1PP9E

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 54
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1pp9E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1pp9E02
4P1CH 2XSOA 4NBAD 2HMOA 3H1JE 3C0DA 1O7HA 1O7MA 2DE7D 1O7GA 1SQVE 1Q90C 2JZAA 3GTSA 2E74D 4QUQA 3VCAA 2B1XA 1BE3E 2YVJB 4NBGD 4HM8A 2QJPC 4HM1A 5KLVE 2XR8A 3DQYA 3VMHD 2DE6D 4NBCD 4U3FE 4NBBD 4NB9D 5AEUA 4H44D 3H1KE 4QDCA 2BMRA 4QDFB 2HMLA 4AIVA 3H1IE 1WQLA 3VMID 1VM9A 4HM7A 2GBXA 3VMGD 1EG9A 1SQXE 3L72E 3EN1A 1PP9E 3GZYA 4HJLA 2CKFA 3GCEA 2NWFA 2NVGA 1O7PA 4H0LD 1L0LE 4QCKA 4HM5A 1SQQE 1EZVE 4EMJB 1PPJE 2YFLA 3AZCA 3VCPA 1UUVA 1VF5D 1RFSA 2A06E 2D2CD 5CXMA 3GL2A 4QURA 2XSHA 2ZT9D 4NBDD 1O7NA 5KLIC 2ZYLA 3GZXA 3GL0A 3BCCE 2YIUC 4D6TE 1BGYE 4AAYB 5HL4A 2NVEA 1NTZE 4HM0A 4P1BH 1NDOA 2E75D 4NB8D 3GTEA 2FYUE 3D89A 1NTME 2B24A 1SQBE 1BCCE 1ZRTE 2JO6A 2YFIA 4HM2A 2FYNC 4HM4A 3EQQA 4H13D 2NVFA 2QPZA 4QUPA 4QDDA 4PV1D 2HMMA 1KB9E 3L70E 1RIEA 1ULJA 3L73E 2BMOA 3GOBA 3FOUA 3GKEA 2NUKA 3N0QA 1JM1A 1VCKA 3H1HE 2HMJA 4OGQD 1L0NE 3TGUE 2HMNA 5KKZC 2YFJA 4QDFA 1NTKE 1G8KB 3H1LE 2XRXA 1ULIA 3GB4A 3CWBE 4PD4E 1KYOE 4HKVA 1P84E 3CXHE 1UUWA 1G8JB 3CX5E 4HM6A 1SQPE 2E76D 5BOKA 3L75E 3L74E 1SJGA 5AEWA 2BMQA 2E4QA 1NYKA 2DE5D 2IBZE 2GBWA 2HMKA 4NBED 1O7WA 4NBHD 4HM3A 4NBFD 1NU1E 2NUMA 2Q3WA 2E4PA 1FQTA 3L71E 2QJYC 2I7FA 2QJKC 2BCCE
chains in the Genus database with same CATH superfamily
2M3EA 3TSIA 1BCCD 1FZGA 5KJ7C 2HR3A 4QUQA 1N7SD 4WB4A 2KZJA 2Y0DA 3VMHD 3RK3D 4XA4A 1OVUA 1A02J 3VMYA 4IL6H 3S4RA 2GBXA 5BU5A 3MHVA 1SQVJ 3TDKA 1SQXE 4PD4H 2CKFA 3G71P 2KK7A 1L4AA 2N1TD 1T2KD 1HBWA 4RJTA 3SSUA 4NPDA 3Q5PA 2ZYLA 2CK3H 3RGUA 4BXLA 2YIUB 5H2FE 3EFFK 3LIDA 2IX7C 3HD7B 2BEQD 4XE5B 2ZVOB 3CL3D 1KB9I 1BE3D 3FX0A 5AVUB 2ITAA 5KAFH 1LT9B 2RMZA 3GOBA 3L71G 2QM7A 4QDFA 3H1LE 3HTKA 1LTGC 2FFDB 1S1CX 3OW2O 3H1KG 1G2CA 5C39A 1ZR4A 1NYHA 4C7RA 1YBKA 3L36A 4QMAA 2KS1B 1MKMA 2R44A 3TK1A 4BWNA 3A0HE 2E74D 1DIPA 3BASA 2QJPC 1AVOA 1CZQA 4H13C 5GTHE 2E76C 3G9RA 1L0NJ 3BCCG 1OVVA 4WY4C 5CMZA 1Y8AA 1K04A 1SFCA 4AIVA 1U7MA 2O1JA 1WRGA 1NTMG 3B4SA 1K9MQ 1KYOH 3L72E 3IR9A 5APQA 3RK2B 2LXCB 3H6PA 3USSA 1ZP0C 2I1KA 3KDPB 3CD6P 1RE3C 1DEBA 5B5EH 2BEZF 1MUUA 3TGUG 3BATA 1GK6A 1M8OB 3HE4B 2KNCA 3L71D 3GG2A 1BCCE 2ZYAA 1VQ4P 4YPCA 1YQ3C 3D6ZA 3V2NA 2H43A 3VP8A 1L2PA 3RK3E 1RIEA 4C7NB 2OTLP 3H1KD 4O9BA 4UB6E 5AVZB 1ZXGA 1FOSF 2ZFCA 2B89A 3P32A 3AE8C 5KJ7D 2XZRA 1LTJC 1FZBA 4HYTB 1EDJA 1NGMB 1URQC 4DJGA 4PV1C 1SQXK 4HM3A 3BCCD 3II6A 1NTMD 3H32B 1FE6A 2R32A 1N8RQ 1BE3E 2OQQA 1X22A 1HVVA 4QDCA 4L73A 1NTKJ 1QLED 4AYCA 3TGUD 1VM9A 4IOIH 1PIXA 1JMMA 1QX8A 4PD4D 4Y99C 4C46A 4ZNCA 2C9LY 1JCCA 2HODB 1UIXA 3HD7A 1VQKP 2XV5A 1RFSA 3B5NC 1NU1J 3GL0A 1LT9A 1LTIC 2O01J 1EDKA 1H88A 2FYNB 4N78D 2KIKA 5KLVJ 3PTZA 2J59M 2FFDA 3GW6A 1S5LX 2J5UA 1KQFB 1BGYJ 2P10A 5CBNA 1NTZJ 2YO3A 1VQ5P 2D2CB 1NKZB 1L0LK 2IFMA 1S72P 1KILE 2OYHB 3M9HA 3ABVC 1A02F 1N7LA 3BRVB 1JY3O 2KS1A 2E76D 2IBZI 2Z4EA 2JKVA 4WY4D 1NYKA 3WU2H 3MGNA 1AVYA 3CCRP 1W2BO 2KI7B 3CWBJ 2NUMA 3PH0A 3L71E 2M5AA 4EOTA 1YJNP 3R4YA 1VQOP 1O7HA 3L75J 1J1DC 2JZAA 1WMKA 2W6BA 1SP4A 2XR8A 2A06G 1RE4A 3KZIE 1OVRA 3T97B 3E7KA 4GT1A 2RKLA 1PGJA 3H1KE 5AVQB 2BMRA 3LW5J 2PAJA 1Q7YQ 1JUNA 3RL0C 1KYOD 3HE4A 1SQVD 5GTIH 1JCDA 1QL2A 3VCPA 3H1IJ 2Q3IA 3LIEA 1L0NG 2QVAA 3BCCE 3H1JJ 4C7NA 1S5LH 3SWFA 3SFDC 1NTME 1JY2P 1MV8A 2OYIC 1URQD 3VYIA 3GHGC 1KQLA 2IYOA 4PV1D 1FOSE 4D6TJ 5AW7B 3N0QA 2Z5IA 2Q9IA 2BCCG 4IL6E 3TGUE 2KUBA 1NKNA 1SVFA 4NPFX 4TT3H 1M1JA 1RF1B 4PD4E 1GU5A 1VQLP 1KMIZ 4U3FG 1GL2C 3H32A 2BMQA 2N1TC 3H1HJ 1T2KC 3GF3A 2A06D 2PP6A 1USDA 2Y9YA 1QGKB 2E4PA 1EDLA 1LWUC 2KLUA 4EDFA 2DW3A 3C0DA 4N78E 3E1IA 4LC1A 1L0LG 1O7MA 3RK2C 1JEKA 3M0AA 2LR2A 1PPJG 4IFMA 5DJTB 1KB9H 3B5ND 3VMZA 1OFCX 5KAFE 3FWNA 1YJWP 2JEEA 2Y0CA 4QDFB 1J2JB 3AECC 1L0ND 3HTKB 4MN4C 1U7JA 4DT0A 4ASVA 1SQPJ 4KT0J 3GCEA 2WSCJ 4ZKPA 3A2AA 2ZT9D 1LTSC 1NTKG 2P1JA 4AAYB 4H44C 1BDDA 2BCCD 2M0BA 1SQQJ 1JNMA 4BRYB 2OYHA 1ZOYC 4EYYQ 4U3FD 1SFCB 1NU1G 2BMOA 1VF5B 1QEXA 2LKMA 5APXA 3WMM0 5KKZB 1U57A 2A45I 1VQMP 1HUCA 1KYOE 1QVGO 3CX5I 3PJSK 2HPCA 5APUA 4ZKUA 4JYBA 1RF0C 5KLVG 1EDIA 1L0LD 2NZ2A 3FXDA 2K9JA 3C1LA 1VQ8P 1PPJD 2V7QJ 1PGQA 2IFNA 5B5EE 3T97A 2E42A 2N9BA 1FZCB 1FQTA 1PP9G 2LXBA 4OGQB 3D6YA 1OMIA 2YKQA 1HWTC 1Q2NA 2V4HA 5CCHD 4W80A 1NOHA 3HUSB 3CPWO 3CCMP 1NTMK 1TU3F 1NTKD 2QM8A 2WSFH 2Q7CA 4HJLA 3MUDA 2KXPB 1GW3A 2WSCH 2K37A 2A06E 1XTGB 5APVA 3V2PA 3GZXA 1E5WA 2NPSB 1NU1D 1R8EA 2P58A 3D70A 3U1AA 1GL2D 1RF1A 1AJYA 2RH0A 3MIWA 3C8VA 2GUSA 5KLVD 1HGZA 1VQ6P 4W7YA 1L0NE 1SQBJ 1X79B 3H1JG 1G8KB 3RK2D 1PP9D 3NFQA 3AE5C 2H89C 3L70J 3JSVC 3M0DC 4XFJA 1FDIA 3GF7A 3ZDMA 1YIJP 2Q3WA 3W68A 2I7FA 3CMEP 4NBBD 2BCCE 3MD0A 4NBAD 1RQUA 1WT6A 4I7ZC 1PGOA 3L74J 1USEA 2YNYA 1ZMEC 1M7LA 1KB9D 4U3FE 1R5LA 3M91A 1T3UA 4H44D 3S1KA 1OIPA 2HMLA 3SWYA 3CCVP 1WQLA 2J58A 2H88C 4L74A 1IFMA 4NPEA 2Q1KA 2QG4A 3O8ZA 2NWFA 1M1KQ 5BVZA 1L0LE 1PPJE 1N7SB 3L73G 4BRYA 3O6QB 3WU2E 1RQVA 4R4LA 1S2EA 3RK3B 2M5AB 2JWAA 1SQXJ 3IAOA 2B9BA 1SQVK 5HL4A 3H1ID 2WQYC 2NVEA 2WVRA 4HM0A 3AE4C 1JY3N 3L37A 1Z56A 3CCLP 1L4AC 2KZIA 2B24A 3H1JD 1IO4A 1SQPG 3NTNA 1HJBA 3FXEA 2WWWA 2QIWA 2CPBA 2Q5UA 3E1RA 3CCUP 1S3JA 4TLFA 1MFZA 4D6TD 2WMMA 3AEDC 1NTKE 1NO4A 5DJUB 3AE9C 2FKWB 1FZCA 1ZLLA 2HYNA 1AQTA 2KOGA 1G1JA 2P67A 5GTIE 5BOKA 1SJGA 1KD1Q 3AEFC 3H1LJ 1DX7A 2I8DA 3HUSA 1NU1E 1FJPA 5AW6B 2QJKC 1YJ9P 2XSOA 2WPVB 1S5LE 5TJHA 2MJZA 3V4WA 5KLVE 1HJ0A 3L73D 3A7OA 1M1JB 2XDJA 2H8PD 1GTWA 1H8AA 3Q2YA 1PP9E 2NPSA 2OTJP 1LT1A 4AUWA 1EZVI 4EI2A 1BSNA 1SQPD 1KN7A 2E74B 4EMJB 1L0NK 3AZCA 3Q5RA 3VP9A 5KLIB 4RESB 1CW5A 4Z1MH 2XSHA 3L72J 1Q81Q 2E5TA 2OTKE 2VRSA 4P1BH 1OZHA 2KSJA 4LGDE 1PV3A 1KZUB 1SLQA 1KQGB 4RO0A 1KILB 3B71A 1VQNP 2IBZG 4L76A 1OW6A 1KB9E 3NXSA 2IDBA 5TISH 2FXPA 2YMYA 3EWKA 3PP5A 1FAVA 2B87A 1BCCJ 1VQ9P 1P84I 2QEXP 3G4SP 1ULIA 1SQVG 1N73B 3TYYA 2E75C 4JF7A 3IFMA 3V5BA 1JY2O 1X8YA 1AA0A 5KAIH 1DD3A 2M8RA 2FYUJ 1J1EB 2QJYB 1SQBG 1LGHB 2ZT9C 5CCGA 3H1JE 1W5CE 2DE7D 1CSBA 5L8RJ 2P2UA 2YVJB 4NBGD 4HM8A 4OH8B 4HM1A 1RHZB 1NWQA 2WITA 3S9OA 1N7SA 3V4QA 1Y47A 3KXDA 3O6QA 3I5CA 2G3AA 1L4AD 2G8YA 2HPCB 3EFGA 1KV4A 1FC2C 2A45H 1H0TB 1BE3J 3CX5H 2K9JB 2PFXA 1O7PA 4Y28J 5BU8B 1BSHA 1NTKK 1PFIA 2IBZD 3GL2A 1CI6B 2YIUC 3V2RA 4UB8H 3PHLA 1VQ7P 1NDOA 1AV1A 1OW8A 3HD7C 4OWFA 4QDDA 1NU1K 2AXTH 3D71A 3L73E 1LT9C 5CCHC 1IJDB 3FOUA 1S9KD 1VCKA 1H89A 3IN6A 1HGVA 2YFJA 1VDFA 3P8MC 5KLVK 3CXHI 2GM4A 1SQBD 2IZ0A 2O01H 1DEEG 2YMKA 5E79H 2ZYGA 2FFDC 1SQPE 5AVRB 2WZ7A 3BRTB 3CC2P 4H0LB 2GBWA 1YYCA 2YXQB 1GK4A 3RBZA 5AVWB 2W27A 4I6MC 3NMDA 3AE7C 2XKMA 1FZEA 2B88A 1KORA 2WPSA 3UIAA 2ZVNB 4P1CH 1YI2P 2HG5D 2Z5HA 1R5SA 4YXDC 1ZV8A 2B1XA 4H13B 1KC8Q 1SFCD 3CC7P 4NBCD 2E76B 3L71J 4WY4B 4GDOA 4HM7A 1Y9BA 2FY8A 3CI9A 1OWAA 3V6IA 4KHXA 4IFDK 1RE4C 2GUVA 1RF0A 5B66H 4HM5A 2FXMA 2KSEA 3H1KJ 2QA4P 3G3ZA 1UUVA 1KILA 2K3RA 1JMBA 2YKOA 3N7NA 1JOCA 2W90A 3F89A 1Q82Q 2SPZA 2A45G 2E75D 3LW5H 4WVZA 4NB8D 3CMAP 1UIIA 1LTAC 1YITP 4RKUJ 1N73A 3U1CA 2WT7B 1T6AA 2HMMA 1M57D 4HKZH 2Q3EA 1IK9A 3VMXA 1MFTA 1EQ7A 1KQSO 1IFJA 1G8JB 5CJ4A 2RN0A 1URQB 1FZAA 5KJ7A 2E4QA 4PV1B 2IBZE 5AW3B 3TGUJ 2FBWC 1G1IA 1M1JC 3PLNA 1EXIA 2AXCA 4N3YB 1N86A 2BASA 5CBOA 3CLQA 1SQVE 1H0TA 1Q86Q 2IPPA 2IYPA 1BGYG 1S9KE 1NTZG 3EQ2A 1QL1A 2FYUG 5AW9B 1CI6A 3HD7D 2JR8A 1D7MA 4Y99B 4ASWA 1XTCC 3CX5D 3L35A 1IFPA 3B5NB 3AE1C 4NBDD 2L91A 4K35A 2OYOA 3CWBG 4DCKA 1SQPK 2JP3A 3IF4A 4GOFA 2W8ZA 2FYNC 4CPGA 4PJ0H 3MZWB 3L75G 1K8AQ 2E43A 2NVFA 1M90Q 2CPSA 1ULJA 2N9YB 2ZXXA 3ITKA 2D2CC 2GA1A 2WSSH 4EIJA 1SQQK 1GU4A 2XRXA 2YXRB 3GB4A 2OYHC 3A0BH 3MP7B 5AEWA 5CJ0A 2FXOA 3H1IG 2K88A 3HE5A 2JO1A 1BGYD 1YTZI 4WY4A 1NTZD 2I1JA 2NRGA 2WSEJ 4YXWH 2KB7P 2FYUD 2H7HA 3AEAC 1J1DB 1QVFO 3AEBC 1VQPP 2C0XA 1IC2A 2B87B 5TISE 4D6TG 1RE3A 2KLVA 2V7QH 1W2EA 1IK7A 4JQ0D 2R5BA 2W6AA 5APTA 3RL0B 1P84H 1DD4A 2YO2A 3CWBD 3M06A 2R3SA 1HH0A 1NAYA 2NVGA 3L75D 3WUUA 5KAIE 3H1HG 5CXMA 4ZMDA 2WT7A 2O1KA 4WBAA 3Q5SA 3P8CD 3G6EP 3MTUE 4I1LA 1KTMA 1JY2N 3MUDC 4B86A 1GW4A 4HM2A 1FDOA 2OYIB 2L5GB 3C9IA 4HM4A 2AEFA 1FS0E 1JM0A 2QPZA 3GHGB 1LTJA 1NAFA 4H0LC 2FYZA 2E5YA 1OX3A 1URQA 4HB1A 2HMJA 3VMAA 4LLHA 5KTBA 2WTYA 3QWOC 4JYCA 1RF1C 2W83C 5AW1B 3A5TA 3RL0g 3CX5E 3Q1MA 2IZ1A 1GL2B 4WWIA 1RH5B 2N1TB 3JCUH 2HFED 4NBED 1PGPA 1SQBK 3V2QA 4NBFD 3AE2C 1DH3A 4UB8E 1LWUB 5AW5B 2P7JA 4N6JA 1KILD 2WSEH 3VOPA 3CCSP 4HJGH 1SQQG 1EZVG 3TNUA 1Q90C 4R4MA 3DQYA 4YTPC 2DE6D 3M9QA 2AXTE 3L4FA 3SFEC 3OJAB 1GD2E 2BCCJ 3B5NA 3H1HD 2OGUA 1EG9A 4W7ZA 2QSIA 2JJLA 3CXHH 1NJIQ 4U3FJ 5E79E 4QCKA 1SS1A 2QE7H 4GOEA 1AFOA 2MKVA 3AEEC 2D2CD 4QURA 3VTPC 3PRJA 4H44B 3RBXA 1BGYE 1NTZE 5AVVB 3F5HA 3GTEA 2FYUE 1L0LJ 2R5DA 2YFIA 3EQQA 4JPZB 3I55P 5AW2B 1S4XA 3OAKA 4HH2A 1NVOA 1SFCC 3GKEA 1E79H 1VF5C 5EFWB 2HLOA 5KKZC 1AQ5A 4PD4I 1GZLA 3P7KA 2Y9ZA 3CWBE 2OARA 1FZFA 4HM6A 5B66E 1SQQD 1EZVD 3L75E 1PZQA 1LTBC 3P8CE 1JTHB 5H2FH 1X9VA 1FZCC 4OGQC 1T8ZA 1ZRTD 1JB0J 3HUSC 5AEUA 1X0TA 3BVHA 5M1BA 3U59A 3VN0A 1EC5A 5CCHA 3H1IE 1PL5A 1VPCA 3EN1A 1M56D 3TF5A 1ZW0A 1P84D 4H0LD 3AEGC 3L70G 5AVXB 1LTTC 1IFDA 5APYA 2OYIA 3I56P 2YFLA 3GHGA 3WUTA 1PP9J 4D6TE 3A3YB 3AE6C 2NPSC 2JWDA 1YTZT 1EXJA 1FU1A 3A0HH 4H13D 4M3LA 3L74G 4QUPA 3KYQA 2KYVA 5GTHH 1MZ9A 4DZOA 3Q3DA 3OA7A 1IFIA 1GL2A 2N1TA 2UWJE 3H1HE 4JBZA 1LP1B 1KYOI 4DOJA 3N4XA 1Q90D 1OW7A 2ZXEB 1LWUA 1LNQA 2XNXA 1BDCA 1JO5A 3SWKA 2POHA 3GLMA 2QRXA 3B8EB 1SQXG 4AQRD 4I7ZB 2HMOA 5AW0B 3CC4P 2ZYDA 3GTSA 4PJ0E 1NTZK 3L70D 2FYUK 4UB6H 5CCGC 3VMID 2Y0EA 5K5GB 3CXHD 3A0BE 5AVTB 2QJPB 1SQQE 1EZVE 2PGDA 1ZN5A 1N7SC 3L74D 3CCQP 1VF5D 3HE5B 4IFFA 1ZR2A 3RK3C 3H1LG 2W6JH 2O01N 1IZNB 1L4AB 2KP8A 1JY3P 1ZRTE 3WUVA 2JO6A 4KJMA 1K73Q 3AE3C 3GMAA 2K9YA 2C0WA 4GKGA 4OVNF 2AEJA 2PRRA 1YQ4C 2NUKA 3KQGA 1JM1A 4OGQD 1GMJA 1IFNA 1JTHA 2K1AA 1SQXD 4HKVA 1P84E 1YHQP 3R2PA 4U7JA 5AVYB 3CCEP 1UUWA 3FWLA 3L73J 3KHUA 2HMKA 2HODA 3BCCJ 1O7WA 4NBHD 3K5BA 2WSFJ 1FDMA 1NTMJ 3L72G 2QJKB 1RY3A 5APSA 3KPEA 1GDTA 1LTJB 5AVSB 4GIFA 1O7GA 3VCAA 2R3CA 1G2CB 3FGAD 4GODA 4NB9D 3M9BA 5CHXA 2NPSD 1KFMA 2C9NY 3CCJP 1BCCG 3VMGD 3H1LD 3GZYA 4K3AA 1LJ2A 1HF9A 4IL6X 1VL2A 2ZJSE 1NH4A 3W67A 1T3JA 1KFNA 2E74C 1NHLA 2WPQA 3JCUE 5KLIC 1O7NA 4L75A 3H25A 3TNUB 3D89A 1K05A 1SQBE 4A7PA 1HTLC 1LP1A 1FBMA 2Q6QA 1KILC 2JDIH 3KZIH 5APWA 3L70E 3M0DA 3QH9A 2KNCB 2XNDH 2WPRA 2HMNA 3RL0D 2YKPA 4I2LC 2E75B 3L72D 1N73C 1BE3G 3HRNA 2XU6A 3CXHE 5AW4B 2AEMA 1N2DC 3L74E 2DE5D 1OXZA 2M3BA 5CCGD 2ZAEB 3JC22 2O3JA 2ZT9B 1J1EC 2QJYC 1FJKA 5AW8B
chains in the Genus database with same CATH topology
4P1CH 2XSOA 4NBAD 2HMOA 3H1JE 3C0DA 1O7HA 1O7MA 2DE7D 1O7GA 1SQVE 1Q90C 2JZAA 3GTSA 2E74D 4QUQA 3VCAA 2B1XA 1BE3E 2YVJB 4NBGD 4HM8A 2QJPC 4HM1A 5KLVE 2XR8A 3DQYA 3VMHD 2DE6D 4NBCD 4U3FE 4NBBD 4NB9D 5AEUA 4H44D 3H1KE 4QDCA 2BMRA 4QDFB 2HMLA 4AIVA 3H1IE 1WQLA 3VMID 1VM9A 4HM7A 2GBXA 3VMGD 1EG9A 1SQXE 3L72E 3EN1A 1PP9E 3GZYA 4HJLA 2CKFA 3GCEA 2NWFA 2NVGA 1O7PA 4H0LD 1L0LE 4QCKA 4HM5A 1SQQE 1EZVE 4EMJB 1PPJE 2YFLA 3AZCA 3VCPA 1UUVA 1VF5D 1RFSA 2A06E 2D2CD 5CXMA 3GL2A 4QURA 2XSHA 2ZT9D 4NBDD 1O7NA 5KLIC 2ZYLA 3GZXA 3GL0A 3BCCE 2YIUC 4D6TE 1BGYE 4AAYB 5HL4A 2NVEA 1NTZE 4HM0A 4P1BH 1NDOA 2E75D 4NB8D 3GTEA 2FYUE 3D89A 1NTME 2B24A 1SQBE 1BCCE 1ZRTE 2JO6A 2YFIA 4HM2A 2FYNC 4HM4A 3EQQA 4H13D 2NVFA 2QPZA 4QUPA 4QDDA 4PV1D 2HMMA 1KB9E 3L70E 1RIEA 1ULJA 3L73E 2BMOA 3GOBA 3FOUA 3GKEA 2NUKA 3N0QA 1JM1A 1VCKA 3H1HE 2HMJA 4OGQD 1L0NE 3TGUE 2HMNA 5KKZC 2YFJA 4QDFA 1NTKE 1G8KB 3H1LE 2XRXA 1ULIA 3GB4A 3CWBE 4PD4E 1KYOE 4HKVA 1P84E 3CXHE 1UUWA 1G8JB 3CX5E 4HM6A 1SQPE 2E76D 5BOKA 3L75E 3L74E 1SJGA 5AEWA 2BMQA 2E4QA 1NYKA 2DE5D 2IBZE 2GBWA 2HMKA 4NBED 1O7WA 4NBHD 4HM3A 4NBFD 1NU1E 2NUMA 2Q3WA 2E4PA 1FQTA 3L71E 2QJYC 2I7FA 2QJKC 2BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1C H;  2XSO A;  4NBA D;  2HMO A;  3H1J E;  3C0D A;  1O7H A;  1O7M A;  2DE7 D;  1O7G A;  1SQV E;  1Q90 C;  2JZA A;  3GTS A;  2E74 D;  4QUQ A;  3VCA A;  2B1X A;  1BE3 E;  2YVJ B;  4NBG D;  4HM8 A;  2QJP C;  4HM1 A;  5KLV E;  2XR8 A;  3DQY A;  3VMH D;  2DE6 D;  4NBC D;  4U3F E;  4NBB D;  4NB9 D;  5AEU A;  4H44 D;  3H1K E;  4QDC A;  2BMR A;  4QDF B;  2HML A;  4AIV A;  3H1I E;  1WQL A;  3VMI D;  1VM9 A;  4HM7 A;  2GBX A;  3VMG D;  1EG9 A;  1SQX E;  3L72 E;  3EN1 A;  1PP9 E;  3GZY A;  4HJL A;  2CKF A;  3GCE A;  2NWF A;  2NVG A;  1O7P A;  4H0L D;  1L0L E;  4QCK A;  4HM5 A;  1SQQ E;  1EZV E;  4EMJ B;  1PPJ E;  2YFL A;  3AZC A;  3VCP A;  1UUV A;  1VF5 D;  1RFS A;  2A06 E;  2D2C D;  5CXM A;  3GL2 A;  4QUR A;  2XSH A;  2ZT9 D;  4NBD D;  1O7N A;  5KLI C;  2ZYL A;  3GZX A;  3GL0 A;  3BCC E;  2YIU C;  4D6T E;  1BGY E;  4AAY B;  5HL4 A;  2NVE A;  1NTZ E;  4HM0 A;  4P1B H;  1NDO A;  2E75 D;  4NB8 D;  3GTE A;  2FYU E;  3D89 A;  1NTM E;  2B24 A;  1SQB E;  1BCC E;  1ZRT E;  2JO6 A;  2YFI A;  4HM2 A;  2FYN C;  4HM4 A;  3EQQ A;  4H13 D;  2NVF A;  2QPZ A;  4QUP A;  4QDD A;  4PV1 D;  2HMM A;  1KB9 E;  3L70 E;  1RIE A;  1ULJ A;  3L73 E;  2BMO A;  3GOB A;  3FOU A;  3GKE A;  2NUK A;  3N0Q A;  1JM1 A;  1VCK A;  3H1H E;  2HMJ A;  4OGQ D;  1L0N E;  3TGU E;  2HMN A;  5KKZ C;  2YFJ A;  4QDF A;  1NTK E;  1G8K B;  3H1L E;  2XRX A;  1ULI A;  3GB4 A;  3CWB E;  4PD4 E;  1KYO E;  4HKV A;  1P84 E;  3CXH E;  1UUW A;  1G8J B;  3CX5 E;  4HM6 A;  1SQP E;  2E76 D;  5BOK A;  3L75 E;  3L74 E;  1SJG A;  5AEW A;  2BMQ A;  2E4Q A;  1NYK A;  2DE5 D;  2IBZ E;  2GBW A;  2HMK A;  4NBE D;  1O7W A;  4NBH D;  4HM3 A;  4NBF D;  1NU1 E;  2NUM A;  2Q3W A;  2E4P A;  1FQT A;  3L71 E;  2QJY C;  2I7F A;  2QJK C;  2BCC E; 
#chains in the Genus database with same CATH topology
 2M3E A;  3TSI A;  1BCC D;  1FZG A;  5KJ7 C;  2HR3 A;  4QUQ A;  1N7S D;  4WB4 A;  2KZJ A;  2Y0D A;  3VMH D;  3RK3 D;  4XA4 A;  1OVU A;  1A02 J;  3VMY A;  4IL6 H;  3S4R A;  2GBX A;  5BU5 A;  3MHV A;  1SQV J;  3TDK A;  1SQX E;  4PD4 H;  2CKF A;  3G71 P;  2KK7 A;  1L4A A;  2N1T D;  1T2K D;  1HBW A;  4RJT A;  3SSU A;  4NPD A;  3Q5P A;  2ZYL A;  2CK3 H;  3RGU A;  4BXL A;  2YIU B;  5H2F E;  3EFF K;  3LID A;  2IX7 C;  3HD7 B;  2BEQ D;  4XE5 B;  2ZVO B;  3CL3 D;  1KB9 I;  1BE3 D;  3FX0 A;  5AVU B;  2ITA A;  5KAF H;  1LT9 B;  2RMZ A;  3GOB A;  3L71 G;  2QM7 A;  4QDF A;  3H1L E;  3HTK A;  1LTG C;  2FFD B;  1S1C X;  3OW2 O;  3H1K G;  1G2C A;  5C39 A;  1ZR4 A;  1NYH A;  4C7R A;  1YBK A;  3L36 A;  4QMA A;  2KS1 B;  1MKM A;  2R44 A;  3TK1 A;  4BWN A;  3A0H E;  2E74 D;  1DIP A;  3BAS A;  2QJP C;  1AVO A;  1CZQ A;  4H13 C;  5GTH E;  2E76 C;  3G9R A;  1L0N J;  3BCC G;  1OVV A;  4WY4 C;  5CMZ A;  1Y8A A;  1K04 A;  1SFC A;  4AIV A;  1U7M A;  2O1J A;  1WRG A;  1NTM G;  3B4S A;  1K9M Q;  1KYO H;  3L72 E;  3IR9 A;  5APQ A;  3RK2 B;  2LXC B;  3H6P A;  3USS A;  1ZP0 C;  2I1K A;  3KDP B;  3CD6 P;  1RE3 C;  1DEB A;  5B5E H;  2BEZ F;  1MUU A;  3TGU G;  3BAT A;  1GK6 A;  1M8O B;  3HE4 B;  2KNC A;  3L71 D;  3GG2 A;  1BCC E;  2ZYA A;  1VQ4 P;  4YPC A;  1YQ3 C;  3D6Z A;  3V2N A;  2H43 A;  3VP8 A;  1L2P A;  3RK3 E;  1RIE A;  4C7N B;  2OTL P;  3H1K D;  4O9B A;  4UB6 E;  5AVZ B;  1ZXG A;  1FOS F;  2ZFC A;  2B89 A;  3P32 A;  3AE8 C;  5KJ7 D;  2XZR A;  1LTJ C;  1FZB A;  4HYT B;  1EDJ A;  1NGM B;  1URQ C;  4DJG A;  4PV1 C;  1SQX K;  4HM3 A;  3BCC D;  3II6 A;  1NTM D;  3H32 B;  1FE6 A;  2R32 A;  1N8R Q;  1BE3 E;  2OQQ A;  1X22 A;  1HVV A;  4QDC A;  4L73 A;  1NTK J;  1QLE D;  4AYC A;  3TGU D;  1VM9 A;  4IOI H;  1PIX A;  1JMM A;  1QX8 A;  4PD4 D;  4Y99 C;  4C46 A;  4ZNC A;  2C9L Y;  1JCC A;  2HOD B;  1UIX A;  3HD7 A;  1VQK P;  2XV5 A;  1RFS A;  3B5N C;  1NU1 J;  3GL0 A;  1LT9 A;  1LTI C;  2O01 J;  1EDK A;  1H88 A;  2FYN B;  4N78 D;  2KIK A;  5KLV J;  3PTZ A;  2J59 M;  2FFD A;  3GW6 A;  1S5L X;  2J5U A;  1KQF B;  1BGY J;  2P10 A;  5CBN A;  1NTZ J;  2YO3 A;  1VQ5 P;  2D2C B;  1NKZ B;  1L0L K;  2IFM A;  1S72 P;  1KIL E;  2OYH B;  3M9H A;  3ABV C;  1A02 F;  1N7L A;  3BRV B;  1JY3 O;  2KS1 A;  2E76 D;  2IBZ I;  2Z4E A;  2JKV A;  4WY4 D;  1NYK A;  3WU2 H;  3MGN A;  1AVY A;  3CCR P;  1W2B O;  2KI7 B;  3CWB J;  2NUM A;  3PH0 A;  3L71 E;  2M5A A;  4EOT A;  1YJN P;  3R4Y A;  1VQO P;  1O7H A;  3L75 J;  1J1D C;  2JZA A;  1WMK A;  2W6B A;  1SP4 A;  2XR8 A;  2A06 G;  1RE4 A;  3KZI E;  1OVR A;  3T97 B;  3E7K A;  4GT1 A;  2RKL A;  1PGJ A;  3H1K E;  5AVQ B;  2BMR A;  3LW5 J;  2PAJ A;  1Q7Y Q;  1JUN A;  3RL0 C;  1KYO D;  3HE4 A;  1SQV D;  5GTI H;  1JCD A;  1QL2 A;  3VCP A;  3H1I J;  2Q3I A;  3LIE A;  1L0N G;  2QVA A;  3BCC E;  3H1J J;  4C7N A;  1S5L H;  3SWF A;  3SFD C;  1NTM E;  1JY2 P;  1MV8 A;  2OYI C;  1URQ D;  3VYI A;  3GHG C;  1KQL A;  2IYO A;  4PV1 D;  1FOS E;  4D6T J;  5AW7 B;  3N0Q A;  2Z5I A;  2Q9I A;  2BCC G;  4IL6 E;  3TGU E;  2KUB A;  1NKN A;  1SVF A;  4NPF X;  4TT3 H;  1M1J A;  1RF1 B;  4PD4 E;  1GU5 A;  1VQL P;  1KMI Z;  4U3F G;  1GL2 C;  3H32 A;  2BMQ A;  2N1T C;  3H1H J;  1T2K C;  3GF3 A;  2A06 D;  2PP6 A;  1USD A;  2Y9Y A;  1QGK B;  2E4P A;  1EDL A;  1LWU C;  2KLU A;  4EDF A;  2DW3 A;  3C0D A;  4N78 E;  3E1I A;  4LC1 A;  1L0L G;  1O7M A;  3RK2 C;  1JEK A;  3M0A A;  2LR2 A;  1PPJ G;  4IFM A;  5DJT B;  1KB9 H;  3B5N D;  3VMZ A;  1OFC X;  5KAF E;  3FWN A;  1YJW P;  2JEE A;  2Y0C A;  4QDF B;  1J2J B;  3AEC C;  1L0N D;  3HTK B;  4MN4 C;  1U7J A;  4DT0 A;  4ASV A;  1SQP J;  4KT0 J;  3GCE A;  2WSC J;  4ZKP A;  3A2A A;  2ZT9 D;  1LTS C;  1NTK G;  2P1J A;  4AAY B;  4H44 C;  1BDD A;  2BCC D;  2M0B A;  1SQQ J;  1JNM A;  4BRY B;  2OYH A;  1ZOY C;  4EYY Q;  4U3F D;  1SFC B;  1NU1 G;  2BMO A;  1VF5 B;  1QEX A;  2LKM A;  5APX A;  3WMM 0;  5KKZ B;  1U57 A;  2A45 I;  1VQM P;  1HUC A;  1KYO E;  1QVG O;  3CX5 I;  3PJS K;  2HPC A;  5APU A;  4ZKU A;  4JYB A;  1RF0 C;  5KLV G;  1EDI A;  1L0L D;  2NZ2 A;  3FXD A;  2K9J A;  3C1L A;  1VQ8 P;  1PPJ D;  2V7Q J;  1PGQ A;  2IFN A;  5B5E E;  3T97 A;  2E42 A;  2N9B A;  1FZC B;  1FQT A;  1PP9 G;  2LXB A;  4OGQ B;  3D6Y A;  1OMI A;  2YKQ A;  1HWT C;  1Q2N A;  2V4H A;  5CCH D;  4W80 A;  1NOH A;  3HUS B;  3CPW O;  3CCM P;  1NTM K;  1TU3 F;  1NTK D;  2QM8 A;  2WSF H;  2Q7C A;  4HJL A;  3MUD A;  2KXP B;  1GW3 A;  2WSC H;  2K37 A;  2A06 E;  1XTG B;  5APV A;  3V2P A;  3GZX A;  1E5W A;  2NPS B;  1NU1 D;  1R8E A;  2P58 A;  3D70 A;  3U1A A;  1GL2 D;  1RF1 A;  1AJY A;  2RH0 A;  3MIW A;  3C8V A;  2GUS A;  5KLV D;  1HGZ A;  1VQ6 P;  4W7Y A;  1L0N E;  1SQB J;  1X79 B;  3H1J G;  1G8K B;  3RK2 D;  1PP9 D;  3NFQ A;  3AE5 C;  2H89 C;  3L70 J;  3JSV C;  3M0D C;  4XFJ A;  1FDI A;  3GF7 A;  3ZDM A;  1YIJ P;  2Q3W A;  3W68 A;  2I7F A;  3CME P;  4NBB D;  2BCC E;  3MD0 A;  4NBA D;  1RQU A;  1WT6 A;  4I7Z C;  1PGO A;  3L74 J;  1USE A;  2YNY A;  1ZME C;  1M7L A;  1KB9 D;  4U3F E;  1R5L A;  3M91 A;  1T3U A;  4H44 D;  3S1K A;  1OIP A;  2HML A;  3SWY A;  3CCV P;  1WQL A;  2J58 A;  2H88 C;  4L74 A;  1IFM A;  4NPE A;  2Q1K A;  2QG4 A;  3O8Z A;  2NWF A;  1M1K Q;  5BVZ A;  1L0L E;  1PPJ E;  1N7S B;  3L73 G;  4BRY A;  3O6Q B;  3WU2 E;  1RQV A;  4R4L A;  1S2E A;  3RK3 B;  2M5A B;  2JWA A;  1SQX J;  3IAO A;  2B9B A;  1SQV K;  5HL4 A;  3H1I D;  2WQY C;  2NVE A;  2WVR A;  4HM0 A;  3AE4 C;  1JY3 N;  3L37 A;  1Z56 A;  3CCL P;  1L4A C;  2KZI A;  2B24 A;  3H1J D;  1IO4 A;  1SQP G;  3NTN A;  1HJB A;  3FXE A;  2WWW A;  2QIW A;  2CPB A;  2Q5U A;  3E1R A;  3CCU P;  1S3J A;  4TLF A;  1MFZ A;  4D6T D;  2WMM A;  3AED C;  1NTK E;  1NO4 A;  5DJU B;  3AE9 C;  2FKW B;  1FZC A;  1ZLL A;  2HYN A;  1AQT A;  2KOG A;  1G1J A;  2P67 A;  5GTI E;  5BOK A;  1SJG A;  1KD1 Q;  3AEF C;  3H1L J;  1DX7 A;  2I8D A;  3HUS A;  1NU1 E;  1FJP A;  5AW6 B;  2QJK C;  1YJ9 P;  2XSO A;  2WPV B;  1S5L E;  5TJH A;  2MJZ A;  3V4W A;  5KLV E;  1HJ0 A;  3L73 D;  3A7O A;  1M1J B;  2XDJ A;  2H8P D;  1GTW A;  1H8A A;  3Q2Y A;  1PP9 E;  2NPS A;  2OTJ P;  1LT1 A;  4AUW A;  1EZV I;  4EI2 A;  1BSN A;  1SQP D;  1KN7 A;  2E74 B;  4EMJ B;  1L0N K;  3AZC A;  3Q5R A;  3VP9 A;  5KLI B;  4RES B;  1CW5 A;  4Z1M H;  2XSH A;  3L72 J;  1Q81 Q;  2E5T A;  2OTK E;  2VRS A;  4P1B H;  1OZH A;  2KSJ A;  4LGD E;  1PV3 A;  1KZU B;  1SLQ A;  1KQG B;  4RO0 A;  1KIL B;  3B71 A;  1VQN P;  2IBZ G;  4L76 A;  1OW6 A;  1KB9 E;  3NXS A;  2IDB A;  5TIS H;  2FXP A;  2YMY A;  3EWK A;  3PP5 A;  1FAV A;  2B87 A;  1BCC J;  1VQ9 P;  1P84 I;  2QEX P;  3G4S P;  1ULI A;  1SQV G;  1N73 B;  3TYY A;  2E75 C;  4JF7 A;  3IFM A;  3V5B A;  1JY2 O;  1X8Y A;  1AA0 A;  5KAI H;  1DD3 A;  2M8R A;  2FYU J;  1J1E B;  2QJY B;  1SQB G;  1LGH B;  2ZT9 C;  5CCG A;  3H1J E;  1W5C E;  2DE7 D;  1CSB A;  5L8R J;  2P2U A;  2YVJ B;  4NBG D;  4HM8 A;  4OH8 B;  4HM1 A;  1RHZ B;  1NWQ A;  2WIT A;  3S9O A;  1N7S A;  3V4Q A;  1Y47 A;  3KXD A;  3O6Q A;  3I5C A;  2G3A A;  1L4A D;  2G8Y A;  2HPC B;  3EFG A;  1KV4 A;  1FC2 C;  2A45 H;  1H0T B;  1BE3 J;  3CX5 H;  2K9J B;  2PFX A;  1O7P A;  4Y28 J;  5BU8 B;  1BSH A;  1NTK K;  1PFI A;  2IBZ D;  3GL2 A;  1CI6 B;  2YIU C;  3V2R A;  4UB8 H;  3PHL A;  1VQ7 P;  1NDO A;  1AV1 A;  1OW8 A;  3HD7 C;  4OWF A;  4QDD A;  1NU1 K;  2AXT H;  3D71 A;  3L73 E;  1LT9 C;  5CCH C;  1IJD B;  3FOU A;  1S9K D;  1VCK A;  1H89 A;  3IN6 A;  1HGV A;  2YFJ A;  1VDF A;  3P8M C;  5KLV K;  3CXH I;  2GM4 A;  1SQB D;  2IZ0 A;  2O01 H;  1DEE G;  2YMK A;  5E79 H;  2ZYG A;  2FFD C;  1SQP E;  5AVR B;  2WZ7 A;  3BRT B;  3CC2 P;  4H0L B;  2GBW A;  1YYC A;  2YXQ B;  1GK4 A;  3RBZ A;  5AVW B;  2W27 A;  4I6M C;  3NMD A;  3AE7 C;  2XKM A;  1FZE A;  2B88 A;  1KOR A;  2WPS A;  3UIA A;  2ZVN B;  4P1C H;  1YI2 P;  2HG5 D;  2Z5H A;  1R5S A;  4YXD C;  1ZV8 A;  2B1X A;  4H13 B;  1KC8 Q;  1SFC D;  3CC7 P;  4NBC D;  2E76 B;  3L71 J;  4WY4 B;  4GDO A;  4HM7 A;  1Y9B A;  2FY8 A;  3CI9 A;  1OWA A;  3V6I A;  4KHX A;  4IFD K;  1RE4 C;  2GUV A;  1RF0 A;  5B66 H;  4HM5 A;  2FXM A;  2KSE A;  3H1K J;  2QA4 P;  3G3Z A;  1UUV A;  1KIL A;  2K3R A;  1JMB A;  2YKO A;  3N7N A;  1JOC A;  2W90 A;  3F89 A;  1Q82 Q;  2SPZ A;  2A45 G;  2E75 D;  3LW5 H;  4WVZ A;  4NB8 D;  3CMA P;  1UII A;  1LTA C;  1YIT P;  4RKU J;  1N73 A;  3U1C A;  2WT7 B;  1T6A A;  2HMM A;  1M57 D;  4HKZ H;  2Q3E A;  1IK9 A;  3VMX A;  1MFT A;  1EQ7 A;  1KQS O;  1IFJ A;  1G8J B;  5CJ4 A;  2RN0 A;  1URQ B;  1FZA A;  5KJ7 A;  2E4Q A;  4PV1 B;  2IBZ E;  5AW3 B;  3TGU J;  2FBW C;  1G1I A;  1M1J C;  3PLN A;  1EXI A;  2AXC A;  4N3Y B;  1N86 A;  2BAS A;  5CBO A;  3CLQ A;  1SQV E;  1H0T A;  1Q86 Q;  2IPP A;  2IYP A;  1BGY G;  1S9K E;  1NTZ G;  3EQ2 A;  1QL1 A;  2FYU G;  5AW9 B;  1CI6 A;  3HD7 D;  2JR8 A;  1D7M A;  4Y99 B;  4ASW A;  1XTC C;  3CX5 D;  3L35 A;  1IFP A;  3B5N B;  3AE1 C;  4NBD D;  2L91 A;  4K35 A;  2OYO A;  3CWB G;  4DCK A;  1SQP K;  2JP3 A;  3IF4 A;  4GOF A;  2W8Z A;  2FYN C;  4CPG A;  4PJ0 H;  3MZW B;  3L75 G;  1K8A Q;  2E43 A;  2NVF A;  1M90 Q;  2CPS A;  1ULJ A;  2N9Y B;  2ZXX A;  3ITK A;  2D2C C;  2GA1 A;  2WSS H;  4EIJ A;  1SQQ K;  1GU4 A;  2XRX A;  2YXR B;  3GB4 A;  2OYH C;  3A0B H;  3MP7 B;  5AEW A;  5CJ0 A;  2FXO A;  3H1I G;  2K88 A;  3HE5 A;  2JO1 A;  1BGY D;  1YTZ I;  4WY4 A;  1NTZ D;  2I1J A;  2NRG A;  2WSE J;  4YXW H;  2KB7 P;  2FYU D;  2H7H A;  3AEA C;  1J1D B;  1QVF O;  3AEB C;  1VQP P;  2C0X A;  1IC2 A;  2B87 B;  5TIS E;  4D6T G;  1RE3 A;  2KLV A;  2V7Q H;  1W2E A;  1IK7 A;  4JQ0 D;  2R5B A;  2W6A A;  5APT A;  3RL0 B;  1P84 H;  1DD4 A;  2YO2 A;  3CWB D;  3M06 A;  2R3S A;  1HH0 A;  1NAY A;  2NVG A;  3L75 D;  3WUU A;  5KAI E;  3H1H G;  5CXM A;  4ZMD A;  2WT7 A;  2O1K A;  4WBA A;  3Q5S A;  3P8C D;  3G6E P;  3MTU E;  4I1L A;  1KTM A;  1JY2 N;  3MUD C;  4B86 A;  1GW4 A;  4HM2 A;  1FDO A;  2OYI B;  2L5G B;  3C9I A;  4HM4 A;  2AEF A;  1FS0 E;  1JM0 A;  2QPZ A;  3GHG B;  1LTJ A;  1NAF A;  4H0L C;  2FYZ A;  2E5Y A;  1OX3 A;  1URQ A;  4HB1 A;  2HMJ A;  3VMA A;  4LLH A;  5KTB A;  2WTY A;  3QWO C;  4JYC A;  1RF1 C;  2W83 C;  5AW1 B;  3A5T A;  3RL0 g;  3CX5 E;  3Q1M A;  2IZ1 A;  1GL2 B;  4WWI A;  1RH5 B;  2N1T B;  3JCU H;  2HFE D;  4NBE D;  1PGP A;  1SQB K;  3V2Q A;  4NBF D;  3AE2 C;  1DH3 A;  4UB8 E;  1LWU B;  5AW5 B;  2P7J A;  4N6J A;  1KIL D;  2WSE H;  3VOP A;  3CCS P;  4HJG H;  1SQQ G;  1EZV G;  3TNU A;  1Q90 C;  4R4M A;  3DQY A;  4YTP C;  2DE6 D;  3M9Q A;  2AXT E;  3L4F A;  3SFE C;  3OJA B;  1GD2 E;  2BCC J;  3B5N A;  3H1H D;  2OGU A;  1EG9 A;  4W7Z A;  2QSI A;  2JJL A;  3CXH H;  1NJI Q;  4U3F J;  5E79 E;  4QCK A;  1SS1 A;  2QE7 H;  4GOE A;  1AFO A;  2MKV A;  3AEE C;  2D2C D;  4QUR A;  3VTP C;  3PRJ A;  4H44 B;  3RBX A;  1BGY E;  1NTZ E;  5AVV B;  3F5H A;  3GTE A;  2FYU E;  1L0L J;  2R5D A;  2YFI A;  3EQQ A;  4JPZ B;  3I55 P;  5AW2 B;  1S4X A;  3OAK A;  4HH2 A;  1NVO A;  1SFC C;  3GKE A;  1E79 H;  1VF5 C;  5EFW B;  2HLO A;  5KKZ C;  1AQ5 A;  4PD4 I;  1GZL A;  3P7K A;  2Y9Z A;  3CWB E;  2OAR A;  1FZF A;  4HM6 A;  5B66 E;  1SQQ D;  1EZV D;  3L75 E;  1PZQ A;  1LTB C;  3P8C E;  1JTH B;  5H2F H;  1X9V A;  1FZC C;  4OGQ C;  1T8Z A;  1ZRT D;  1JB0 J;  3HUS C;  5AEU A;  1X0T A;  3BVH A;  5M1B A;  3U59 A;  3VN0 A;  1EC5 A;  5CCH A;  3H1I E;  1PL5 A;  1VPC A;  3EN1 A;  1M56 D;  3TF5 A;  1ZW0 A;  1P84 D;  4H0L D;  3AEG C;  3L70 G;  5AVX B;  1LTT C;  1IFD A;  5APY A;  2OYI A;  3I56 P;  2YFL A;  3GHG A;  3WUT A;  1PP9 J;  4D6T E;  3A3Y B;  3AE6 C;  2NPS C;  2JWD A;  1YTZ T;  1EXJ A;  1FU1 A;  3A0H H;  4H13 D;  4M3L A;  3L74 G;  4QUP A;  3KYQ A;  2KYV A;  5GTH H;  1MZ9 A;  4DZO A;  3Q3D A;  3OA7 A;  1IFI A;  1GL2 A;  2N1T A;  2UWJ E;  3H1H E;  4JBZ A;  1LP1 B;  1KYO I;  4DOJ A;  3N4X A;  1Q90 D;  1OW7 A;  2ZXE B;  1LWU A;  1LNQ A;  2XNX A;  1BDC A;  1JO5 A;  3SWK A;  2POH A;  3GLM A;  2QRX A;  3B8E B;  1SQX G;  4AQR D;  4I7Z B;  2HMO A;  5AW0 B;  3CC4 P;  2ZYD A;  3GTS A;  4PJ0 E;  1NTZ K;  3L70 D;  2FYU K;  4UB6 H;  5CCG C;  3VMI D;  2Y0E A;  5K5G B;  3CXH D;  3A0B E;  5AVT B;  2QJP B;  1SQQ E;  1EZV E;  2PGD A;  1ZN5 A;  1N7S C;  3L74 D;  3CCQ P;  1VF5 D;  3HE5 B;  4IFF A;  1ZR2 A;  3RK3 C;  3H1L G;  2W6J H;  2O01 N;  1IZN B;  1L4A B;  2KP8 A;  1JY3 P;  1ZRT E;  3WUV A;  2JO6 A;  4KJM A;  1K73 Q;  3AE3 C;  3GMA A;  2K9Y A;  2C0W A;  4GKG A;  4OVN F;  2AEJ A;  2PRR A;  1YQ4 C;  2NUK A;  3KQG A;  1JM1 A;  4OGQ D;  1GMJ A;  1IFN A;  1JTH A;  2K1A A;  1SQX D;  4HKV A;  1P84 E;  1YHQ P;  3R2P A;  4U7J A;  5AVY B;  3CCE P;  1UUW A;  3FWL A;  3L73 J;  3KHU A;  2HMK A;  2HOD A;  3BCC J;  1O7W A;  4NBH D;  3K5B A;  2WSF J;  1FDM A;  1NTM J;  3L72 G;  2QJK B;  1RY3 A;  5APS A;  3KPE A;  1GDT A;  1LTJ B;  5AVS B;  4GIF A;  1O7G A;  3VCA A;  2R3C A;  1G2C B;  3FGA D;  4GOD A;  4NB9 D;  3M9B A;  5CHX A;  2NPS D;  1KFM A;  2C9N Y;  3CCJ P;  1BCC G;  3VMG D;  3H1L D;  3GZY A;  4K3A A;  1LJ2 A;  1HF9 A;  4IL6 X;  1VL2 A;  2ZJS E;  1NH4 A;  3W67 A;  1T3J A;  1KFN A;  2E74 C;  1NHL A;  2WPQ A;  3JCU E;  5KLI C;  1O7N A;  4L75 A;  3H25 A;  3TNU B;  3D89 A;  1K05 A;  1SQB E;  4A7P A;  1HTL C;  1LP1 A;  1FBM A;  2Q6Q A;  1KIL C;  2JDI H;  3KZI H;  5APW A;  3L70 E;  3M0D A;  3QH9 A;  2KNC B;  2XND H;  2WPR A;  2HMN A;  3RL0 D;  2YKP A;  4I2L C;  2E75 B;  3L72 D;  1N73 C;  1BE3 G;  3HRN A;  2XU6 A;  3CXH E;  5AW4 B;  2AEM A;  1N2D C;  3L74 E;  2DE5 D;  1OXZ A;  2M3B A;  5CCG D;  2ZAE B;  3JC2 2;  2O3J A;  2ZT9 B;  1J1E C;  2QJY C;  1FJK A;  5AW8 B; 
#chains in the Genus database with same CATH homology
 4P1C H;  2XSO A;  4NBA D;  2HMO A;  3H1J E;  3C0D A;  1O7H A;  1O7M A;  2DE7 D;  1O7G A;  1SQV E;  1Q90 C;  2JZA A;  3GTS A;  2E74 D;  4QUQ A;  3VCA A;  2B1X A;  1BE3 E;  2YVJ B;  4NBG D;  4HM8 A;  2QJP C;  4HM1 A;  5KLV E;  2XR8 A;  3DQY A;  3VMH D;  2DE6 D;  4NBC D;  4U3F E;  4NBB D;  4NB9 D;  5AEU A;  4H44 D;  3H1K E;  4QDC A;  2BMR A;  4QDF B;  2HML A;  4AIV A;  3H1I E;  1WQL A;  3VMI D;  1VM9 A;  4HM7 A;  2GBX A;  3VMG D;  1EG9 A;  1SQX E;  3L72 E;  3EN1 A;  1PP9 E;  3GZY A;  4HJL A;  2CKF A;  3GCE A;  2NWF A;  2NVG A;  1O7P A;  4H0L D;  1L0L E;  4QCK A;  4HM5 A;  1SQQ E;  1EZV E;  4EMJ B;  1PPJ E;  2YFL A;  3AZC A;  3VCP A;  1UUV A;  1VF5 D;  1RFS A;  2A06 E;  2D2C D;  5CXM A;  3GL2 A;  4QUR A;  2XSH A;  2ZT9 D;  4NBD D;  1O7N A;  5KLI C;  2ZYL A;  3GZX A;  3GL0 A;  3BCC E;  2YIU C;  4D6T E;  1BGY E;  4AAY B;  5HL4 A;  2NVE A;  1NTZ E;  4HM0 A;  4P1B H;  1NDO A;  2E75 D;  4NB8 D;  3GTE A;  2FYU E;  3D89 A;  1NTM E;  2B24 A;  1SQB E;  1BCC E;  1ZRT E;  2JO6 A;  2YFI A;  4HM2 A;  2FYN C;  4HM4 A;  3EQQ A;  4H13 D;  2NVF A;  2QPZ A;  4QUP A;  4QDD A;  4PV1 D;  2HMM A;  1KB9 E;  3L70 E;  1RIE A;  1ULJ A;  3L73 E;  2BMO A;  3GOB A;  3FOU A;  3GKE A;  2NUK A;  3N0Q A;  1JM1 A;  1VCK A;  3H1H E;  2HMJ A;  4OGQ D;  1L0N E;  3TGU E;  2HMN A;  5KKZ C;  2YFJ A;  4QDF A;  1NTK E;  1G8K B;  3H1L E;  2XRX A;  1ULI A;  3GB4 A;  3CWB E;  4PD4 E;  1KYO E;  4HKV A;  1P84 E;  3CXH E;  1UUW A;  1G8J B;  3CX5 E;  4HM6 A;  1SQP E;  2E76 D;  5BOK A;  3L75 E;  3L74 E;  1SJG A;  5AEW A;  2BMQ A;  2E4Q A;  1NYK A;  2DE5 D;  2IBZ E;  2GBW A;  2HMK A;  4NBE D;  1O7W A;  4NBH D;  4HM3 A;  4NBF D;  1NU1 E;  2NUM A;  2Q3W A;  2E4P A;  1FQT A;  3L71 E;  2QJY C;  2I7F A;  2QJK C;  2BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...