1PP9E

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 54
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1pp9E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1pp9E02
2HMLA 3GL0A 4EMJB 1NTZE 1O7MA 4P1BH 1PP9E 3L72E 2NWFA 3GTSA 2QJYC 4HM1A 2ZT9D 2HMKA 3H1HE 3L74E 4HM3A 3L71E 5BOKA 1UUVA 3VCAA 4HM8A 4QDDA 2B1XA 3L70E 2NVGA 4HM7A 2HMOA 1VM9A 2QPZA 5KKZC 2YFJA 2HMNA 3H1JE 4P1CH 4QDFA 2BMOA 2QJPC 1G8JB 3VMHD 3H1IE 2NVEA 4QDFB 1NU1E 3VMGD 1NTKE 2GBWA 4NBCD 3CX5E 2D2CD 3C0DA 1FQTA 4NB8D 4PV1D 1BCCE 2E75D 3EN1A 2XRXA 3GL2A 1L0LE 1G8KB 4NBAD 1SQXE 1ULIA 2E4QA 4U3FE 4NBGD 1O7PA 4NB9D 4HM5A 1ULJA 2DE7D 4AIVA 4HM0A 4NBFD 1RFSA 1PPJE 5AEWA 2E74D 3VCPA 2A06E 2JO6A 1SQVE 1L0NE 2NUKA 3GOBA 1EZVE 1NYKA 4H44D 4H13D 2IBZE 1RIEA 4HKVA 3L75E 5AEUA 4HM4A 1NTME 4D6TE 1O7HA 2YIUC 1UUWA 1SQPE 2YFIA 1Q90C 4NBHD 1O7GA 4OGQD 4QUPA 1BGYE 4AAYB 3L73E 4NBDD 2ZYLA 2FYNC 1VF5D 3CWBE 3GB4A 2XSHA 1VCKA 3EQQA 4PD4E 2NVFA 1EG9A 4HJLA 2BMQA 1ZRTE 2JZAA 2E4PA 2GBXA 3AZCA 2B24A 2CKFA 4QUQA 3D89A 1KYOE 3H1LE 2QJKC 5KLIC 3DQYA 2E76D 4QCKA 1SJGA 2HMJA 4QDCA 2YVJB 2XR8A 3CXHE 1NDOA 1WQLA 3TGUE 3VMID 2YFLA 4QURA 2I7FA 3FOUA 3GZXA 3GTEA 1O7NA 4H0LD 1O7WA 1SQBE 2DE6D 5KLVE 2XSOA 4HM2A 4HM6A 2HMMA 1BE3E 5HL4A 3H1KE 2FYUE 1SQQE 4NBBD 2DE5D 5CXMA 4NBED 3GCEA 2BCCE 3GZYA 1P84E 3BCCE 3GKEA 3N0QA 2Q3WA 2BMRA 2NUMA 1JM1A 1KB9E
chains in the Genus database with same CATH superfamily
3PTZA 4EMJB 3Q5SA 3SWKA 3R4YA 1LWUC 3D6ZA 3A3YB 4TT3H 1NKZB 1NVOA 1U7MA 2E75B 1KMIZ 1K9MQ 3U1AA 1RE4C 3A0HH 1N73B 5AVVB 1EZVI 1SQQK 1BCCE 1VQPP 1M1JA 4PD4H 2N1TD 4NB9D 5B66H 3AE5C 2WPSA 4ZKUA 4HM0A 2QJKB 2W83C 1CW5A 1FDOA 1AQ5A 1AQTA 3A0HE 3CD6P 1T6AA 3AEGC 1EZVD 2NPSC 5AW3B 2HPCA 1MKMA 4LC1A 1LTJC 4PD4E 2BMQA 5CCHC 2O1KA 2K9JA 5B66E 2YXQB 5KLIC 1NU1G 2XZRA 1SJGA 3WMM0 1VPCA 2WZ7A 1SQXG 3GTEA 1YJWP 5APTA 3L71J 3MIWA 3TNUB 1DD3A 3VP8A 5KJ7A 1IFNA 2M3EA 2FYUD 5BVZA 1VQKP 3H1JJ 1BSNA 2V7QH 1IFMA 1NTZE 1OFCX 3CI9A 4GODA 1GL2C 3CWBG 3PP5A 2LKMA 2MJZA 3L74E 3W67A 4HM3A 2WSCJ 1NHLA 3C1LA 1JY2N 2WSFH 4I1LA 1HJ0A 1X79B 1N73A 1N7SB 2NVGA 5KLVD 1KQGB 4RESB 2IX7C 4Y99B 3FGAD 3M91A 1IZNB 1QEXA 2YXRB 5KLVK 2OYHB 2W27A 4RO0A 3N7NA 1J1DC 4H44B 5CHXA 2V4HA 3L70G 1CSBA 1AVOA 1K04A 3G3ZA 1Y9BA 4BWNA 3LIEA 1VF5C 1NJIQ 1G2CB 2A06E 1GDTA 5GTHE 5AVUB 2H89C 2YIUC 3VP9A 1EDJA 1AJYA 1LT9B 2E43A 2WT7B 3L75D 1VF5D 2FXOA 1RE3A 2A45I 1OW6A 2OARA 1ZR4A 1ZXGA 3EFFK 3H25A 1SFCB 1PIXA 1NAYA 4WY4B 3E1RA 3TNUA 2P10A 2JJLA 1S5LX 2Q5UA 1SQVG 2PFXA 1EZVG 2XKMA 2QJPB 3SSUA 4GDOA 3BCCD 1NU1J 3CMEP 3CCVP 2HMKA 4KHXA 4IFDK 1RHZB 1WMKA 1CI6B 4U7JA 1N7SA 5KJ7D 2B1XA 1KC8Q 1GD2E 1PV3A 2OYHA 4JQ0D 1S9KD 3BASA 1HWTC 3L37A 4N78E 1FQTA 2QIWA 4UB6E 2E75D 1E79H 3GHGC 1BGYJ 1L0LE 1G8KB 1FC2C 2Z5HA 3KPEA 1KQFB 1G2CA 1KN7A 1JMMA 1L0NJ 3Q3DA 2IBZE 4D6TE 1SQPE 1FU1A 1LT9A 1PFIA 2M8RA 4GKGA 1A02J 2WT7A 2ZYGA 3MD0A 1AFOA 1NTMD 4H0LB 1M8OB 2GUSA 3EQQA 4PJ0H 3V4QA 2WSEJ 1JMBA 2B24A 3C8VA 1SFCA 1NTKG 4WY4A 3KQGA 5APYA 1S2EA 1IFIA 2PGDA 3FWLA 1GZLA 1BDCA 3S4RA 1SQQJ 2AXTH 3ABVC 3R2PA 2WMMA 1JUNA 1YHQP 1LNQA 1BE3D 1OVRA 4PJ0E 3L75G 3N4XA 2L5GB 2XNXA 3SWYA 1CI6A 3M06A 3L72D 1RF0C 3RK3B 3VCAA 2POHA 2KB7P 4HM7A 2IZ0A 2CPBA 1NKNA 2OYOA 1YQ3C 3PRJA 3P8CD 1M1KQ 1KZUB 3EN1A 1OW8A 4U3FJ 3BCCG 1MV8A 1N7SD 4HM5A 3G6EP 3WUVA 2D2CC 3RL0g 4PV1C 2JDIH 3RK2D 3I5CA 4NBFD 1J1EC 2WQYC 3L36A 3GF3A 1N8RQ 1DH3A 3WU2H 3VCPA 5CBOA 1L0NE 3LW5H 3RK3E 2NUKA 4H44D 1PPJD 2YFIA 3BRTB 2C0WA 5AVYB 2FYUJ 1OVVA 4TLFA 5AW6B 5CCGA 3AE9C 1KTMA 3L73D 2IZ1A 2LR2A 3AECC 4QCKA 1R5SA 1KILC 2PRRA 3VMID 3CC2P 2YFLA 3GZXA 3EQ2A 1JY3P 3Q1MA 5KLVJ 1FOSF 1RY3A 1GU4A 2C9NY 2WVRA 1H0TB 1SQQE 2VRSA 3GZYA 1YYCA 3B5NC 2Q3WA 1JB0J 5H2FH 1NTMG 1VQOP 3CMAP 3GG2A 4W7ZA 1EQ7A 1OMIA 3I55P 3B5ND 2KLUA 4AUWA 1VQ7P 3KHUA 1U7JA 5E79H 3H1HD 1YQ4C 2HODB 1VM9A 1T3JA 2YKQA 5GTIH 3L75J 1GW4A 3P8MC 1QVGO 1NAFA 1BE3G 3AE6C 1ZMEC 1IK9A 4U3FE 2XDJA 1Y8AA 4IFMA 1Q7YQ 1LTTC 2W6JH 5E79E 3FXDA 2XNDH 5GTIE 1Q90C 1O7GA 5KAFH 4AAYB 4C46A 2R32A 2KUBA 1ZN5A 1T8ZA 4H13C 4IL6E 2P2UA 2XSHA 4BXLA 4YPCA 3BCCJ 2UWJE 3V6IA 1XTCC 1EG9A 1X22A 4L75A 2GBXA 1R5LA 1LTGC 1NU1K 1SQXD 3DQYA 2R3CA 4DZOA 1SQXK 3NFQA 3TGUJ 5KTBA 4H0LD 1H0TA 2E76C 3TYYA 5KLVE 4L76A 1JCDA 5APSA 3H1KJ 2ZT9B 3GF7A 3A5TA 1PPJG 3AE4C 2FBWC 5B5EE 2FFDC 3CC7P 4ZKPA 3GL0A 3CWBD 5AW1B 1AVYA 1HGVA 3CCLP 3L73G 2QVAA 1RF1B 1PP9D 3VTPC 2KSEA 2IDBA 2HODA 1FOSE 3EWKA 3EFGA 2JP3A 4R4MA 3FWNA 3VMHD 1HGZA 1VQMP 3L70D 3OAKA 3VMGD 1NGMB 1E5WA 1NOHA 2XRXA 2I8DA 1AA0A 1ULJA 2GUVA 3NXSA 2RKLA 2N1TC 3CXHH 5AEWA 4YTPC 2KIKA 1L4AD 1L0LG 2HG5D 3H1HG 1ZW0A 3D70A 3CCEP 3HD7B 1YTZI 1P84I 4DT0A 2H43A 4K35A 3V2PA 2IBZG 1URQB 3H1LJ 1VQLP 2HYNA 3F89A 3HUSC 4XA4A 3L72J 3CXHE 3PHLA 3TGUE 1FJPA 1SQVD 3H1KE 2FYZA 2DE5D 1GK6A 1OZHA 1S9KE 1SQVK 1SQBD 2NUMA 3JCUH 2MKVA 3L4FA 1IFJA 3USSA 5AW2B 1P84D 3UIAA 3AE2C 3O6QB 1RF1A 3E7KA 2B9BA 2Q3IA 4DOJA 1AV1A 3RL0B 1UUVA 2ZVOB 3B71A 2H88C 1FZCC 2WITA 3OA7A 3KDPB 1MZ9A 3JCUE 2GBWA 2FYUK 3C9IA 3C0DA 3L73J 3H1ID 2E4QA 3KYQA 5APWA 4ASWA 1KYOH 4AIVA 2M5AB 1NYHA 5GTHH 1PP9G 3MTUE 3CCMP 3ITKA 2KI7B 1O7HA 4QUPA 2KOGA 2FYNC 3HD7A 2I1JA 1FS0E 3Q5RA 1NTKD 1M1JC 1ZRTE 1URQA 1FZEA 1VQ4P 1KYOE 1X9VA 3H1LE 4JYCA 2QJYB 3PH0A 2CPSA 1GU5A 3H1HJ 2D2CB 5HL4A 1YI2P 3W68A 4NPEA 3GKEA 2BMRA 1KB9E 2WWWA 2BCCD 3O6QA 3Q5PA 3M0DA 2ZT9D 2WSCH 2E5YA 3OJAB 3HTKB 3L71E 1VQ8P 2QRXA 4HM8A 3GMAA 2Z4EA 2N9YB 2XV5A 3P32A 1IO4A 3O8ZA 1QL1A 5KKZC 3H1JE 4WWIA 4P1CH 2BMOA 1G8JB 2HFED 3AEBC 5KJ7C 4UB6H 2E74B 5BU5A 1CZQA 1K05A 1SQBG 4NBCD 4GOFA 4NB8D 1HH0A 3AEAC 1SQXJ 1RQUA 1O7PA 4OGQB 2K88A 1BCCD 2E75C 3M0AA 4PD4I 2P1JA 5APQA 1OWAA 1S3JA 1N73C 3CCUP 4LLHA 1A02F 2KS1B 2ITAA 1M56D 2RMZA 1ZV8A 1KILE 2ZVNB 3CWBJ 3U1CA 3KXDA 1VQ6P 1ZR2A 3ZDMA 4GIFA 2QJKC 3H1IG 2W90A 1PP9J 4PD4D 5C39A 2YO3A 2YVJB 5AW9B 1W2EA 5CBNA 5K5GB 3A2AA 1URQD 3GCEA 3L70J 1NTMK 2HMLA 2AXCA 2G3AA 3CX5H 3WUTA 1LT1A 2OGUA 3TF5A 4HJGH 3HTKA 2JEEA 1NTZD 3AE1C 3SWFA 1DEBA 2W6BA 2YMKA 2AEMA 3MUDA 2Y0EA 1PL5A 3L74D 3V2NA 2QPZA 1GW3A 1QVFO 2YFJA 2JKVA 3AE7C 3M9BA 2NVEA 2E42A 1NU1E 2E76B 4C7RA 3CX5E 1FZBA 2KK7A 1FBMA 2BCCG 1SQXE 3M9HA 2XU6A 2Q6QA 4I2LC 1JTHB 1N7SC 1SQVJ 4DCKA 1JY3N 1M7LA 2KS1A 3AEEC 3RK2C 2IPPA 4UB8H 2WPQA 1UUWA 2Y9ZA 4NBHD 1SQBJ 4WVZA 2OYHC 4DJGA 1FAVA 2A06D 3TK1A 2ZFCA 1TU3F 4I7ZB 1BGYE 1FDIA 4H44C 4NPFX 2WSEH 3CWBE 4A7PA 1VCKA 2HR3A 3L35A 3P7KA 5TISE 4EI2A 5AVSB 5DJUB 2KP8A 1LWUB 1RH5B 4OVNF 1NDOA 1BCCG 2AEJA 3H32B 3IR9A 2DE6D 4UB8E 5AVTB 4HM6A 2OTJP 5APVA 3A0BH 1YTZT 1LT9C 1IC2A 2Q7CA 1OX3A 2HLOA 3HE5B 1N7LA 3F5HA 3CL3D 1HF9A 1T2KD 1LTSC 2OTLP 3QWOC 3GTSA 1SFCC 3D6YA 2IYPA 1JY2O 2WSSH 4WY4C 3II6A 3AE8C 2LXCB 1X0TA 1OVUA 1M57D 4QDDA 3RBZA 3A0BE 1LJ2A 1SFCD 4WBAA 2GM4A 4IL6X 4WY4D 1FZFA 2QJPC 3V5BA 2IBZI 1NTKJ 2O01N 2NPSB 2Q1KA 3GW6A 3KZIH 4B86A 2K9YA 2O01J 3TSIA 1LTJB 1SS1A 2NRGA 4N78D 4L73A 1L0LD 1JTHA 1NTZG 5KLIB 2E74D 3CCRP 1SQVE 1EZVE 2OYIC 2QE7H 1USDA 3L74G 4IL6H 4HH2A 4OGQD 4WB4A 2IBZD 4I6MC 4D6TD 2BCCJ 1SQPD 3KZIE 4AQRD 1GK4A 1LWUA 5AVZB 2IYOA 1GL2B 1H88A 2XSOA 4YXWH 2KXPB 2FYUE 1RE4A 5B5EH 3BATA 1EDIA 4H0LC 3N0QA 2A06G 1IFDA 1O7MA 2FXPA 5CCGC 1J1DB 1BCCJ 2FYNB 3A7OA 1EXIA 2W8ZA 3RGUA 2QSIA 5CCGD 1VF5B 2JWAA 1KFNA 2AEFA 2ZYAA 2P58A 4HYTB 4OH8B 3VN0A 2YIUB 2K3RA 5AW0B 2K1AA 2NPSA 1NTKE 2RN0A 1Q81Q 1DD4A 1LTJA 2CK3H 3QH9A 4HKZH 5CCHA 4NBGD 1VQ9P 1Q82Q 3VMZA 3H1JG 4ASVA 4BRYB 2H8PD 2K9JB 5APXA 3GOBA 1BSHA 2B88A 1NTMJ 3L75E 3IF4A 3MP7B 2QEXP 1L0ND 1W2BO 2KNCB 3RK3D 2A45H 1OW7A 1LTIC 1FZGA 2ZYLA 4Z1MH 1L4AC 3G71P 1IJDB 3VMXA 1NTZJ 1GL2A 1JNMA 3JSVC 3HE4B 4QURA 2YMYA 1HBWA 3L74J 1BE3J 2GA1A 5CXMA 3BCCE 1W5CE 1JM1A 2QM8A 1SQQD 4D6TG 1SQPG 2V7QJ 3GHGB 1FZAA 4HM1A 4R4LA 1NO4A 3V2RA 1GTWA 2O1JA 3SFDC 3GLMA 1JY3O 4K3AA 3HRNA 2WSFJ 2YKOA 3NMDA 2JWDA 1SQBK 1S4XA 1QL2A 2ZAEB 5AW8B 3GL2A 3MGNA 3H6PA 4BRYA 4HB1A 5CMZA 3CCJP 4U3FD 3D71A 2NPSD 5APUA 2DW3A 1NTME 2KNCA 3S9OA 2P67A 5CCHD 2BEZF 3S1KA 1DEEG 2WTYA 4M3LA 4JPZB 1JOCA 1PGJA 3D89A 1SP4A 2K37A 4QDCA 3TDKA 2XR8A 3HE4A 4GOEA 1WQLA 1BGYG 3IFMA 2J5UA 2I7FA 1O7WA 4HM2A 1J2JB 1BE3E 1KB9H 4Y28J 2RH0A 1L0NG 2JR8A 1GL2D 1PGPA 3RK2B 4W7YA 1NTKK 1SLQA 3V2QA 3SFEC 3GHGA 2R44A 3L72E 1UIXA 1L0LJ 1G1IA 4PV1B 5BOKA 1KD1Q 1OXZA 1J1EB 2ZT9C 2G8YA 3P8CE 3AE3C 3U59A 4D6TJ 1NH4A 1EC5A 1SQPJ 1SQQG 4NBAD 1ULIA 1RF1C 2ZYDA 5KAIH 2C9LY 4IFFA 1JCCA 1PPJE 2FKWB 3JC22 2JO6A 1JY2P 2M3BA 3CCSP 3CLQA 1KILB 1NYKA 2B87B 3PLNA 4HM4A 3CXHI 4MN4C 1HJBA 3L73E 3G4SP 4EOTA 1N2DC 3B5NB 2KZIA 1H8AA 1EXJA 3M9QA 1FE6A 2NVFA 4HJLA 2M5AA 3FXEA 4JBZA 3AZCA 4QUQA 5KAIE 1GMJA 3PJSK 4NPDA 2J58A 4W80A 1RF0A 4U3FG 2JO1A 1M90Q 4NBBD 3CXHD 1HTLC 3TGUD 5CJ4A 4YXDC 3HD7C 4XFJA 2OYIB 3H1KD 2YNYA 1OIPA 1S5LH 1URQC 1WRGA 1YJNP 2L91A 2Q3EA 1G1JA 2FYUG 2PAJA 3Q2YA 1Y47A 3H1HE 1KORA 3HD7D 4OWFA 3T97B 3AEDC 1YITP 2QA4P 4C7NB 3VOPA 3V4WA 1PZQA 1MUUA 1H89A 1DIPA 4AYCA 1RE3C 2R3SA 3MZWB 4QDFB 2BEQD 5KLVG 2Y0CA 5AW4B 1S5LE 1LTBC 1FDMA 4H13B 3VMYA 3M0DC 1KFMA 1VQ5P 4N6JA 1HVVA 2QG4A 2DE7D 3IAOA 2Y0DA 1NTZK 2FY8A 3RL0C 2PP6A 1D7MA 1KILA 2B87A 1KYOI 4JYBA 3AEFC 1QX8A 3IN6A 4EYYQ 5AEUA 3LW5J 1Z56A 3B5NA 3RL0D 3WUUA 2IFMA 1HUCA 5DJTB 4NBDD 1FJKA 5TISH 4RJTA 5AVWB 2FFDB 2JZAA 2E4PA 3NTNA 1KB9I 1KV4A 1WT6A 2KSJA 2ZXXA 3K5BA 2HMJA 1ZRTD 4Y99C 1Q86Q 1L2PA 1KYOD 2KLVA 3H1LD 3FOUA 1O7NA 3CCQP 2I1KA 2AXTE 4QMAA 5CJ0A 2OYIA 3OW2O 1K8AQ 4GT1A 4KJMA 1VQNP 1EDLA 4EIJA 3FX0A 1T3UA 1PP9E 2YO2A 1KB9D 2QJYC 4LGDE 1T2KC 1N86A 1L4AB 3T97A 4ZMDA 2A45G 1UIIA 4C7NA 1IFPA 2E5TA 4N3YB 1EDKA 2N1TB 3L70E 2YKPA 1LP1B 1KQSO 3L71D 2W6AA 3E1IA 4EDFA 2HMNA 4QDFA 3TGUG 2R5DA 3H1IJ 1X8YA 2D2CD 4PV1D 1K73Q 3H1KG 3H1JD 1R8EA 2ZJSE 5AVXB 1ZLLA 1YJ9P 5AVRB 2IFNA 3VYIA 1XTGB 3HUSB 1Q2NA 1RQVA 1ZOYC 3MUDC 1VDFA 3WU2E 3BRVB 2E74C 2Z5IA 1PGOA 5EFWB 1P84H 4ZNCA 4O9BA 2FFDA 3GB4A 4XE5B 4OGQC 1KILD 1LTAC 2CKFA 1LGHB 5AVQB 2SPZA 3VMAA 2N9BA 2Y9YA 1L0LK 1JO5A 1SVFA 1U57A 1MFTA 1SQBE 2B89A 2HMMA 2LXBA 2O3JA 1YIJP 3CPWO 4NBED 1FZCB 1P84E 1ZP0C 3G9RA 2H7HA 2WPVB 1QGKB 1SQPK 1IK7A 2WPRA 4P1BH 3B4SA 3H32A 2J59M 5H2FE 1JM0A 2NWFA 3LIDA 1L4AA 5BU8B 3CX5I 4IOIH 1QLED 2NZ2A 2N1TA 3HE5A 3H1LG 1LP1A 1YBKA 1PGQA 2ZXEB 2HMOA 2C0XA 2OQQA 2OTKE 1KQLA 3L72G 1DX7A 1NWQA 3H1IE 1S1CX 2O01H 1BDDA 1VL2A 5M1BA 4KT0J 4JF7A 5L8RJ 3BVHA 1M1JB 1NU1D 3CX5D 3CC4P 3HUSA 4L74A 5AW7B 1RFSA 1Q90D 1S72P 4CPGA 5TJHA 2Q9IA 4H13D 4HKVA 1RIEA 2KYVA 2BASA 2R5BA 3L71G 3RBXA 3MHVA 2P7JA 5KAFE 2HPCB 3RK3C 1BGYD 2KZJA 2QM7A 5AW5B 2E76D 3B8EB 4RKUJ 2M0BA 3I56P 2FXMA 1FZCA 1JEKA 4I7ZC 1USEA 1MFZA 2BCCE 1L0NK 5KKZB
chains in the Genus database with same CATH topology
2HMLA 3GL0A 4EMJB 1NTZE 1O7MA 4P1BH 1PP9E 3L72E 2NWFA 3GTSA 2QJYC 4HM1A 2ZT9D 2HMKA 3H1HE 3L74E 4HM3A 3L71E 5BOKA 1UUVA 3VCAA 4HM8A 4QDDA 2B1XA 3L70E 2NVGA 4HM7A 2HMOA 1VM9A 2QPZA 5KKZC 2YFJA 2HMNA 3H1JE 4P1CH 4QDFA 2BMOA 2QJPC 1G8JB 3VMHD 3H1IE 2NVEA 4QDFB 1NU1E 3VMGD 1NTKE 2GBWA 4NBCD 3CX5E 2D2CD 3C0DA 1FQTA 4NB8D 4PV1D 1BCCE 2E75D 3EN1A 2XRXA 3GL2A 1L0LE 1G8KB 4NBAD 1SQXE 1ULIA 2E4QA 4U3FE 4NBGD 1O7PA 4NB9D 4HM5A 1ULJA 2DE7D 4AIVA 4HM0A 4NBFD 1RFSA 1PPJE 5AEWA 2E74D 3VCPA 2A06E 2JO6A 1SQVE 1L0NE 2NUKA 3GOBA 1EZVE 1NYKA 4H44D 4H13D 2IBZE 1RIEA 4HKVA 3L75E 5AEUA 4HM4A 1NTME 4D6TE 1O7HA 2YIUC 1UUWA 1SQPE 2YFIA 1Q90C 4NBHD 1O7GA 4OGQD 4QUPA 1BGYE 4AAYB 3L73E 4NBDD 2ZYLA 2FYNC 1VF5D 3CWBE 3GB4A 2XSHA 1VCKA 3EQQA 4PD4E 2NVFA 1EG9A 4HJLA 2BMQA 1ZRTE 2JZAA 2E4PA 2GBXA 3AZCA 2B24A 2CKFA 4QUQA 3D89A 1KYOE 3H1LE 2QJKC 5KLIC 3DQYA 2E76D 4QCKA 1SJGA 2HMJA 4QDCA 2YVJB 2XR8A 3CXHE 1NDOA 1WQLA 3TGUE 3VMID 2YFLA 4QURA 2I7FA 3FOUA 3GZXA 3GTEA 1O7NA 4H0LD 1O7WA 1SQBE 2DE6D 5KLVE 2XSOA 4HM2A 4HM6A 2HMMA 1BE3E 5HL4A 3H1KE 2FYUE 1SQQE 4NBBD 2DE5D 5CXMA 4NBED 3GCEA 2BCCE 3GZYA 1P84E 3BCCE 3GKEA 3N0QA 2Q3WA 2BMRA 2NUMA 1JM1A 1KB9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HML A;  3GL0 A;  4EMJ B;  1NTZ E;  1O7M A;  4P1B H;  1PP9 E;  3L72 E;  2NWF A;  3GTS A;  2QJY C;  4HM1 A;  2ZT9 D;  2HMK A;  3H1H E;  3L74 E;  4HM3 A;  3L71 E;  5BOK A;  1UUV A;  3VCA A;  4HM8 A;  4QDD A;  2B1X A;  3L70 E;  2NVG A;  4HM7 A;  2HMO A;  1VM9 A;  2QPZ A;  5KKZ C;  2YFJ A;  2HMN A;  3H1J E;  4P1C H;  4QDF A;  2BMO A;  2QJP C;  1G8J B;  3VMH D;  3H1I E;  2NVE A;  4QDF B;  1NU1 E;  3VMG D;  1NTK E;  2GBW A;  4NBC D;  3CX5 E;  2D2C D;  3C0D A;  1FQT A;  4NB8 D;  4PV1 D;  1BCC E;  2E75 D;  3EN1 A;  2XRX A;  3GL2 A;  1L0L E;  1G8K B;  4NBA D;  1SQX E;  1ULI A;  2E4Q A;  4U3F E;  4NBG D;  1O7P A;  4NB9 D;  4HM5 A;  1ULJ A;  2DE7 D;  4AIV A;  4HM0 A;  4NBF D;  1RFS A;  1PPJ E;  5AEW A;  2E74 D;  3VCP A;  2A06 E;  2JO6 A;  1SQV E;  1L0N E;  2NUK A;  3GOB A;  1EZV E;  1NYK A;  4H44 D;  4H13 D;  2IBZ E;  1RIE A;  4HKV A;  3L75 E;  5AEU A;  4HM4 A;  1NTM E;  4D6T E;  1O7H A;  2YIU C;  1UUW A;  1SQP E;  2YFI A;  1Q90 C;  4NBH D;  1O7G A;  4OGQ D;  4QUP A;  1BGY E;  4AAY B;  3L73 E;  4NBD D;  2ZYL A;  2FYN C;  1VF5 D;  3CWB E;  3GB4 A;  2XSH A;  1VCK A;  3EQQ A;  4PD4 E;  2NVF A;  1EG9 A;  4HJL A;  2BMQ A;  1ZRT E;  2JZA A;  2E4P A;  2GBX A;  3AZC A;  2B24 A;  2CKF A;  4QUQ A;  3D89 A;  1KYO E;  3H1L E;  2QJK C;  5KLI C;  3DQY A;  2E76 D;  4QCK A;  1SJG A;  2HMJ A;  4QDC A;  2YVJ B;  2XR8 A;  3CXH E;  1NDO A;  1WQL A;  3TGU E;  3VMI D;  2YFL A;  4QUR A;  2I7F A;  3FOU A;  3GZX A;  3GTE A;  1O7N A;  4H0L D;  1O7W A;  1SQB E;  2DE6 D;  5KLV E;  2XSO A;  4HM2 A;  4HM6 A;  2HMM A;  1BE3 E;  5HL4 A;  3H1K E;  2FYU E;  1SQQ E;  4NBB D;  2DE5 D;  5CXM A;  4NBE D;  3GCE A;  2BCC E;  3GZY A;  1P84 E;  3BCC E;  3GKE A;  3N0Q A;  2Q3W A;  2BMR A;  2NUM A;  1JM1 A;  1KB9 E; 
#chains in the Genus database with same CATH topology
 3PTZ A;  4EMJ B;  3Q5S A;  3SWK A;  3R4Y A;  1LWU C;  3D6Z A;  3A3Y B;  4TT3 H;  1NKZ B;  1NVO A;  1U7M A;  2E75 B;  1KMI Z;  1K9M Q;  3U1A A;  1RE4 C;  3A0H H;  1N73 B;  5AVV B;  1EZV I;  1SQQ K;  1BCC E;  1VQP P;  1M1J A;  4PD4 H;  2N1T D;  4NB9 D;  5B66 H;  3AE5 C;  2WPS A;  4ZKU A;  4HM0 A;  2QJK B;  2W83 C;  1CW5 A;  1FDO A;  1AQ5 A;  1AQT A;  3A0H E;  3CD6 P;  1T6A A;  3AEG C;  1EZV D;  2NPS C;  5AW3 B;  2HPC A;  1MKM A;  4LC1 A;  1LTJ C;  4PD4 E;  2BMQ A;  5CCH C;  2O1K A;  2K9J A;  5B66 E;  2YXQ B;  5KLI C;  1NU1 G;  2XZR A;  1SJG A;  3WMM 0;  1VPC A;  2WZ7 A;  1SQX G;  3GTE A;  1YJW P;  5APT A;  3L71 J;  3MIW A;  3TNU B;  1DD3 A;  3VP8 A;  5KJ7 A;  1IFN A;  2M3E A;  2FYU D;  5BVZ A;  1VQK P;  3H1J J;  1BSN A;  2V7Q H;  1IFM A;  1NTZ E;  1OFC X;  3CI9 A;  4GOD A;  1GL2 C;  3CWB G;  3PP5 A;  2LKM A;  2MJZ A;  3L74 E;  3W67 A;  4HM3 A;  2WSC J;  1NHL A;  3C1L A;  1JY2 N;  2WSF H;  4I1L A;  1HJ0 A;  1X79 B;  1N73 A;  1N7S B;  2NVG A;  5KLV D;  1KQG B;  4RES B;  2IX7 C;  4Y99 B;  3FGA D;  3M91 A;  1IZN B;  1QEX A;  2YXR B;  5KLV K;  2OYH B;  2W27 A;  4RO0 A;  3N7N A;  1J1D C;  4H44 B;  5CHX A;  2V4H A;  3L70 G;  1CSB A;  1AVO A;  1K04 A;  3G3Z A;  1Y9B A;  4BWN A;  3LIE A;  1VF5 C;  1NJI Q;  1G2C B;  2A06 E;  1GDT A;  5GTH E;  5AVU B;  2H89 C;  2YIU C;  3VP9 A;  1EDJ A;  1AJY A;  1LT9 B;  2E43 A;  2WT7 B;  3L75 D;  1VF5 D;  2FXO A;  1RE3 A;  2A45 I;  1OW6 A;  2OAR A;  1ZR4 A;  1ZXG A;  3EFF K;  3H25 A;  1SFC B;  1PIX A;  1NAY A;  4WY4 B;  3E1R A;  3TNU A;  2P10 A;  2JJL A;  1S5L X;  2Q5U A;  1SQV G;  2PFX A;  1EZV G;  2XKM A;  2QJP B;  3SSU A;  4GDO A;  3BCC D;  1NU1 J;  3CME P;  3CCV P;  2HMK A;  4KHX A;  4IFD K;  1RHZ B;  1WMK A;  1CI6 B;  4U7J A;  1N7S A;  5KJ7 D;  2B1X A;  1KC8 Q;  1GD2 E;  1PV3 A;  2OYH A;  4JQ0 D;  1S9K D;  3BAS A;  1HWT C;  3L37 A;  4N78 E;  1FQT A;  2QIW A;  4UB6 E;  2E75 D;  1E79 H;  3GHG C;  1BGY J;  1L0L E;  1G8K B;  1FC2 C;  2Z5H A;  3KPE A;  1KQF B;  1G2C A;  1KN7 A;  1JMM A;  1L0N J;  3Q3D A;  2IBZ E;  4D6T E;  1SQP E;  1FU1 A;  1LT9 A;  1PFI A;  2M8R A;  4GKG A;  1A02 J;  2WT7 A;  2ZYG A;  3MD0 A;  1AFO A;  1NTM D;  4H0L B;  1M8O B;  2GUS A;  3EQQ A;  4PJ0 H;  3V4Q A;  2WSE J;  1JMB A;  2B24 A;  3C8V A;  1SFC A;  1NTK G;  4WY4 A;  3KQG A;  5APY A;  1S2E A;  1IFI A;  2PGD A;  3FWL A;  1GZL A;  1BDC A;  3S4R A;  1SQQ J;  2AXT H;  3ABV C;  3R2P A;  2WMM A;  1JUN A;  1YHQ P;  1LNQ A;  1BE3 D;  1OVR A;  4PJ0 E;  3L75 G;  3N4X A;  2L5G B;  2XNX A;  3SWY A;  1CI6 A;  3M06 A;  3L72 D;  1RF0 C;  3RK3 B;  3VCA A;  2POH A;  2KB7 P;  4HM7 A;  2IZ0 A;  2CPB A;  1NKN A;  2OYO A;  1YQ3 C;  3PRJ A;  3P8C D;  1M1K Q;  1KZU B;  3EN1 A;  1OW8 A;  4U3F J;  3BCC G;  1MV8 A;  1N7S D;  4HM5 A;  3G6E P;  3WUV A;  2D2C C;  3RL0 g;  4PV1 C;  2JDI H;  3RK2 D;  3I5C A;  4NBF D;  1J1E C;  2WQY C;  3L36 A;  3GF3 A;  1N8R Q;  1DH3 A;  3WU2 H;  3VCP A;  5CBO A;  1L0N E;  3LW5 H;  3RK3 E;  2NUK A;  4H44 D;  1PPJ D;  2YFI A;  3BRT B;  2C0W A;  5AVY B;  2FYU J;  1OVV A;  4TLF A;  5AW6 B;  5CCG A;  3AE9 C;  1KTM A;  3L73 D;  2IZ1 A;  2LR2 A;  3AEC C;  4QCK A;  1R5S A;  1KIL C;  2PRR A;  3VMI D;  3CC2 P;  2YFL A;  3GZX A;  3EQ2 A;  1JY3 P;  3Q1M A;  5KLV J;  1FOS F;  1RY3 A;  1GU4 A;  2C9N Y;  2WVR A;  1H0T B;  1SQQ E;  2VRS A;  3GZY A;  1YYC A;  3B5N C;  2Q3W A;  1JB0 J;  5H2F H;  1NTM G;  1VQO P;  3CMA P;  3GG2 A;  4W7Z A;  1EQ7 A;  1OMI A;  3I55 P;  3B5N D;  2KLU A;  4AUW A;  1VQ7 P;  3KHU A;  1U7J A;  5E79 H;  3H1H D;  1YQ4 C;  2HOD B;  1VM9 A;  1T3J A;  2YKQ A;  5GTI H;  3L75 J;  1GW4 A;  3P8M C;  1QVG O;  1NAF A;  1BE3 G;  3AE6 C;  1ZME C;  1IK9 A;  4U3F E;  2XDJ A;  1Y8A A;  4IFM A;  1Q7Y Q;  1LTT C;  2W6J H;  5E79 E;  3FXD A;  2XND H;  5GTI E;  1Q90 C;  1O7G A;  5KAF H;  4AAY B;  4C46 A;  2R32 A;  2KUB A;  1ZN5 A;  1T8Z A;  4H13 C;  4IL6 E;  2P2U A;  2XSH A;  4BXL A;  4YPC A;  3BCC J;  2UWJ E;  3V6I A;  1XTC C;  1EG9 A;  1X22 A;  4L75 A;  2GBX A;  1R5L A;  1LTG C;  1NU1 K;  1SQX D;  3DQY A;  2R3C A;  4DZO A;  1SQX K;  3NFQ A;  3TGU J;  5KTB A;  4H0L D;  1H0T A;  2E76 C;  3TYY A;  5KLV E;  4L76 A;  1JCD A;  5APS A;  3H1K J;  2ZT9 B;  3GF7 A;  3A5T A;  1PPJ G;  3AE4 C;  2FBW C;  5B5E E;  2FFD C;  3CC7 P;  4ZKP A;  3GL0 A;  3CWB D;  5AW1 B;  1AVY A;  1HGV A;  3CCL P;  3L73 G;  2QVA A;  1RF1 B;  1PP9 D;  3VTP C;  2KSE A;  2IDB A;  2HOD A;  1FOS E;  3EWK A;  3EFG A;  2JP3 A;  4R4M A;  3FWN A;  3VMH D;  1HGZ A;  1VQM P;  3L70 D;  3OAK A;  3VMG D;  1NGM B;  1E5W A;  1NOH A;  2XRX A;  2I8D A;  1AA0 A;  1ULJ A;  2GUV A;  3NXS A;  2RKL A;  2N1T C;  3CXH H;  5AEW A;  4YTP C;  2KIK A;  1L4A D;  1L0L G;  2HG5 D;  3H1H G;  1ZW0 A;  3D70 A;  3CCE P;  3HD7 B;  1YTZ I;  1P84 I;  4DT0 A;  2H43 A;  4K35 A;  3V2P A;  2IBZ G;  1URQ B;  3H1L J;  1VQL P;  2HYN A;  3F89 A;  3HUS C;  4XA4 A;  3L72 J;  3CXH E;  3PHL A;  3TGU E;  1FJP A;  1SQV D;  3H1K E;  2FYZ A;  2DE5 D;  1GK6 A;  1OZH A;  1S9K E;  1SQV K;  1SQB D;  2NUM A;  3JCU H;  2MKV A;  3L4F A;  1IFJ A;  3USS A;  5AW2 B;  1P84 D;  3UIA A;  3AE2 C;  3O6Q B;  1RF1 A;  3E7K A;  2B9B A;  2Q3I A;  4DOJ A;  1AV1 A;  3RL0 B;  1UUV A;  2ZVO B;  3B71 A;  2H88 C;  1FZC C;  2WIT A;  3OA7 A;  3KDP B;  1MZ9 A;  3JCU E;  2GBW A;  2FYU K;  3C9I A;  3C0D A;  3L73 J;  3H1I D;  2E4Q A;  3KYQ A;  5APW A;  4ASW A;  1KYO H;  4AIV A;  2M5A B;  1NYH A;  5GTH H;  1PP9 G;  3MTU E;  3CCM P;  3ITK A;  2KI7 B;  1O7H A;  4QUP A;  2KOG A;  2FYN C;  3HD7 A;  2I1J A;  1FS0 E;  3Q5R A;  1NTK D;  1M1J C;  1ZRT E;  1URQ A;  1FZE A;  1VQ4 P;  1KYO E;  1X9V A;  3H1L E;  4JYC A;  2QJY B;  3PH0 A;  2CPS A;  1GU5 A;  3H1H J;  2D2C B;  5HL4 A;  1YI2 P;  3W68 A;  4NPE A;  3GKE A;  2BMR A;  1KB9 E;  2WWW A;  2BCC D;  3O6Q A;  3Q5P A;  3M0D A;  2ZT9 D;  2WSC H;  2E5Y A;  3OJA B;  3HTK B;  3L71 E;  1VQ8 P;  2QRX A;  4HM8 A;  3GMA A;  2Z4E A;  2N9Y B;  2XV5 A;  3P32 A;  1IO4 A;  3O8Z A;  1QL1 A;  5KKZ C;  3H1J E;  4WWI A;  4P1C H;  2BMO A;  1G8J B;  2HFE D;  3AEB C;  5KJ7 C;  4UB6 H;  2E74 B;  5BU5 A;  1CZQ A;  1K05 A;  1SQB G;  4NBC D;  4GOF A;  4NB8 D;  1HH0 A;  3AEA C;  1SQX J;  1RQU A;  1O7P A;  4OGQ B;  2K88 A;  1BCC D;  2E75 C;  3M0A A;  4PD4 I;  2P1J A;  5APQ A;  1OWA A;  1S3J A;  1N73 C;  3CCU P;  4LLH A;  1A02 F;  2KS1 B;  2ITA A;  1M56 D;  2RMZ A;  1ZV8 A;  1KIL E;  2ZVN B;  3CWB J;  3U1C A;  3KXD A;  1VQ6 P;  1ZR2 A;  3ZDM A;  4GIF A;  2QJK C;  3H1I G;  2W90 A;  1PP9 J;  4PD4 D;  5C39 A;  2YO3 A;  2YVJ B;  5AW9 B;  1W2E A;  5CBN A;  5K5G B;  3A2A A;  1URQ D;  3GCE A;  3L70 J;  1NTM K;  2HML A;  2AXC A;  2G3A A;  3CX5 H;  3WUT A;  1LT1 A;  2OGU A;  3TF5 A;  4HJG H;  3HTK A;  2JEE A;  1NTZ D;  3AE1 C;  3SWF A;  1DEB A;  2W6B A;  2YMK A;  2AEM A;  3MUD A;  2Y0E A;  1PL5 A;  3L74 D;  3V2N A;  2QPZ A;  1GW3 A;  1QVF O;  2YFJ A;  2JKV A;  3AE7 C;  3M9B A;  2NVE A;  2E42 A;  1NU1 E;  2E76 B;  4C7R A;  3CX5 E;  1FZB A;  2KK7 A;  1FBM A;  2BCC G;  1SQX E;  3M9H A;  2XU6 A;  2Q6Q A;  4I2L C;  1JTH B;  1N7S C;  1SQV J;  4DCK A;  1JY3 N;  1M7L A;  2KS1 A;  3AEE C;  3RK2 C;  2IPP A;  4UB8 H;  2WPQ A;  1UUW A;  2Y9Z A;  4NBH D;  1SQB J;  4WVZ A;  2OYH C;  4DJG A;  1FAV A;  2A06 D;  3TK1 A;  2ZFC A;  1TU3 F;  4I7Z B;  1BGY E;  1FDI A;  4H44 C;  4NPF X;  2WSE H;  3CWB E;  4A7P A;  1VCK A;  2HR3 A;  3L35 A;  3P7K A;  5TIS E;  4EI2 A;  5AVS B;  5DJU B;  2KP8 A;  1LWU B;  1RH5 B;  4OVN F;  1NDO A;  1BCC G;  2AEJ A;  3H32 B;  3IR9 A;  2DE6 D;  4UB8 E;  5AVT B;  4HM6 A;  2OTJ P;  5APV A;  3A0B H;  1YTZ T;  1LT9 C;  1IC2 A;  2Q7C A;  1OX3 A;  2HLO A;  3HE5 B;  1N7L A;  3F5H A;  3CL3 D;  1HF9 A;  1T2K D;  1LTS C;  2OTL P;  3QWO C;  3GTS A;  1SFC C;  3D6Y A;  2IYP A;  1JY2 O;  2WSS H;  4WY4 C;  3II6 A;  3AE8 C;  2LXC B;  1X0T A;  1OVU A;  1M57 D;  4QDD A;  3RBZ A;  3A0B E;  1LJ2 A;  1SFC D;  4WBA A;  2GM4 A;  4IL6 X;  4WY4 D;  1FZF A;  2QJP C;  3V5B A;  2IBZ I;  1NTK J;  2O01 N;  2NPS B;  2Q1K A;  3GW6 A;  3KZI H;  4B86 A;  2K9Y A;  2O01 J;  3TSI A;  1LTJ B;  1SS1 A;  2NRG A;  4N78 D;  4L73 A;  1L0L D;  1JTH A;  1NTZ G;  5KLI B;  2E74 D;  3CCR P;  1SQV E;  1EZV E;  2OYI C;  2QE7 H;  1USD A;  3L74 G;  4IL6 H;  4HH2 A;  4OGQ D;  4WB4 A;  2IBZ D;  4I6M C;  4D6T D;  2BCC J;  1SQP D;  3KZI E;  4AQR D;  1GK4 A;  1LWU A;  5AVZ B;  2IYO A;  1GL2 B;  1H88 A;  2XSO A;  4YXW H;  2KXP B;  2FYU E;  1RE4 A;  5B5E H;  3BAT A;  1EDI A;  4H0L C;  3N0Q A;  2A06 G;  1IFD A;  1O7M A;  2FXP A;  5CCG C;  1J1D B;  1BCC J;  2FYN B;  3A7O A;  1EXI A;  2W8Z A;  3RGU A;  2QSI A;  5CCG D;  1VF5 B;  2JWA A;  1KFN A;  2AEF A;  2ZYA A;  2P58 A;  4HYT B;  4OH8 B;  3VN0 A;  2YIU B;  2K3R A;  5AW0 B;  2K1A A;  2NPS A;  1NTK E;  2RN0 A;  1Q81 Q;  1DD4 A;  1LTJ A;  2CK3 H;  3QH9 A;  4HKZ H;  5CCH A;  4NBG D;  1VQ9 P;  1Q82 Q;  3VMZ A;  3H1J G;  4ASV A;  4BRY B;  2H8P D;  2K9J B;  5APX A;  3GOB A;  1BSH A;  2B88 A;  1NTM J;  3L75 E;  3IF4 A;  3MP7 B;  2QEX P;  1L0N D;  1W2B O;  2KNC B;  3RK3 D;  2A45 H;  1OW7 A;  1LTI C;  1FZG A;  2ZYL A;  4Z1M H;  1L4A C;  3G71 P;  1IJD B;  3VMX A;  1NTZ J;  1GL2 A;  1JNM A;  3JSV C;  3HE4 B;  4QUR A;  2YMY A;  1HBW A;  3L74 J;  1BE3 J;  2GA1 A;  5CXM A;  3BCC E;  1W5C E;  1JM1 A;  2QM8 A;  1SQQ D;  4D6T G;  1SQP G;  2V7Q J;  3GHG B;  1FZA A;  4HM1 A;  4R4L A;  1NO4 A;  3V2R A;  1GTW A;  2O1J A;  3SFD C;  3GLM A;  1JY3 O;  4K3A A;  3HRN A;  2WSF J;  2YKO A;  3NMD A;  2JWD A;  1SQB K;  1S4X A;  1QL2 A;  2ZAE B;  5AW8 B;  3GL2 A;  3MGN A;  3H6P A;  4BRY A;  4HB1 A;  5CMZ A;  3CCJ P;  4U3F D;  3D71 A;  2NPS D;  5APU A;  2DW3 A;  1NTM E;  2KNC A;  3S9O A;  2P67 A;  5CCH D;  2BEZ F;  3S1K A;  1DEE G;  2WTY A;  4M3L A;  4JPZ B;  1JOC A;  1PGJ A;  3D89 A;  1SP4 A;  2K37 A;  4QDC A;  3TDK A;  2XR8 A;  3HE4 A;  4GOE A;  1WQL A;  1BGY G;  3IFM A;  2J5U A;  2I7F A;  1O7W A;  4HM2 A;  1J2J B;  1BE3 E;  1KB9 H;  4Y28 J;  2RH0 A;  1L0N G;  2JR8 A;  1GL2 D;  1PGP A;  3RK2 B;  4W7Y A;  1NTK K;  1SLQ A;  3V2Q A;  3SFE C;  3GHG A;  2R44 A;  3L72 E;  1UIX A;  1L0L J;  1G1I A;  4PV1 B;  5BOK A;  1KD1 Q;  1OXZ A;  1J1E B;  2ZT9 C;  2G8Y A;  3P8C E;  3AE3 C;  3U59 A;  4D6T J;  1NH4 A;  1EC5 A;  1SQP J;  1SQQ G;  4NBA D;  1ULI A;  1RF1 C;  2ZYD A;  5KAI H;  2C9L Y;  4IFF A;  1JCC A;  1PPJ E;  2FKW B;  3JC2 2;  2JO6 A;  1JY2 P;  2M3B A;  3CCS P;  3CLQ A;  1KIL B;  1NYK A;  2B87 B;  3PLN A;  4HM4 A;  3CXH I;  4MN4 C;  1HJB A;  3L73 E;  3G4S P;  4EOT A;  1N2D C;  3B5N B;  2KZI A;  1H8A A;  1EXJ A;  3M9Q A;  1FE6 A;  2NVF A;  4HJL A;  2M5A A;  3FXE A;  4JBZ A;  3AZC A;  4QUQ A;  5KAI E;  1GMJ A;  3PJS K;  4NPD A;  2J58 A;  4W80 A;  1RF0 A;  4U3F G;  2JO1 A;  1M90 Q;  4NBB D;  3CXH D;  1HTL C;  3TGU D;  5CJ4 A;  4YXD C;  3HD7 C;  4XFJ A;  2OYI B;  3H1K D;  2YNY A;  1OIP A;  1S5L H;  1URQ C;  1WRG A;  1YJN P;  2L91 A;  2Q3E A;  1G1J A;  2FYU G;  2PAJ A;  3Q2Y A;  1Y47 A;  3H1H E;  1KOR A;  3HD7 D;  4OWF A;  3T97 B;  3AED C;  1YIT P;  2QA4 P;  4C7N B;  3VOP A;  3V4W A;  1PZQ A;  1MUU A;  1H89 A;  1DIP A;  4AYC A;  1RE3 C;  2R3S A;  3MZW B;  4QDF B;  2BEQ D;  5KLV G;  2Y0C A;  5AW4 B;  1S5L E;  1LTB C;  1FDM A;  4H13 B;  3VMY A;  3M0D C;  1KFM A;  1VQ5 P;  4N6J A;  1HVV A;  2QG4 A;  2DE7 D;  3IAO A;  2Y0D A;  1NTZ K;  2FY8 A;  3RL0 C;  2PP6 A;  1D7M A;  1KIL A;  2B87 A;  1KYO I;  4JYB A;  3AEF C;  1QX8 A;  3IN6 A;  4EYY Q;  5AEU A;  3LW5 J;  1Z56 A;  3B5N A;  3RL0 D;  3WUU A;  2IFM A;  1HUC A;  5DJT B;  4NBD D;  1FJK A;  5TIS H;  4RJT A;  5AVW B;  2FFD B;  2JZA A;  2E4P A;  3NTN A;  1KB9 I;  1KV4 A;  1WT6 A;  2KSJ A;  2ZXX A;  3K5B A;  2HMJ A;  1ZRT D;  4Y99 C;  1Q86 Q;  1L2P A;  1KYO D;  2KLV A;  3H1L D;  3FOU A;  1O7N A;  3CCQ P;  2I1K A;  2AXT E;  4QMA A;  5CJ0 A;  2OYI A;  3OW2 O;  1K8A Q;  4GT1 A;  4KJM A;  1VQN P;  1EDL A;  4EIJ A;  3FX0 A;  1T3U A;  1PP9 E;  2YO2 A;  1KB9 D;  2QJY C;  4LGD E;  1T2K C;  1N86 A;  1L4A B;  3T97 A;  4ZMD A;  2A45 G;  1UII A;  4C7N A;  1IFP A;  2E5T A;  4N3Y B;  1EDK A;  2N1T B;  3L70 E;  2YKP A;  1LP1 B;  1KQS O;  3L71 D;  2W6A A;  3E1I A;  4EDF A;  2HMN A;  4QDF A;  3TGU G;  2R5D A;  3H1I J;  1X8Y A;  2D2C D;  4PV1 D;  1K73 Q;  3H1K G;  3H1J D;  1R8E A;  2ZJS E;  5AVX B;  1ZLL A;  1YJ9 P;  5AVR B;  2IFN A;  3VYI A;  1XTG B;  3HUS B;  1Q2N A;  1RQV A;  1ZOY C;  3MUD C;  1VDF A;  3WU2 E;  3BRV B;  2E74 C;  2Z5I A;  1PGO A;  5EFW B;  1P84 H;  4ZNC A;  4O9B A;  2FFD A;  3GB4 A;  4XE5 B;  4OGQ C;  1KIL D;  1LTA C;  2CKF A;  1LGH B;  5AVQ B;  2SPZ A;  3VMA A;  2N9B A;  2Y9Y A;  1L0L K;  1JO5 A;  1SVF A;  1U57 A;  1MFT A;  1SQB E;  2B89 A;  2HMM A;  2LXB A;  2O3J A;  1YIJ P;  3CPW O;  4NBE D;  1FZC B;  1P84 E;  1ZP0 C;  3G9R A;  2H7H A;  2WPV B;  1QGK B;  1SQP K;  1IK7 A;  2WPR A;  4P1B H;  3B4S A;  3H32 A;  2J59 M;  5H2F E;  1JM0 A;  2NWF A;  3LID A;  1L4A A;  5BU8 B;  3CX5 I;  4IOI H;  1QLE D;  2NZ2 A;  2N1T A;  3HE5 A;  3H1L G;  1LP1 A;  1YBK A;  1PGQ A;  2ZXE B;  2HMO A;  2C0X A;  2OQQ A;  2OTK E;  1KQL A;  3L72 G;  1DX7 A;  1NWQ A;  3H1I E;  1S1C X;  2O01 H;  1BDD A;  1VL2 A;  5M1B A;  4KT0 J;  4JF7 A;  5L8R J;  3BVH A;  1M1J B;  1NU1 D;  3CX5 D;  3CC4 P;  3HUS A;  4L74 A;  5AW7 B;  1RFS A;  1Q90 D;  1S72 P;  4CPG A;  5TJH A;  2Q9I A;  4H13 D;  4HKV A;  1RIE A;  2KYV A;  2BAS A;  2R5B A;  3L71 G;  3RBX A;  3MHV A;  2P7J A;  5KAF E;  2HPC B;  3RK3 C;  1BGY D;  2KZJ A;  2QM7 A;  5AW5 B;  2E76 D;  3B8E B;  4RKU J;  2M0B A;  3I56 P;  2FXM A;  1FZC A;  1JEK A;  4I7Z C;  1USE A;  1MFZ A;  2BCC E;  1L0N K;  5KKZ B; 
#chains in the Genus database with same CATH homology
 2HML A;  3GL0 A;  4EMJ B;  1NTZ E;  1O7M A;  4P1B H;  1PP9 E;  3L72 E;  2NWF A;  3GTS A;  2QJY C;  4HM1 A;  2ZT9 D;  2HMK A;  3H1H E;  3L74 E;  4HM3 A;  3L71 E;  5BOK A;  1UUV A;  3VCA A;  4HM8 A;  4QDD A;  2B1X A;  3L70 E;  2NVG A;  4HM7 A;  2HMO A;  1VM9 A;  2QPZ A;  5KKZ C;  2YFJ A;  2HMN A;  3H1J E;  4P1C H;  4QDF A;  2BMO A;  2QJP C;  1G8J B;  3VMH D;  3H1I E;  2NVE A;  4QDF B;  1NU1 E;  3VMG D;  1NTK E;  2GBW A;  4NBC D;  3CX5 E;  2D2C D;  3C0D A;  1FQT A;  4NB8 D;  4PV1 D;  1BCC E;  2E75 D;  3EN1 A;  2XRX A;  3GL2 A;  1L0L E;  1G8K B;  4NBA D;  1SQX E;  1ULI A;  2E4Q A;  4U3F E;  4NBG D;  1O7P A;  4NB9 D;  4HM5 A;  1ULJ A;  2DE7 D;  4AIV A;  4HM0 A;  4NBF D;  1RFS A;  1PPJ E;  5AEW A;  2E74 D;  3VCP A;  2A06 E;  2JO6 A;  1SQV E;  1L0N E;  2NUK A;  3GOB A;  1EZV E;  1NYK A;  4H44 D;  4H13 D;  2IBZ E;  1RIE A;  4HKV A;  3L75 E;  5AEU A;  4HM4 A;  1NTM E;  4D6T E;  1O7H A;  2YIU C;  1UUW A;  1SQP E;  2YFI A;  1Q90 C;  4NBH D;  1O7G A;  4OGQ D;  4QUP A;  1BGY E;  4AAY B;  3L73 E;  4NBD D;  2ZYL A;  2FYN C;  1VF5 D;  3CWB E;  3GB4 A;  2XSH A;  1VCK A;  3EQQ A;  4PD4 E;  2NVF A;  1EG9 A;  4HJL A;  2BMQ A;  1ZRT E;  2JZA A;  2E4P A;  2GBX A;  3AZC A;  2B24 A;  2CKF A;  4QUQ A;  3D89 A;  1KYO E;  3H1L E;  2QJK C;  5KLI C;  3DQY A;  2E76 D;  4QCK A;  1SJG A;  2HMJ A;  4QDC A;  2YVJ B;  2XR8 A;  3CXH E;  1NDO A;  1WQL A;  3TGU E;  3VMI D;  2YFL A;  4QUR A;  2I7F A;  3FOU A;  3GZX A;  3GTE A;  1O7N A;  4H0L D;  1O7W A;  1SQB E;  2DE6 D;  5KLV E;  2XSO A;  4HM2 A;  4HM6 A;  2HMM A;  1BE3 E;  5HL4 A;  3H1K E;  2FYU E;  1SQQ E;  4NBB D;  2DE5 D;  5CXM A;  4NBE D;  3GCE A;  2BCC E;  3GZY A;  1P84 E;  3BCC E;  3GKE A;  3N0Q A;  2Q3W A;  2BMR A;  2NUM A;  1JM1 A;  1KB9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...