1PP9E

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 54
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1pp9E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1pp9E02
3L74E 2DE7D 1L0LE 3EQQA 1SQQE 4NBGD 2HMKA 2ZYLA 5KLIC 1EG9A 3DQYA 4NBCD 1NTZE 3H1IE 3L72E 1NTME 2JO6A 3L75E 1NU1E 3VMGD 4D6TE 3TGUE 2HMJA 1VF5D 1ULJA 3GZXA 1VCKA 2JZAA 2NWFA 2NVGA 3GTSA 1UUVA 1ZRTE 1BE3E 1G8JB 3N0QA 4NBBD 1UUWA 2NUKA 4NB9D 1L0NE 5HL4A 4HJLA 2BMOA 1O7WA 2YVJB 3GOBA 4HM5A 2HMNA 4QDFA 4AAYB 2BCCE 1PPJE 1Q90C 1RFSA 3GKEA 4HM7A 2FYUE 2DE5D 4QUQA 2QJPC 1VM9A 4HM4A 2HMOA 4QUPA 3GL2A 2DE6D 2IBZE 2GBXA 4NBDD 2B1XA 4P1BH 4AIVA 2XSOA 3H1LE 3GZYA 5AEWA 1PP9E 1SJGA 1BGYE 1EZVE 1ULIA 3GTEA 4QCKA 3VCAA 2A06E 1G8KB 1NYKA 1NTKE 2YFJA 4U3FE 1O7NA 4HM3A 4HM1A 2NVFA 1O7PA 1P84E 3CX5E 2NUMA 2XRXA 2GBWA 3L71E 2HMLA 1O7GA 2QJYC 3AZCA 4H13D 4H44D 4NB8D 1RIEA 2QJKC 5CXMA 4H0LD 2B24A 1O7MA 1FQTA 4HM8A 2BMRA 2E75D 1SQVE 4NBED 4OGQD 3L70E 3FOUA 5KKZC 3L73E 4P1CH 2E76D 4QDDA 3H1HE 3H1KE 1JM1A 2E74D 4NBHD 4HM2A 3GCEA 2HMMA 3VMHD 3CXHE 3EN1A 1SQBE 2QPZA 4QURA 3D89A 2E4PA 2I7FA 1WQLA 5BOKA 2ZT9D 4NBFD 1SQPE 1O7HA 1KB9E 2D2CD 2YIUC 4PV1D 2XR8A 1BCCE 4QDFB 1KYOE 4HKVA 4NBAD 2CKFA 4QDCA 2XSHA 2Q3WA 2YFLA 3GB4A 2BMQA 4HM0A 4HM6A 3BCCE 2YFIA 3VCPA 4PD4E 4EMJB 3H1JE 3CWBE 3C0DA 2E4QA 5AEUA 3VMID 2NVEA 1NDOA 1SQXE 2FYNC 5KLVE 3GL0A
chains in the Genus database with same CATH superfamily
3W68A 3G71P 1L0NJ 2K9YA 3L72J 4HKZH 3AEGC 2IBZI 1KILA 4XFJA 1NYHA 1QL1A 1RF0C 5KAFE 2BEZF 3H1JJ 2Y0CA 3AE4C 3Q1MA 3RL0C 2B87A 1S2EA 4PD4I 1X8YA 1W2EA 4AAYB 4Y28J 2MJZA 1RE4A 1X9VA 3AE1C 3G4SP 1LT9B 3CCLP 2M5AA 5AW8B 1P84I 4GT1A 1E5WA 3CL3D 2POHA 1SJGA 3R4YA 1M1KQ 1G8KB 1KN7A 1VQMP 1EDJA 1RF1B 2Y0EA 1SQBD 2E76B 2XRXA 2OQQA 1NU1K 2WSCH 4D6TG 2E75C 1K73Q 2L5GB 2QJKC 2WSCJ 2QEXP 2HODB 3HE4A 1LTSC 3PH0A 3H1ID 1UIIA 4DT0A 4XE5B 3TDKA 1WQLA 2ZT9D 1LT9C 5KAIE 3GF3A 3Q3DA 1XTGB 1KILE 3F5HA 2QM8A 3CCJP 1GTWA 2RH0A 1D7MA 3LIDA 1AJYA 3EQQA 4NBGD 3BRTB 3CXHD 2E75B 2KLVA 2C0WA 1NTZE 3H1LJ 3L75E 3HD7B 1NU1E 3D70A 1FZAA 2K9JB 2PGDA 1NU1G 5APXA 3FX0A 1SFCC 3VP9A 1BE3E 3I56P 1L0NE 5KJ7A 1YQ3C 1R5LA 1L0NG 2WVRA 1FZFA 3FWLA 4OVNF 2Q3EA 1VM9A 3MUDA 1EDIA 4PJ0H 2W83C 2QIWA 2B1XA 3VN0A 2KLUA 1H8AA 1OWAA 2OYHB 4RKUJ 1KV4A 1S9KE 2P1JA 4ASVA 4U3FE 1YJ9P 1P84D 1RE4C 1N73B 2KUBA 5CMZA 3I5CA 4LC1A 3B71A 1CI6B 2KB7P 1BE3G 1FZCC 1GD2E 5CCGD 1X79B 3GCEA 3AECC 3KXDA 3B5ND 1X0TA 1N7SD 2K88A 1VQKP 1SS1A 2OTLP 2HPCA 3BCCD 2O3JA 1L4AB 2WWWA 4HM0A 1NAYA 3C0DA 4DCKA 1IK9A 3OA7A 3HRNA 4PD4H 2R5BA 3KPEA 3S4RA 1VQLP 1VL2A 3AE6C 5C39A 2ZT9C 2WSFH 1G8JB 1P84H 1GL2C 3VMXA 2AXTH 4PJ0E 3USSA 1LNQA 2Q6QA 3VTPC 2FYNB 3CWBG 1T6AA 3TSIA 3L36A 3H6PA 1IFIA 4HJGH 1ZRTD 2M3BA 4EOTA 5AVYB 1SQPJ 1LTIC 1N7SA 1VF5B 2FYUD 2DW3A 3FXEA 1YQ4C 3II6A 1RE3C 3H1IG 3JSVC 1Y9BA 1YYCA 1DIPA 3VP8A 2JR8A 2ZT9B 4IL6E 3MD0A 1J1EB 1KQSO 5H2FE 4EIJA 2GUVA 4JPZB 4A7PA 2C9LY 1LP1A 1M1JB 1UIXA 2FYZA 2G3AA 5BU8B 3L73J 2R44A 1PGJA 1FBMA 1L0LJ 1YITP 4ASWA 1DEEG 2CKFA 3PLNA 2CK3H 1LTTC 1BGYG 5GTIH 4DJGA 4R4MA 1BE3J 2B89A 4K35A 4C7NA 1JM0A 2XNXA 3H1LG 2E4QA 1M90Q 5APUA 1KILB 2A06G 2W6AA 4UB8H 4Y99B 5KLIC 1L0ND 3H1KD 3L37A 1RHZB 1PV3A 3PJSK 1EQ7A 1HH0A 1LTGC 2FY8A 3IAOA 1PL5A 1RFSA 1SQBK 1KORA 1G1IA 1KFNA 1R5SA 2XSOA 4NPEA 1Q82Q 1VDFA 4JBZA 1OVUA 5AW4B 1URQD 2JEEA 2WTYA 1PGQA 3D6YA 3SSUA 3LIEA 5KLIB 3M9QA 4Y99C 2JO1A 3L71E 5GTHH 2QJYC 1Q2NA 1FDOA 2K37A 2PAJA 2B24A 4HM8A 2YMYA 3L70E 3L4FA 2E76D 3BCCG 2WMMA 3GW6A 1SQBE 2QG4A 1CI6A 5BOKA 3L71G 3LW5H 3A5TA 2R5DA 1LGHB 2PRRA 2ZXEB 2LXBA 3G9RA 1EC5A 4I1LA 1FE6A 1ZP0C 1H88A 3DQYA 3HTKA 5GTIE 3ITKA 2ZYAA 4O9BA 3RK3B 2NPSB 4KT0J 3CWBD 4PD4D 3B5NA 1OFCX 3WUUA 3H1JD 4MN4C 2KZIA 2KSJA 1SQXJ 1QEXA 2RKLA 2OTJP 4OGQC 1PPJE 4R4LA 1L0NK 4QUQA 2FYUG 2QJPC 2YNYA 3LW5J 2GM4A 1N7SC 2LR2A 2OYOA 1QX8A 1KFMA 2I1JA 1JTHB 1HJ0A 3L74J 2KZJA 2HFED 2OYIB 1URQC 3CCEP 3AE2C 1IO4A 1O7PA 4H0LB 5APTA 1NTKK 5CCHC 1KYOD 3L75G 2VRSA 3KDPB 1BGYD 2YKQA 4NBHD 1FDMA 2KNCA 2Q1KA 3H1LD 3WU2H 2HYNA 1DH3A 2E4PA 1VPCA 1G1JA 2QVAA 2A06D 2CPBA 4M3LA 3TYYA 3GLMA 1JCCA 2YFLA 3H1KG 4GODA 3V4WA 1NJIQ 1BSNA 5DJTB 3TK1A 1TU3F 2NZ2A 4N3YB 1BGYJ 3MZWB 2WSSH 2IBZG 3BRVB 1LP1B 1M1JA 2V7QH 1ULJA 3TF5A 2FFDA 1ZR4A 1KD1Q 2WZ7A 1U7JA 1YIJP 4H44C 3MTUE 3OW2O 3RK2C 3O6QB 5TISH 4HM4A 1N7LA 4OWFA 4QUPA 3GZYA 1SQVJ 2WPRA 3GMAA 4RJTA 5AW6B 2C9NY 1SQXG 4N78D 1O7NA 3CCVP 3CC2P 3CX5E 4C46A 3FWNA 1Z56A 3S1KA 2O01J 2I8DA 2R3CA 3L71D 1AVOA 1FZGA 1W5CE 3WU2E 4GOFA 1YTZI 3L73E 3V4QA 4KHXA 3I55P 2Z5IA 2P58A 1RY3A 1T2KC 3KQGA 2HODA 3HE4B 1O7HA 3NMDA 1GL2A 4PV1D 3MGNA 3PP5A 5APYA 4NPDA 4HKVA 4BWNA 2IDBA 1FS0E 1MKMA 3GB4A 1S5LX 3CXHI 3AE3C 4IFDK 2AEFA 5DJUB 5AEUA 1L2PA 3RK3E 1K9MQ 3H1JG 4I2LC 1MFTA 1BCCJ 1LTJB 1IFPA 4ZMDA 1J2JB 1AV1A 3H1HD 1MFZA 3B5NB 2WT7B 2A45G 2YKOA 2JZAA 3H1KJ 1RH5B 2ZVNB 3P32A 3GTSA 3HE5A 5TISE 2FBWC 5AW5B 1O7WA 1HF9A 3MUDC 2E76C 3B4SA 3A3YB 1M1JC 4YXWH 4AUWA 1SFCD 1HGZA 1SQQG 1NTZG 2DE5D 4HM7A 3E1RA 1PPJG 1JO5A 3B8EB 3M0DC 5AVVB 2IZ1A 3GHGB 1SQVD 4CPGA 3VCAA 3L75D 3TNUA 3QH9A 1SP4A 3CCQP 1FZBA 2LKMA 1JY3N 2NUMA 2SPZA 2OGUA 1H89A 3AEBC 1J1DC 4H13D 4H44D 5AVZB 5KKZC 4P1CH 3CC4P 1T3JA 3H1KE 1U7MA 1BDDA 2Q5UA 1E79H 2QPZA 1NTMJ 2I7FA 1FJPA 3BVHA 3KZIE 4BRYB 1BCCE 2E74B 2KSEA 1KB9I 1SFCB 2LXCB 1EZVG 2G8YA 2IBZD 5CBNA 2O1KA 2QJKB 4EMJB 2BCCJ 2AXCA 3SFDC 2HPCB 2BEQD 1NDOA 2NVEA 2V7QJ 1QVGO 4GDOA 2M8RA 2A45I 2RN0A 1EG9A 4NBCD 1OX3A 1J1DB 1FU1A 2HMJA 1VF5D 4HB1A 5CCGC 4ZKUA 2R32A 5CBOA 2AEJA 1JY3P 2NUKA 1VQNP 4HJLA 2BMOA 3IF4A 2QA4P 1HWTC 3GOBA 4HM5A 1SQXD 2N9BA 3GKEA 2FYUE 3A0BH 3HUSA 3CCRP 1Q81Q 3GL2A 5APSA 3VMAA 3H1LE 4GKGA 5M1BA 4U7JA 1LTJA 5AW7B 1S9KD 1EZVE 4QCKA 3IR9A 1NYKA 2KYVA 1ZW0A 4JYCA 1YBKA 4C7RA 3CLQA 1NHLA 4W7YA 3L35A 1N2DC 2XZRA 2NPSC 2O01H 2YMKA 1AQTA 3V5BA 5KTBA 5CXMA 4H0LD 1AVYA 2FFDC 2B87B 2ZFCA 3C8VA 1VQPP 1FAVA 5B66H 3FOUA 1PP9J 3H1HE 2E74D 3JCUH 3RL0D 3QWOC 1JY2N 1KB9E 1IC2A 1KYOE 1N7SB 5AVRB 3AEFC 1FOSF 1GL2B 1OW6A 2Z4EA 5AVTB 3H1HG 4IL6X 1PGOA 2K1AA 1L4AA 1NTKG 1YTZT 5B5EH 2IZ0A 1LWUC 2OYIC 1SQQE 1JCDA 4LGDE 2ZYLA 1VQ8P 4H0LC 2HR3A 4BXLA 2JO6A 1KQLA 1JB0J 1SQQD 1NTZD 3AEEC 3TGUE 1PPJD 3P8MC 1HJBA 1NTZJ 3P8CD 2NVGA 2NWFA 1JOCA 3HE5B 1VF5C 1SQVG 1HTLC 3ABVC 2JP3A 1IFMA 3KYQA 1X22A 4QDFA 1SQPG 1S5LE 2KK7A 2OTKE 1FC2C 2H43A 2DE6D 2GBXA 1KYOI 2Q7CA 5AVXB 3GTEA 1YJNP 1SQQJ 1DX7A 3MIWA 1KB9D 5KJ7D 1LWUB 2YFJA 2ZYDA 2IPPA 2NVFA 2WPVB 1O7GA 1G2CB 1MV8A 4NB8D 1U57A 1T3UA 4OGQD 3M9BA 1YJWP 1EZVD 1IFNA 3CXHH 2HMMA 3GHGA 2ZJSE 2W6BA 4NBFD 2BCCG 2D2CD 1GZLA 3Q5PA 4U3FG 3BATA 2IX7C 1QGKB 3A0HH 2H89C 2NPSA 3EFGA 1GU5A 2BMQA 2NRGA 4YPCA 3BCCJ 3L73G 1J1EC 2Z5HA 3VMID 4JQ0D 2FXOA 5CCHD 1L4AD 4AYCA 2P10A 1W2BO 3PHLA 2H8PD 1KB9H 3H1IE 4WY4B 4WVZA 3SWYA 3Q5SA 1ZLLA 1NGMB 1ZR2A 3GG2A 1ZRTE 3L70J 2FXPA 1UUWA 5AVWB 2HMNA 2WSEJ 1GMJA 2ZVOB 1SLQA 3CX5I 1N8RQ 3V2QA 4PV1C 1URQA 2JKVA 1ZMEC 1BCCD 1KC8Q 1ZN5A 5CHXA 2XDJA 4ZKPA 1OVVA 2YXQB 1VQ6P 4LLHA 2OYHA 4UB6H 3FXDA 2E75D 3H25A 2WITA 2XV5A 4Z1MH 3L74G 1YHQP 2IFNA 1JMMA 4K3AA 3D89A 1NTKD 2YKPA 1OZHA 2OYIA 3G3ZA 1JY3O 2GA1A 3GHGC 2R3SA 1AFOA 2YFIA 1L0LK 1LTAC 3AEAC 1L0LE 2QJPB 5B66E 2KI7B 1ZOYC 1SQXK 2JWAA 4HH2A 5AW2B 2PFXA 1SQPD 5APWA 4D6TE 1JY2O 3L70D 5KAFH 3RK3D 5APQA 4YTPC 2JDIH 1WRGA 3AE9C 2D2CC 3E1IA 4NBBD 1RF1C 5HL4A 1IZNB 2J59M 3T97A 5E79E 5E79H 2BCCE 1Q90C 2KXPB 2L91A 1Q86Q 1H0TB 2M3EA 3V2RA 2HMOA 2ITAA 2ZYGA 1ULIA 3OJAB 3W67A 1NTKE 1LWUA 2WPQA 4UB6E 2KOGA 1NTMK 1P84E 1KYOH 1IJDB 1SQQK 4OGQB 3CX5D 2BCCD 1RE3A 4U3FD 5TJHA 2D2CB 4NBED 1USDA 1Y8AA 2W6JH 2C0XA 1Q90D 4D6TJ 3N7NA 2HLOA 1VQ7P 3EN1A 3L73D 1OIPA 2FYUK 4QURA 4L73A 3IN6A 4EDFA 1URQB 1NTMD 4QDFB 1PZQA 2OARA 4GIFA 1K8AQ 5K5GB 3V2NA 3PRJA 2AXTE 3RK2B 1NU1J 3H32B 2WSFJ 2E43A 5AW3B 3V6IA 5AW0B 2P7JA 2UWJE 4L76A 4EI2A 1M7LA 3HD7A 1PP9D 2JWDA 3AE7C 1G2CA 1NTZK 3WUTA 4DOJA 3CCSP 1L0LD 2FFDB 2W90A 3P7KA 1FDIA 1Q7YQ 4DZOA 1QL2A 2YVJB 4H13B 4AQRD 3NTNA 1GL2D 4W80A 1BCCG 1SQPK 2I1KA 5AW9B 5CCHA 5BVZA 3SWKA 4NBDD 3WUVA 1H0TA 1EXIA 2WPSA 4KJMA 1BGYE 3L72D 2E5YA 2WT7A 1MZ9A 3N4XA 3L74D 3CWBJ 1M57D 4H44B 1IK7A 2RMZA 3SFEC 1FJKA 1YI2P 2BASA 1S3JA 1L4AC 1QLED 1CW5A 4QMAA 2KNCB 2ZAEB 1O7MA 1FQTA 4RESB 4JF7A 1USEA 1CSBA 1NKNA 1OMIA 1KMIZ 2N1TB 4H13C 3VMZA 1LT1A 1S72P 2YO2A 3H1IJ 3E7KA 1JUNA 1RQUA 1NO4A 3H32A 1BDCA 3C1LA 1LT9A 2HG5D 5KLVK 1HVVA 3BCCE 2WSEH 5KAIH 3L70G 4OH8B 3D71A 3H1JE 1NOHA 1OXZA 2H88C 1WMKA 3G6EP 1NWQA 2FYNC 3CCUP 1NH4A 3L74E 2DE7D 3VMYA 4C7NB 3M06A 1FZCA 3L72E 1PGPA 3CPWO 1NAFA 3O8ZA 4BRYA 3U1AA 3A0BE 4NB9D 2N1TC 1CZQA 2H7HA 4IL6H 5H2FH 1LTJC 4WY4A 1EXJA 2M0BA 5KKZB 5AEWA 3VYIA 3HUSB 1PP9E 2K3RA 1LTBC 3PTZA 1M8OB 4HM3A 1GK4A 2QSIA 3O6QA 5AVSB 4L74A 5CCGA 2N9YB 1NTMG 4N6JA 1RIEA 1JTHA 3MHVA 2N1TD 2BMRA 4W7ZA 3UIAA 3RL0B 1T2KD 2Q3IA 2NPSD 3TGUJ 3P8CE 1AQ5A 3CXHE 3EWKA 3TGUD 2KS1B 3EFFK 2YIUC 2E42A 1EDKA 3KZIH 3JCUE 4RO0A 5APVA 3CCMP 2B88A 3RBXA 2XSHA 2Q3WA 3A0HE 1IFJA 4HM6A 1PP9G 4PD4E 4I7ZC 3CWBE 1L0LG 1SQXE 2B9BA 1OW7A 2QM7A 2M5AB 1JMBA 4B86A 5KLVJ 5B5EE 1GW3A 1JY2P 2E74C 3WMM0 3H1HJ 3RL0g 2V4HA 1KTMA 2A45H 1RF1A 3ZDMA 3L72G 4IFMA 2YIUB 5CJ4A 3U59A 2O01N 5AVUB 2N1TA 2IBZE 4P1BH 4AIVA 4I7ZB 1PIXA 5EFWB 2AEMA 5KLVD 2KP8A 1SQBJ 1MUUA 2FKWB 3SWFA 2FYUJ 2GBWA 2CPSA 4I6MC 3HD7C 2HMLA 3AZCA 5KJ7C 3MP7B 1S1CX 4TLFA 1RF0A 3L71J 4QDDA 3GF7A 3K5BA 4ZNCA 1EDLA 3M0DA 4IFFA 3D6ZA 3V2PA 3RK3C 2GUSA 1VQ5P 1OW8A 2IYOA 2WQYC 3A2AA 3NFQA 2QJYB 3HTKB 4QDCA 2MKVA 3A7OA 2P2UA 2PP6A 2OYHC 1N86A 3M9HA 2KIKA 4WBAA 2HMKA 1WT6A 1GW4A 1NTME 2XNDH 1N73A 3Q5RA 1N73C 4WWIA 1SQVK 3R2PA 4IOIH 4YXDC 5CJ0A 1FZCB 1UUVA 2JJLA 1EZVI 2J58A 4L75A 4UB8E 1S5LH 3RK2D 1HBWA 3Q2YA 3OAKA 2ZXXA 1A02F 3CD6P 4NPFX 1AA0A 1ZXGA 4HM1A 1QVFO 5BU5A 2XKMA 3M0AA 1GU4A 1A02J 3TGUG 2K9JA 1KZUB 1JNMA 3CC7P 1ZV8A 1K05A 1SQVE 3JC22 3CMAP 4TT3H 3M91A 1SQBG 4HM2A 1NTKJ 3BASA 4D6TD 1SQPE 2QRXA 2W27A 2XR8A 2Y0DA 1DEBA 4NBAD 4JYBA 1FZEA 1M56D 4HYTB 3VCPA 3AEDC 4WY4D 3VOPA 4U3FJ 1DD3A 5KLVE 1K04A 2O1JA 3IFMA 3FGAD 3AE5C 3TNUB 1NKZB 3EQ2A 1HGVA 3VMGD 1R8EA 2XU6A 4WB4A 2Y9ZA 3GZXA 1VCKA 4GOEA 3S9OA 3N0QA 3CX5H 1KQFB 2YO3A 3AE8C 1FOSE 5L8RJ 3RBZA 2IYPA 1VQOP 1HUCA 5KLVG 2P67A 1VQ9P 1GDTA 1XTCC 3CMEP 1SFCA 3F89A 1NU1D 3T97B 1KILD 1PFIA 4WY4C 3L75J 2IFMA 1S4XA 2Y9YA 1Y47A 5AW1B 2A06E 1KILC 3HD7D 2Q9IA 1BSHA 4N78E 1SVFA 4XA4A 1GK6A 3NXSA 1NVOA 1JM1A 2KS1A 2YXRB 1JEKA 4PV1B 3VMHD 1T8ZA 1IFDA 1RQVA 5AVQB 2J5UA 3CI9A 2QE7H 3B5NC 1OVRA 2FXMA 3C9IA 3U1CA 3KHUA 1BE3D 2W8ZA 1VQ4P 1DD4A 1KQGB 3RGUA 1LJ2A 2E5TA 3HUSC 5GTHE 4EYYQ 3GL0A
chains in the Genus database with same CATH topology
3L74E 2DE7D 1L0LE 3EQQA 1SQQE 4NBGD 2HMKA 2ZYLA 5KLIC 1EG9A 3DQYA 4NBCD 1NTZE 3H1IE 3L72E 1NTME 2JO6A 3L75E 1NU1E 3VMGD 4D6TE 3TGUE 2HMJA 1VF5D 1ULJA 3GZXA 1VCKA 2JZAA 2NWFA 2NVGA 3GTSA 1UUVA 1ZRTE 1BE3E 1G8JB 3N0QA 4NBBD 1UUWA 2NUKA 4NB9D 1L0NE 5HL4A 4HJLA 2BMOA 1O7WA 2YVJB 3GOBA 4HM5A 2HMNA 4QDFA 4AAYB 2BCCE 1PPJE 1Q90C 1RFSA 3GKEA 4HM7A 2FYUE 2DE5D 4QUQA 2QJPC 1VM9A 4HM4A 2HMOA 4QUPA 3GL2A 2DE6D 2IBZE 2GBXA 4NBDD 2B1XA 4P1BH 4AIVA 2XSOA 3H1LE 3GZYA 5AEWA 1PP9E 1SJGA 1BGYE 1EZVE 1ULIA 3GTEA 4QCKA 3VCAA 2A06E 1G8KB 1NYKA 1NTKE 2YFJA 4U3FE 1O7NA 4HM3A 4HM1A 2NVFA 1O7PA 1P84E 3CX5E 2NUMA 2XRXA 2GBWA 3L71E 2HMLA 1O7GA 2QJYC 3AZCA 4H13D 4H44D 4NB8D 1RIEA 2QJKC 5CXMA 4H0LD 2B24A 1O7MA 1FQTA 4HM8A 2BMRA 2E75D 1SQVE 4NBED 4OGQD 3L70E 3FOUA 5KKZC 3L73E 4P1CH 2E76D 4QDDA 3H1HE 3H1KE 1JM1A 2E74D 4NBHD 4HM2A 3GCEA 2HMMA 3VMHD 3CXHE 3EN1A 1SQBE 2QPZA 4QURA 3D89A 2E4PA 2I7FA 1WQLA 5BOKA 2ZT9D 4NBFD 1SQPE 1O7HA 1KB9E 2D2CD 2YIUC 4PV1D 2XR8A 1BCCE 4QDFB 1KYOE 4HKVA 4NBAD 2CKFA 4QDCA 2XSHA 2Q3WA 2YFLA 3GB4A 2BMQA 4HM0A 4HM6A 3BCCE 2YFIA 3VCPA 4PD4E 4EMJB 3H1JE 3CWBE 3C0DA 2E4QA 5AEUA 3VMID 2NVEA 1NDOA 1SQXE 2FYNC 5KLVE 3GL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 E;  2DE7 D;  1L0L E;  3EQQ A;  1SQQ E;  4NBG D;  2HMK A;  2ZYL A;  5KLI C;  1EG9 A;  3DQY A;  4NBC D;  1NTZ E;  3H1I E;  3L72 E;  1NTM E;  2JO6 A;  3L75 E;  1NU1 E;  3VMG D;  4D6T E;  3TGU E;  2HMJ A;  1VF5 D;  1ULJ A;  3GZX A;  1VCK A;  2JZA A;  2NWF A;  2NVG A;  3GTS A;  1UUV A;  1ZRT E;  1BE3 E;  1G8J B;  3N0Q A;  4NBB D;  1UUW A;  2NUK A;  4NB9 D;  1L0N E;  5HL4 A;  4HJL A;  2BMO A;  1O7W A;  2YVJ B;  3GOB A;  4HM5 A;  2HMN A;  4QDF A;  4AAY B;  2BCC E;  1PPJ E;  1Q90 C;  1RFS A;  3GKE A;  4HM7 A;  2FYU E;  2DE5 D;  4QUQ A;  2QJP C;  1VM9 A;  4HM4 A;  2HMO A;  4QUP A;  3GL2 A;  2DE6 D;  2IBZ E;  2GBX A;  4NBD D;  2B1X A;  4P1B H;  4AIV A;  2XSO A;  3H1L E;  3GZY A;  5AEW A;  1PP9 E;  1SJG A;  1BGY E;  1EZV E;  1ULI A;  3GTE A;  4QCK A;  3VCA A;  2A06 E;  1G8K B;  1NYK A;  1NTK E;  2YFJ A;  4U3F E;  1O7N A;  4HM3 A;  4HM1 A;  2NVF A;  1O7P A;  1P84 E;  3CX5 E;  2NUM A;  2XRX A;  2GBW A;  3L71 E;  2HML A;  1O7G A;  2QJY C;  3AZC A;  4H13 D;  4H44 D;  4NB8 D;  1RIE A;  2QJK C;  5CXM A;  4H0L D;  2B24 A;  1O7M A;  1FQT A;  4HM8 A;  2BMR A;  2E75 D;  1SQV E;  4NBE D;  4OGQ D;  3L70 E;  3FOU A;  5KKZ C;  3L73 E;  4P1C H;  2E76 D;  4QDD A;  3H1H E;  3H1K E;  1JM1 A;  2E74 D;  4NBH D;  4HM2 A;  3GCE A;  2HMM A;  3VMH D;  3CXH E;  3EN1 A;  1SQB E;  2QPZ A;  4QUR A;  3D89 A;  2E4P A;  2I7F A;  1WQL A;  5BOK A;  2ZT9 D;  4NBF D;  1SQP E;  1O7H A;  1KB9 E;  2D2C D;  2YIU C;  4PV1 D;  2XR8 A;  1BCC E;  4QDF B;  1KYO E;  4HKV A;  4NBA D;  2CKF A;  4QDC A;  2XSH A;  2Q3W A;  2YFL A;  3GB4 A;  2BMQ A;  4HM0 A;  4HM6 A;  3BCC E;  2YFI A;  3VCP A;  4PD4 E;  4EMJ B;  3H1J E;  3CWB E;  3C0D A;  2E4Q A;  5AEU A;  3VMI D;  2NVE A;  1NDO A;  1SQX E;  2FYN C;  5KLV E;  3GL0 A; 
#chains in the Genus database with same CATH topology
 3W68 A;  3G71 P;  1L0N J;  2K9Y A;  3L72 J;  4HKZ H;  3AEG C;  2IBZ I;  1KIL A;  4XFJ A;  1NYH A;  1QL1 A;  1RF0 C;  5KAF E;  2BEZ F;  3H1J J;  2Y0C A;  3AE4 C;  3Q1M A;  3RL0 C;  2B87 A;  1S2E A;  4PD4 I;  1X8Y A;  1W2E A;  4AAY B;  4Y28 J;  2MJZ A;  1RE4 A;  1X9V A;  3AE1 C;  3G4S P;  1LT9 B;  3CCL P;  2M5A A;  5AW8 B;  1P84 I;  4GT1 A;  1E5W A;  3CL3 D;  2POH A;  1SJG A;  3R4Y A;  1M1K Q;  1G8K B;  1KN7 A;  1VQM P;  1EDJ A;  1RF1 B;  2Y0E A;  1SQB D;  2E76 B;  2XRX A;  2OQQ A;  1NU1 K;  2WSC H;  4D6T G;  2E75 C;  1K73 Q;  2L5G B;  2QJK C;  2WSC J;  2QEX P;  2HOD B;  3HE4 A;  1LTS C;  3PH0 A;  3H1I D;  1UII A;  4DT0 A;  4XE5 B;  3TDK A;  1WQL A;  2ZT9 D;  1LT9 C;  5KAI E;  3GF3 A;  3Q3D A;  1XTG B;  1KIL E;  3F5H A;  2QM8 A;  3CCJ P;  1GTW A;  2RH0 A;  1D7M A;  3LID A;  1AJY A;  3EQQ A;  4NBG D;  3BRT B;  3CXH D;  2E75 B;  2KLV A;  2C0W A;  1NTZ E;  3H1L J;  3L75 E;  3HD7 B;  1NU1 E;  3D70 A;  1FZA A;  2K9J B;  2PGD A;  1NU1 G;  5APX A;  3FX0 A;  1SFC C;  3VP9 A;  1BE3 E;  3I56 P;  1L0N E;  5KJ7 A;  1YQ3 C;  1R5L A;  1L0N G;  2WVR A;  1FZF A;  3FWL A;  4OVN F;  2Q3E A;  1VM9 A;  3MUD A;  1EDI A;  4PJ0 H;  2W83 C;  2QIW A;  2B1X A;  3VN0 A;  2KLU A;  1H8A A;  1OWA A;  2OYH B;  4RKU J;  1KV4 A;  1S9K E;  2P1J A;  4ASV A;  4U3F E;  1YJ9 P;  1P84 D;  1RE4 C;  1N73 B;  2KUB A;  5CMZ A;  3I5C A;  4LC1 A;  3B71 A;  1CI6 B;  2KB7 P;  1BE3 G;  1FZC C;  1GD2 E;  5CCG D;  1X79 B;  3GCE A;  3AEC C;  3KXD A;  3B5N D;  1X0T A;  1N7S D;  2K88 A;  1VQK P;  1SS1 A;  2OTL P;  2HPC A;  3BCC D;  2O3J A;  1L4A B;  2WWW A;  4HM0 A;  1NAY A;  3C0D A;  4DCK A;  1IK9 A;  3OA7 A;  3HRN A;  4PD4 H;  2R5B A;  3KPE A;  3S4R A;  1VQL P;  1VL2 A;  3AE6 C;  5C39 A;  2ZT9 C;  2WSF H;  1G8J B;  1P84 H;  1GL2 C;  3VMX A;  2AXT H;  4PJ0 E;  3USS A;  1LNQ A;  2Q6Q A;  3VTP C;  2FYN B;  3CWB G;  1T6A A;  3TSI A;  3L36 A;  3H6P A;  1IFI A;  4HJG H;  1ZRT D;  2M3B A;  4EOT A;  5AVY B;  1SQP J;  1LTI C;  1N7S A;  1VF5 B;  2FYU D;  2DW3 A;  3FXE A;  1YQ4 C;  3II6 A;  1RE3 C;  3H1I G;  3JSV C;  1Y9B A;  1YYC A;  1DIP A;  3VP8 A;  2JR8 A;  2ZT9 B;  4IL6 E;  3MD0 A;  1J1E B;  1KQS O;  5H2F E;  4EIJ A;  2GUV A;  4JPZ B;  4A7P A;  2C9L Y;  1LP1 A;  1M1J B;  1UIX A;  2FYZ A;  2G3A A;  5BU8 B;  3L73 J;  2R44 A;  1PGJ A;  1FBM A;  1L0L J;  1YIT P;  4ASW A;  1DEE G;  2CKF A;  3PLN A;  2CK3 H;  1LTT C;  1BGY G;  5GTI H;  4DJG A;  4R4M A;  1BE3 J;  2B89 A;  4K35 A;  4C7N A;  1JM0 A;  2XNX A;  3H1L G;  2E4Q A;  1M90 Q;  5APU A;  1KIL B;  2A06 G;  2W6A A;  4UB8 H;  4Y99 B;  5KLI C;  1L0N D;  3H1K D;  3L37 A;  1RHZ B;  1PV3 A;  3PJS K;  1EQ7 A;  1HH0 A;  1LTG C;  2FY8 A;  3IAO A;  1PL5 A;  1RFS A;  1SQB K;  1KOR A;  1G1I A;  1KFN A;  1R5S A;  2XSO A;  4NPE A;  1Q82 Q;  1VDF A;  4JBZ A;  1OVU A;  5AW4 B;  1URQ D;  2JEE A;  2WTY A;  1PGQ A;  3D6Y A;  3SSU A;  3LIE A;  5KLI B;  3M9Q A;  4Y99 C;  2JO1 A;  3L71 E;  5GTH H;  2QJY C;  1Q2N A;  1FDO A;  2K37 A;  2PAJ A;  2B24 A;  4HM8 A;  2YMY A;  3L70 E;  3L4F A;  2E76 D;  3BCC G;  2WMM A;  3GW6 A;  1SQB E;  2QG4 A;  1CI6 A;  5BOK A;  3L71 G;  3LW5 H;  3A5T A;  2R5D A;  1LGH B;  2PRR A;  2ZXE B;  2LXB A;  3G9R A;  1EC5 A;  4I1L A;  1FE6 A;  1ZP0 C;  1H88 A;  3DQY A;  3HTK A;  5GTI E;  3ITK A;  2ZYA A;  4O9B A;  3RK3 B;  2NPS B;  4KT0 J;  3CWB D;  4PD4 D;  3B5N A;  1OFC X;  3WUU A;  3H1J D;  4MN4 C;  2KZI A;  2KSJ A;  1SQX J;  1QEX A;  2RKL A;  2OTJ P;  4OGQ C;  1PPJ E;  4R4L A;  1L0N K;  4QUQ A;  2FYU G;  2QJP C;  2YNY A;  3LW5 J;  2GM4 A;  1N7S C;  2LR2 A;  2OYO A;  1QX8 A;  1KFM A;  2I1J A;  1JTH B;  1HJ0 A;  3L74 J;  2KZJ A;  2HFE D;  2OYI B;  1URQ C;  3CCE P;  3AE2 C;  1IO4 A;  1O7P A;  4H0L B;  5APT A;  1NTK K;  5CCH C;  1KYO D;  3L75 G;  2VRS A;  3KDP B;  1BGY D;  2YKQ A;  4NBH D;  1FDM A;  2KNC A;  2Q1K A;  3H1L D;  3WU2 H;  2HYN A;  1DH3 A;  2E4P A;  1VPC A;  1G1J A;  2QVA A;  2A06 D;  2CPB A;  4M3L A;  3TYY A;  3GLM A;  1JCC A;  2YFL A;  3H1K G;  4GOD A;  3V4W A;  1NJI Q;  1BSN A;  5DJT B;  3TK1 A;  1TU3 F;  2NZ2 A;  4N3Y B;  1BGY J;  3MZW B;  2WSS H;  2IBZ G;  3BRV B;  1LP1 B;  1M1J A;  2V7Q H;  1ULJ A;  3TF5 A;  2FFD A;  1ZR4 A;  1KD1 Q;  2WZ7 A;  1U7J A;  1YIJ P;  4H44 C;  3MTU E;  3OW2 O;  3RK2 C;  3O6Q B;  5TIS H;  4HM4 A;  1N7L A;  4OWF A;  4QUP A;  3GZY A;  1SQV J;  2WPR A;  3GMA A;  4RJT A;  5AW6 B;  2C9N Y;  1SQX G;  4N78 D;  1O7N A;  3CCV P;  3CC2 P;  3CX5 E;  4C46 A;  3FWN A;  1Z56 A;  3S1K A;  2O01 J;  2I8D A;  2R3C A;  3L71 D;  1AVO A;  1FZG A;  1W5C E;  3WU2 E;  4GOF A;  1YTZ I;  3L73 E;  3V4Q A;  4KHX A;  3I55 P;  2Z5I A;  2P58 A;  1RY3 A;  1T2K C;  3KQG A;  2HOD A;  3HE4 B;  1O7H A;  3NMD A;  1GL2 A;  4PV1 D;  3MGN A;  3PP5 A;  5APY A;  4NPD A;  4HKV A;  4BWN A;  2IDB A;  1FS0 E;  1MKM A;  3GB4 A;  1S5L X;  3CXH I;  3AE3 C;  4IFD K;  2AEF A;  5DJU B;  5AEU A;  1L2P A;  3RK3 E;  1K9M Q;  3H1J G;  4I2L C;  1MFT A;  1BCC J;  1LTJ B;  1IFP A;  4ZMD A;  1J2J B;  1AV1 A;  3H1H D;  1MFZ A;  3B5N B;  2WT7 B;  2A45 G;  2YKO A;  2JZA A;  3H1K J;  1RH5 B;  2ZVN B;  3P32 A;  3GTS A;  3HE5 A;  5TIS E;  2FBW C;  5AW5 B;  1O7W A;  1HF9 A;  3MUD C;  2E76 C;  3B4S A;  3A3Y B;  1M1J C;  4YXW H;  4AUW A;  1SFC D;  1HGZ A;  1SQQ G;  1NTZ G;  2DE5 D;  4HM7 A;  3E1R A;  1PPJ G;  1JO5 A;  3B8E B;  3M0D C;  5AVV B;  2IZ1 A;  3GHG B;  1SQV D;  4CPG A;  3VCA A;  3L75 D;  3TNU A;  3QH9 A;  1SP4 A;  3CCQ P;  1FZB A;  2LKM A;  1JY3 N;  2NUM A;  2SPZ A;  2OGU A;  1H89 A;  3AEB C;  1J1D C;  4H13 D;  4H44 D;  5AVZ B;  5KKZ C;  4P1C H;  3CC4 P;  1T3J A;  3H1K E;  1U7M A;  1BDD A;  2Q5U A;  1E79 H;  2QPZ A;  1NTM J;  2I7F A;  1FJP A;  3BVH A;  3KZI E;  4BRY B;  1BCC E;  2E74 B;  2KSE A;  1KB9 I;  1SFC B;  2LXC B;  1EZV G;  2G8Y A;  2IBZ D;  5CBN A;  2O1K A;  2QJK B;  4EMJ B;  2BCC J;  2AXC A;  3SFD C;  2HPC B;  2BEQ D;  1NDO A;  2NVE A;  2V7Q J;  1QVG O;  4GDO A;  2M8R A;  2A45 I;  2RN0 A;  1EG9 A;  4NBC D;  1OX3 A;  1J1D B;  1FU1 A;  2HMJ A;  1VF5 D;  4HB1 A;  5CCG C;  4ZKU A;  2R32 A;  5CBO A;  2AEJ A;  1JY3 P;  2NUK A;  1VQN P;  4HJL A;  2BMO A;  3IF4 A;  2QA4 P;  1HWT C;  3GOB A;  4HM5 A;  1SQX D;  2N9B A;  3GKE A;  2FYU E;  3A0B H;  3HUS A;  3CCR P;  1Q81 Q;  3GL2 A;  5APS A;  3VMA A;  3H1L E;  4GKG A;  5M1B A;  4U7J A;  1LTJ A;  5AW7 B;  1S9K D;  1EZV E;  4QCK A;  3IR9 A;  1NYK A;  2KYV A;  1ZW0 A;  4JYC A;  1YBK A;  4C7R A;  3CLQ A;  1NHL A;  4W7Y A;  3L35 A;  1N2D C;  2XZR A;  2NPS C;  2O01 H;  2YMK A;  1AQT A;  3V5B A;  5KTB A;  5CXM A;  4H0L D;  1AVY A;  2FFD C;  2B87 B;  2ZFC A;  3C8V A;  1VQP P;  1FAV A;  5B66 H;  3FOU A;  1PP9 J;  3H1H E;  2E74 D;  3JCU H;  3RL0 D;  3QWO C;  1JY2 N;  1KB9 E;  1IC2 A;  1KYO E;  1N7S B;  5AVR B;  3AEF C;  1FOS F;  1GL2 B;  1OW6 A;  2Z4E A;  5AVT B;  3H1H G;  4IL6 X;  1PGO A;  2K1A A;  1L4A A;  1NTK G;  1YTZ T;  5B5E H;  2IZ0 A;  1LWU C;  2OYI C;  1SQQ E;  1JCD A;  4LGD E;  2ZYL A;  1VQ8 P;  4H0L C;  2HR3 A;  4BXL A;  2JO6 A;  1KQL A;  1JB0 J;  1SQQ D;  1NTZ D;  3AEE C;  3TGU E;  1PPJ D;  3P8M C;  1HJB A;  1NTZ J;  3P8C D;  2NVG A;  2NWF A;  1JOC A;  3HE5 B;  1VF5 C;  1SQV G;  1HTL C;  3ABV C;  2JP3 A;  1IFM A;  3KYQ A;  1X22 A;  4QDF A;  1SQP G;  1S5L E;  2KK7 A;  2OTK E;  1FC2 C;  2H43 A;  2DE6 D;  2GBX A;  1KYO I;  2Q7C A;  5AVX B;  3GTE A;  1YJN P;  1SQQ J;  1DX7 A;  3MIW A;  1KB9 D;  5KJ7 D;  1LWU B;  2YFJ A;  2ZYD A;  2IPP A;  2NVF A;  2WPV B;  1O7G A;  1G2C B;  1MV8 A;  4NB8 D;  1U57 A;  1T3U A;  4OGQ D;  3M9B A;  1YJW P;  1EZV D;  1IFN A;  3CXH H;  2HMM A;  3GHG A;  2ZJS E;  2W6B A;  4NBF D;  2BCC G;  2D2C D;  1GZL A;  3Q5P A;  4U3F G;  3BAT A;  2IX7 C;  1QGK B;  3A0H H;  2H89 C;  2NPS A;  3EFG A;  1GU5 A;  2BMQ A;  2NRG A;  4YPC A;  3BCC J;  3L73 G;  1J1E C;  2Z5H A;  3VMI D;  4JQ0 D;  2FXO A;  5CCH D;  1L4A D;  4AYC A;  2P10 A;  1W2B O;  3PHL A;  2H8P D;  1KB9 H;  3H1I E;  4WY4 B;  4WVZ A;  3SWY A;  3Q5S A;  1ZLL A;  1NGM B;  1ZR2 A;  3GG2 A;  1ZRT E;  3L70 J;  2FXP A;  1UUW A;  5AVW B;  2HMN A;  2WSE J;  1GMJ A;  2ZVO B;  1SLQ A;  3CX5 I;  1N8R Q;  3V2Q A;  4PV1 C;  1URQ A;  2JKV A;  1ZME C;  1BCC D;  1KC8 Q;  1ZN5 A;  5CHX A;  2XDJ A;  4ZKP A;  1OVV A;  2YXQ B;  1VQ6 P;  4LLH A;  2OYH A;  4UB6 H;  3FXD A;  2E75 D;  3H25 A;  2WIT A;  2XV5 A;  4Z1M H;  3L74 G;  1YHQ P;  2IFN A;  1JMM A;  4K3A A;  3D89 A;  1NTK D;  2YKP A;  1OZH A;  2OYI A;  3G3Z A;  1JY3 O;  2GA1 A;  3GHG C;  2R3S A;  1AFO A;  2YFI A;  1L0L K;  1LTA C;  3AEA C;  1L0L E;  2QJP B;  5B66 E;  2KI7 B;  1ZOY C;  1SQX K;  2JWA A;  4HH2 A;  5AW2 B;  2PFX A;  1SQP D;  5APW A;  4D6T E;  1JY2 O;  3L70 D;  5KAF H;  3RK3 D;  5APQ A;  4YTP C;  2JDI H;  1WRG A;  3AE9 C;  2D2C C;  3E1I A;  4NBB D;  1RF1 C;  5HL4 A;  1IZN B;  2J59 M;  3T97 A;  5E79 E;  5E79 H;  2BCC E;  1Q90 C;  2KXP B;  2L91 A;  1Q86 Q;  1H0T B;  2M3E A;  3V2R A;  2HMO A;  2ITA A;  2ZYG A;  1ULI A;  3OJA B;  3W67 A;  1NTK E;  1LWU A;  2WPQ A;  4UB6 E;  2KOG A;  1NTM K;  1P84 E;  1KYO H;  1IJD B;  1SQQ K;  4OGQ B;  3CX5 D;  2BCC D;  1RE3 A;  4U3F D;  5TJH A;  2D2C B;  4NBE D;  1USD A;  1Y8A A;  2W6J H;  2C0X A;  1Q90 D;  4D6T J;  3N7N A;  2HLO A;  1VQ7 P;  3EN1 A;  3L73 D;  1OIP A;  2FYU K;  4QUR A;  4L73 A;  3IN6 A;  4EDF A;  1URQ B;  1NTM D;  4QDF B;  1PZQ A;  2OAR A;  4GIF A;  1K8A Q;  5K5G B;  3V2N A;  3PRJ A;  2AXT E;  3RK2 B;  1NU1 J;  3H32 B;  2WSF J;  2E43 A;  5AW3 B;  3V6I A;  5AW0 B;  2P7J A;  2UWJ E;  4L76 A;  4EI2 A;  1M7L A;  3HD7 A;  1PP9 D;  2JWD A;  3AE7 C;  1G2C A;  1NTZ K;  3WUT A;  4DOJ A;  3CCS P;  1L0L D;  2FFD B;  2W90 A;  3P7K A;  1FDI A;  1Q7Y Q;  4DZO A;  1QL2 A;  2YVJ B;  4H13 B;  4AQR D;  3NTN A;  1GL2 D;  4W80 A;  1BCC G;  1SQP K;  2I1K A;  5AW9 B;  5CCH A;  5BVZ A;  3SWK A;  4NBD D;  3WUV A;  1H0T A;  1EXI A;  2WPS A;  4KJM A;  1BGY E;  3L72 D;  2E5Y A;  2WT7 A;  1MZ9 A;  3N4X A;  3L74 D;  3CWB J;  1M57 D;  4H44 B;  1IK7 A;  2RMZ A;  3SFE C;  1FJK A;  1YI2 P;  2BAS A;  1S3J A;  1L4A C;  1QLE D;  1CW5 A;  4QMA A;  2KNC B;  2ZAE B;  1O7M A;  1FQT A;  4RES B;  4JF7 A;  1USE A;  1CSB A;  1NKN A;  1OMI A;  1KMI Z;  2N1T B;  4H13 C;  3VMZ A;  1LT1 A;  1S72 P;  2YO2 A;  3H1I J;  3E7K A;  1JUN A;  1RQU A;  1NO4 A;  3H32 A;  1BDC A;  3C1L A;  1LT9 A;  2HG5 D;  5KLV K;  1HVV A;  3BCC E;  2WSE H;  5KAI H;  3L70 G;  4OH8 B;  3D71 A;  3H1J E;  1NOH A;  1OXZ A;  2H88 C;  1WMK A;  3G6E P;  1NWQ A;  2FYN C;  3CCU P;  1NH4 A;  3L74 E;  2DE7 D;  3VMY A;  4C7N B;  3M06 A;  1FZC A;  3L72 E;  1PGP A;  3CPW O;  1NAF A;  3O8Z A;  4BRY A;  3U1A A;  3A0B E;  4NB9 D;  2N1T C;  1CZQ A;  2H7H A;  4IL6 H;  5H2F H;  1LTJ C;  4WY4 A;  1EXJ A;  2M0B A;  5KKZ B;  5AEW A;  3VYI A;  3HUS B;  1PP9 E;  2K3R A;  1LTB C;  3PTZ A;  1M8O B;  4HM3 A;  1GK4 A;  2QSI A;  3O6Q A;  5AVS B;  4L74 A;  5CCG A;  2N9Y B;  1NTM G;  4N6J A;  1RIE A;  1JTH A;  3MHV A;  2N1T D;  2BMR A;  4W7Z A;  3UIA A;  3RL0 B;  1T2K D;  2Q3I A;  2NPS D;  3TGU J;  3P8C E;  1AQ5 A;  3CXH E;  3EWK A;  3TGU D;  2KS1 B;  3EFF K;  2YIU C;  2E42 A;  1EDK A;  3KZI H;  3JCU E;  4RO0 A;  5APV A;  3CCM P;  2B88 A;  3RBX A;  2XSH A;  2Q3W A;  3A0H E;  1IFJ A;  4HM6 A;  1PP9 G;  4PD4 E;  4I7Z C;  3CWB E;  1L0L G;  1SQX E;  2B9B A;  1OW7 A;  2QM7 A;  2M5A B;  1JMB A;  4B86 A;  5KLV J;  5B5E E;  1GW3 A;  1JY2 P;  2E74 C;  3WMM 0;  3H1H J;  3RL0 g;  2V4H A;  1KTM A;  2A45 H;  1RF1 A;  3ZDM A;  3L72 G;  4IFM A;  2YIU B;  5CJ4 A;  3U59 A;  2O01 N;  5AVU B;  2N1T A;  2IBZ E;  4P1B H;  4AIV A;  4I7Z B;  1PIX A;  5EFW B;  2AEM A;  5KLV D;  2KP8 A;  1SQB J;  1MUU A;  2FKW B;  3SWF A;  2FYU J;  2GBW A;  2CPS A;  4I6M C;  3HD7 C;  2HML A;  3AZC A;  5KJ7 C;  3MP7 B;  1S1C X;  4TLF A;  1RF0 A;  3L71 J;  4QDD A;  3GF7 A;  3K5B A;  4ZNC A;  1EDL A;  3M0D A;  4IFF A;  3D6Z A;  3V2P A;  3RK3 C;  2GUS A;  1VQ5 P;  1OW8 A;  2IYO A;  2WQY C;  3A2A A;  3NFQ A;  2QJY B;  3HTK B;  4QDC A;  2MKV A;  3A7O A;  2P2U A;  2PP6 A;  2OYH C;  1N86 A;  3M9H A;  2KIK A;  4WBA A;  2HMK A;  1WT6 A;  1GW4 A;  1NTM E;  2XND H;  1N73 A;  3Q5R A;  1N73 C;  4WWI A;  1SQV K;  3R2P A;  4IOI H;  4YXD C;  5CJ0 A;  1FZC B;  1UUV A;  2JJL A;  1EZV I;  2J58 A;  4L75 A;  4UB8 E;  1S5L H;  3RK2 D;  1HBW A;  3Q2Y A;  3OAK A;  2ZXX A;  1A02 F;  3CD6 P;  4NPF X;  1AA0 A;  1ZXG A;  4HM1 A;  1QVF O;  5BU5 A;  2XKM A;  3M0A A;  1GU4 A;  1A02 J;  3TGU G;  2K9J A;  1KZU B;  1JNM A;  3CC7 P;  1ZV8 A;  1K05 A;  1SQV E;  3JC2 2;  3CMA P;  4TT3 H;  3M91 A;  1SQB G;  4HM2 A;  1NTK J;  3BAS A;  4D6T D;  1SQP E;  2QRX A;  2W27 A;  2XR8 A;  2Y0D A;  1DEB A;  4NBA D;  4JYB A;  1FZE A;  1M56 D;  4HYT B;  3VCP A;  3AED C;  4WY4 D;  3VOP A;  4U3F J;  1DD3 A;  5KLV E;  1K04 A;  2O1J A;  3IFM A;  3FGA D;  3AE5 C;  3TNU B;  1NKZ B;  3EQ2 A;  1HGV A;  3VMG D;  1R8E A;  2XU6 A;  4WB4 A;  2Y9Z A;  3GZX A;  1VCK A;  4GOE A;  3S9O A;  3N0Q A;  3CX5 H;  1KQF B;  2YO3 A;  3AE8 C;  1FOS E;  5L8R J;  3RBZ A;  2IYP A;  1VQO P;  1HUC A;  5KLV G;  2P67 A;  1VQ9 P;  1GDT A;  1XTC C;  3CME P;  1SFC A;  3F89 A;  1NU1 D;  3T97 B;  1KIL D;  1PFI A;  4WY4 C;  3L75 J;  2IFM A;  1S4X A;  2Y9Y A;  1Y47 A;  5AW1 B;  2A06 E;  1KIL C;  3HD7 D;  2Q9I A;  1BSH A;  4N78 E;  1SVF A;  4XA4 A;  1GK6 A;  3NXS A;  1NVO A;  1JM1 A;  2KS1 A;  2YXR B;  1JEK A;  4PV1 B;  3VMH D;  1T8Z A;  1IFD A;  1RQV A;  5AVQ B;  2J5U A;  3CI9 A;  2QE7 H;  3B5N C;  1OVR A;  2FXM A;  3C9I A;  3U1C A;  3KHU A;  1BE3 D;  2W8Z A;  1VQ4 P;  1DD4 A;  1KQG B;  3RGU A;  1LJ2 A;  2E5T A;  3HUS C;  5GTH E;  4EYY Q;  3GL0 A; 
#chains in the Genus database with same CATH homology
 3L74 E;  2DE7 D;  1L0L E;  3EQQ A;  1SQQ E;  4NBG D;  2HMK A;  2ZYL A;  5KLI C;  1EG9 A;  3DQY A;  4NBC D;  1NTZ E;  3H1I E;  3L72 E;  1NTM E;  2JO6 A;  3L75 E;  1NU1 E;  3VMG D;  4D6T E;  3TGU E;  2HMJ A;  1VF5 D;  1ULJ A;  3GZX A;  1VCK A;  2JZA A;  2NWF A;  2NVG A;  3GTS A;  1UUV A;  1ZRT E;  1BE3 E;  1G8J B;  3N0Q A;  4NBB D;  1UUW A;  2NUK A;  4NB9 D;  1L0N E;  5HL4 A;  4HJL A;  2BMO A;  1O7W A;  2YVJ B;  3GOB A;  4HM5 A;  2HMN A;  4QDF A;  4AAY B;  2BCC E;  1PPJ E;  1Q90 C;  1RFS A;  3GKE A;  4HM7 A;  2FYU E;  2DE5 D;  4QUQ A;  2QJP C;  1VM9 A;  4HM4 A;  2HMO A;  4QUP A;  3GL2 A;  2DE6 D;  2IBZ E;  2GBX A;  4NBD D;  2B1X A;  4P1B H;  4AIV A;  2XSO A;  3H1L E;  3GZY A;  5AEW A;  1PP9 E;  1SJG A;  1BGY E;  1EZV E;  1ULI A;  3GTE A;  4QCK A;  3VCA A;  2A06 E;  1G8K B;  1NYK A;  1NTK E;  2YFJ A;  4U3F E;  1O7N A;  4HM3 A;  4HM1 A;  2NVF A;  1O7P A;  1P84 E;  3CX5 E;  2NUM A;  2XRX A;  2GBW A;  3L71 E;  2HML A;  1O7G A;  2QJY C;  3AZC A;  4H13 D;  4H44 D;  4NB8 D;  1RIE A;  2QJK C;  5CXM A;  4H0L D;  2B24 A;  1O7M A;  1FQT A;  4HM8 A;  2BMR A;  2E75 D;  1SQV E;  4NBE D;  4OGQ D;  3L70 E;  3FOU A;  5KKZ C;  3L73 E;  4P1C H;  2E76 D;  4QDD A;  3H1H E;  3H1K E;  1JM1 A;  2E74 D;  4NBH D;  4HM2 A;  3GCE A;  2HMM A;  3VMH D;  3CXH E;  3EN1 A;  1SQB E;  2QPZ A;  4QUR A;  3D89 A;  2E4P A;  2I7F A;  1WQL A;  5BOK A;  2ZT9 D;  4NBF D;  1SQP E;  1O7H A;  1KB9 E;  2D2C D;  2YIU C;  4PV1 D;  2XR8 A;  1BCC E;  4QDF B;  1KYO E;  4HKV A;  4NBA D;  2CKF A;  4QDC A;  2XSH A;  2Q3W A;  2YFL A;  3GB4 A;  2BMQ A;  4HM0 A;  4HM6 A;  3BCC E;  2YFI A;  3VCP A;  4PD4 E;  4EMJ B;  3H1J E;  3CWB E;  3C0D A;  2E4Q A;  5AEU A;  3VMI D;  2NVE A;  1NDO A;  1SQX E;  2FYN C;  5KLV E;  3GL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...