;  1MV8 A;  4BXL A;  5APT A;  1X8Y A;  3RL0 C;  1ZME C;  3CX5 H;  4IFD K;  4RJT A;  2NRG A;  1VF5 B;  2Q5U A;  1FZC C;  1RE3 A;  2Z5H A;  1GK6 A;  3B4S A;  4DOJ A;  2ZFC A;  2CK3 H;  4HM4 A;  2P67 A;  3GL2 A;  1SQP G;  1PPJ D;  2HFE D;  1RFS A;  1LNQ A;  5BVZ A;  1LWU C;  4WWI A;  1M90 Q;  4AYC A;  3W68 A;  5B66 E;  3Q1M A;  3CCV P;  2QSI A;  3M9Q A;  3O8Z A;  3A0B E;  1RHZ B;  1N73 B;  3H1H E;  3S9O A;  5AEU A;  1AQT A;  2V7Q J;  1FE6 A;  3L36 A;  5KAI H;  1AJY A;  4I1L A;  4QDC A;  3N0Q A;  1LWU B;  4N78 D;  4JPZ B;  1OFC X;  1NAY A;  1SFC C;  1FC2 C;  2BEZ F;  2M3E A;  3L71 G;  3L75 J;  1KYO H;  3H1K G;  3EWK A;  2KLV A;  1EDK A;  2KXP B;  2FYU G;  4I7Z C;  2BCC G;  1L0N K;  4ZMD A;  4U7J A;  3CC2 P;  1KB9 I;  5CJ0 A;  4NBB D;  2YIU C;  3G6E P;  2JZA A;  2E74 D;  1NKN A;  1VM9 A;  2JKV A;  1JM1 A;  2JJL A;  3A0H H;  3GHG C;  3V2P A;  5CBN A;  2XSO A;  5APX A;  2HG5 D;  3CCM P;  3AE1 C;  3L70 E;  2QM8 A;  1NJI Q;  5CCH C;  2O01 J;  1MFZ A;  1OW6 A;  3H1J D;  1DH3 A;  2YXQ B;  1SQV D;  3RK3 E;  1PGP A;  5H2F E;  4NBF D;  4OH8 B;  1XTC C;  2YNY A;  2OYI B;  4EI2 A;  1RE3 C;  3RK3 B;  3T97 A;  2E42 A;  2LXC B;  3VP9 A;  1FDM A;  4QDF B;  4L73 A;  1P84 I;  1HJ0 A;  1L4A A;  3AED C;  1N7S D;  1SQQ K;  3A5T A;  2C9L Y;  4ZKP A;  4EMJ B;  2MKV A;  4PV1 D;  1W5C E;  2KK7 A;  1PPJ E;  1H0T A;  3H1I E;  1DD4 A;  1LTG C;  3MUD A;  1FZA A;  2L5G B;  3AE5 C;  4N6J A;  1IO4 A;  2KZJ A;  1L0N E;  3L75 G;  3FXD A;  4Y99 B;  1AVO A;  1KIL D;  2KUB A;  1PGQ A;  2HMJ A;  3HTK A;  4QDD A;  1VQL P;  1K04 A;  2FFD A;  4B86 A;  1HVV A;  3H1I G;  1ZLL A;  3EFG A;  5GTI H;  1QEX A;  1X79 B;  1OX3 A;  3SSU A;  3B8E B;  4D6T E;  1NTZ J;  3SFE C;  5L8R J;  2WPQ A;  4GOE A;  3F89 A;  1L0N G;  4HJG H;  3AE4 C;  3V2R A;  2KP8 A;  2W6A A;  2WWW A;  2WMM A;  1HF9 A;  1GMJ A;  4DJG A;  3GMA A;  1GL2 D;  5CMZ A;  3BCC G;  4IL6 H;  2XRX A;  3GKE A;  2IZ0 A;  1SQX D;  1LTJ B;  4D6T G;  1GL2 A;  3TDK A;  3Q3D A;  2CKF A;  1BE3 J;  4PD4 I;  4W7Z A;  1M1J A;  2I7F A;  3HE5 B;  1UII A;  2W6J H;  4QUP A;  2PRR A;  4I6M C;  1Q82 Q;  3M9B A;  4QMA A;  1U7M A;  4K35 A;  3PH0 A;  3D89 A;  2E74 B;  3P7K A;  1JMM A;  2IYO A;  2OYO A;  2WVR A;  3CWB D;  4K3A A;  1L4A C;  2IZ1 A;  1Q90 D;  3MD0 A;  1Y47 A;  2XND H;  3II6 A;  4U3F D;  2JO6 A;  3ABV C;  1HWT C;  1NTK J;  1SQQ G;  1GD2 E;  2P1J A;  3TF5 A;  2FKW B;  2HMK A;  2K37 A;  3T97 B;  1YIJ P;  2E76 C;  1R5S A;  2R5B A;  4PV1 C;  3CD6 P;  3L74 E;  3B5N A;  2Z5I A;  3TGU J;  1O7M A;  1N7S B;  5KLV D;  5AVW B;  4H13 C;  1O7N A;  3C9I A;  2E75 C;  4EYY Q;  2Q3W A;  1BDC A;  2N1T C;  5AVU B;  1G8J B;  3LW5 J;  1JY3 O;  5TIS E;  3Q2Y A;  4IFF A;  1PP9 J;  2FFD C;  3L72 J;  4O9B A;  2Y0D A;  4PV1 B;  3L74 G;  3USS A;  2LXB A;  1ZRT E;  5C39 A;  2H89 C;  1BGY D;  5TJH A;  4NBG D;  2XSH A;  1O7W A;  3H1L J;  4AUW A;  1RF1 B; 
#chains in the Genus database with same CATH homology
 3H1H E;  4QUP A;  1NTZ E;  2FYN C;  5AEU A;  4HJL A;  2YFL A;  3EQQ A;  4H13 D;  1NTK E;  1RIE A;  4QCK A;  4U3F E;  3D89 A;  1KB9 E;  2E75 D;  2DE7 D;  3GB4 A;  2GBX A;  4EMJ B;  4NB8 D;  3N0Q A;  4QDC A;  3GCE A;  1NYK A;  5KLV E;  5CXM A;  2ZYL A;  1SQB E;  4HM7 A;  2A06 E;  1UUV A;  1SQP E;  2GBW A;  1ULJ A;  4PV1 D;  1PP9 E;  4NBA D;  4OGQ D;  1PPJ E;  3L72 E;  4HM0 A;  3TGU E;  3H1I E;  3VCP A;  3BCC E;  5HL4 A;  2QPZ A;  1BE3 E;  2BMO A;  1SQX E;  2JO6 A;  2YVJ B;  2HMM A;  3C0D A;  3GZY A;  1FQT A;  2YFJ A;  1ULI A;  3CXH E;  4NBB D;  2DE5 D;  2XR8 A;  1VCK A;  4HKV A;  1O7H A;  2ZT9 D;  1EZV E;  4P1C H;  2YIU C;  1L0N E;  3FOU A;  2E4Q A;  3DQY A;  1BGY E;  2HMN A;  3GTS A;  2NUM A;  1EG9 A;  2JZA A;  2HMJ A;  2HMK A;  2NVF A;  4NBH D;  2E74 D;  4HM6 A;  2DE6 D;  4QDD A;  5KKZ C;  4NBE D;  1VM9 A;  3H1J E;  3GTE A;  1JM1 A;  2B1X A;  1SQV E;  1G8K B;  3VMI D;  3GL0 A;  4AIV A;  1KYO E;  1SJG A;  3L74 E;  1O7P A;  2XSO A;  4D6T E;  3GZX A;  5BOK A;  1O7M A;  2NWF A;  1UUW A;  5KLI C;  4HM1 A;  3EN1 A;  4QDF A;  3VMG D;  2NUK A;  3L70 E;  4PD4 E;  1O7G A;  3H1L E;  1O7N A;  2NVE A;  1WQL A;  4HM4 A;  1P84 E;  2BMR A;  3GL2 A;  1VF5 D;  3L71 E;  2Q3W A;  4AAY B;  4HM5 A;  4HM8 A;  3CWB E;  3H1K E;  2NVG A;  1G8J B;  1L0L E;  2HMO A;  2E4P A;  2BMQ A;  1BCC E;  1RFS A;  4NBC D;  3L73 E;  2D2C D;  1NTM E;  1NDO A;  2FYU E;  3AZC A;  4NB9 D;  4H44 D;  4NBD D;  4P1B H;  4H0L D;  5AEW A;  2BCC E;  3GKE A;  2XRX A;  4NBF D;  2QJK C;  2QJP C;  2HML A;  4QUR A;  1NU1 E;  2B24 A;  1Q90 C;  1SQQ E;  1ZRT E;  2QJY C;  2CKF A;  3CX5 E;  3L75 E;  2E76 D;  4HM3 A;  2YFI A;  4QDF B;  2I7F A;  4QUQ A;  4NBG D;  2XSH A;  3GOB A;  3VMH D;  2IBZ E;  1O7W A;  3VCA A;  4HM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...