3H1IE

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
total genus 45
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1iE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1iE02
3FOUA 1RIEA 2E76D 3L72E 4QUPA 2HMKA 4QDFA 3EN1A 1G8KB 1SJGA 4EMJB 4QCKA 4QDCA 3VMGD 1SQXE 1VM9A 1PP9E 3BCCE 4U3FE 3H1JE 1L0LE 2DE5D 2ZT9D 1O7MA 1SQBE 3GB4A 2NVGA 4HM0A 5KLIC 1NYKA 1ULIA 1Q90C 1ZRTE 1FQTA 2BCCE 4D6TE 3GCEA 2XR8A 3C0DA 3GL0A 3L70E 1UUVA 3GZYA 1VF5D 5HL4A 1ULJA 1NDOA 2DE7D 5AEUA 3L71E 4NBCD 1KYOE 1RFSA 4AAYB 1O7PA 3D89A 3GTEA 2HMJA 2YFJA 1KB9E 1NU1E 2NVFA 4PD4E 2HMMA 4QDDA 2HMNA 3CWBE 4H0LD 2GBXA 1NTME 3GTSA 2B1XA 4HM7A 1SQPE 4HM1A 1BGYE 2YVJB 3GKEA 4HM4A 3VCPA 4HM8A 2E75D 2JO6A 5CXMA 2BMOA 1WQLA 2BMQA 2QPZA 4HM5A 2NUKA 4NBBD 1BE3E 3AZCA 2Q3WA 1SQQE 3L75E 4NB9D 1O7WA 4NBFD 3GZXA 4NB8D 1P84E 4HM6A 4NBGD 4NBED 3DQYA 2A06E 4QURA 3GOBA 1O7GA 3CX5E 3H1IE 2NVEA 3GL2A 1EG9A 4PV1D 2CKFA 5KLVE 2D2CD 4HM3A 4P1CH 4AIVA 3L74E 2YIUC 4H13D 3N0QA 4P1BH 1NTZE 3H1LE 2FYUE 2ZYLA 2FYNC 2HMLA 1UUWA 4NBHD 1G8JB 2BMRA 2QJYC 2YFLA 4QDFB 1BCCE 4NBDD 2XRXA 3H1HE 2E4PA 2NUMA 1L0NE 1EZVE 3CXHE 3L73E 1SQVE 3TGUE 4QUQA 2QJKC 3VCAA 2NWFA 3H1KE 1O7NA 2B24A 3VMHD 1NTKE 1O7HA 5KKZC 1PPJE 2JZAA 1VCKA 2E4QA 3EQQA 2DE6D 2QJPC 1JM1A 2IBZE 4HKVA 2YFIA 2XSHA 2E74D 2GBWA 4HJLA 4OGQD 2I7FA 5BOKA 2XSOA 4NBAD 4H44D 3VMID 5AEWA 2HMOA 4HM2A
chains in the Genus database with same CATH superfamily
4N78D 4WY4A 2HMKA 2V4HA 1SQQD 3KXDA 1VM9A 3VMAA 3BCCE 4HKZH 5TISH 1T2KD 1O7MA 4C7NB 2W27A 2JWDA 1FQTA 1NTZJ 1FU1A 3A5TA 3PTZA 1SP4A 2IBZI 3GZYA 1FOSE 4D6TG 1X79B 1KQGB 5AEUA 3U1AA 3GTEA 3FXEA 2V7QJ 4Z1MH 1PFIA 1NYHA 2OTKE 3HRNA 5GTIH 2OYIC 1BGYE 2NPSA 1QVFO 1KV4A 2KS1B 4WB4A 1JMBA 1HTLC 2BMQA 2JEEA 2NUKA 3VYIA 3AZCA 5GTHH 3L37A 4NB9D 1NHLA 3L73J 4HYTB 2M3BA 3E1RA 3H1IG 3P32A 4HM6A 3CC7P 3EFGA 1ZRTD 3IN6A 2WSEJ 1RE4A 1HWTC 1FZEA 1VF5C 4NBHD 1LNQA 2N1TA 4UB8E 2KZIA 2Z5IA 2YFLA 4QDFB 2KK7A 2YXRB 2NUMA 3B4SA 3CCQP 4PD4D 2ZJSE 1KILC 1SFCA 3OW2O 1FDOA 3CD6P 1NTZD 1H0TA 3CCLP 2E5YA 1AA0A 1TU3F 3MP7B 1M1JA 1HF9A 1Q7YQ 2XSOA 3WMM0 2WVRA 1RIEA 2BCCD 1BE3G 1KQSO 1GD2E 2M5AA 1L0NK 1PP9E 2ZT9D 1OW6A 2PGDA 4H13B 1ZP0C 1FOSF 1ZRTE 4IL6X 5EFWB 3NXSA 3CX5H 5CBNA 3H1LG 2CK3H 1KD1Q 1LTGC 1VPCA 1YHQP 1JNMA 1N7SC 2P2UA 1NTKD 1OFCX 3AEEC 5B66H 1QEXA 2NVFA 3RK3E 1GL2A 2P10A 4HM1A 5KAFH 3SFDC 1LTSC 1SQQJ 2QPZA 1URQB 2O01J 3GG2A 3V2PA 5APXA 4WY4D 1ZW0A 1FS0E 1RE3C 5APSA 1S9KD 2P58A 2WPVB 1GTWA 3D71A 3JCUH 1VQLP 1KMIZ 1WRGA 4OGQB 1YJNP 1RE4C 2G8YA 3H1LE 1IFJA 3M9BA 2FYNC 2IPPA 1CZQA 4U3FD 1KZUB 3E7KA 2JKVA 3L73E 1JUNA 1SQVE 3AE6C 3GHGB 1VL2A 1M7LA 4HKVA 3TGUD 2E74D 2OYHB 5CCGC 2YO3A 2SPZA 5AEWA 3L74D 5KLVD 2HMOA 3L4FA 4JBZA 1ZV8A 1NOHA 1LTTC 3BCCJ 4EIJA 3Q5RA 1WMKA 1PGPA 4IL6E 2HPCA 3G6EP 4HM0A 4KT0J 1ULIA 4C7RA 2IZ0A 4L75A 2FYZA 2IYPA 3GL0A 1NTZG 3L73G 4ZKPA 3L72D 2E43A 1KTMA 1KILD 1N73A 1KYOE 1YTZI 1LP1B 4K35A 2ZYGA 2FXMA 1N7SD 1NTMJ 2NZ2A 3B5ND 2HMMA 4H0LD 5CCHC 4OGQC 3MZWB 3B5NA 2Y0DA 4ZMDA 2AXCA 4NPFX 1HBWA 1DEBA 2E75D 2WT7A 3CX5D 2HYNA 3OAKA 1J1EC 1NJIQ 3V5BA 1NTZK 1LT9C 1ZMEC 4NBFD 5GTHE 2XV5A 1ZLLA 4HH2A 3OJAB 1NAYA 1GW3A 2Q6QA 5GTIE 5APYA 1L0LG 1NTMD 3HE5B 3LIDA 3PLNA 2HMLA 1JMMA 3F5HA 4NBDD 1U57A 4MN4C 4LLHA 1X9VA 4DOJA 3VCAA 3CC2P 3H1KE 1O7NA 1J1DB 1BGYD 4RJTA 3S9OA 2FKWB 2E75B 4HJGH 1OWAA 2LXBA 4H44D 4RKUJ 1RF1B 3B71A 5C39A 4JPZB 1YBKA 3QWOC 3KZIH 2CPSA 2KUBA 2G3AA 3TNUA 3MUDA 3TK1A 3TDKA 2XZRA 1Q90C 4ASWA 3TSIA 1VQKP 3NFQA 5CBOA 4IFMA 2BEQD 1QVGO 1M1KQ 1SQPG 5KAIH 1EZVD 1IC2A 3AE1C 3D89A 3CLQA 4ASVA 3H1KG 2QJYB 3O6QB 4GOFA 3FWNA 1GK6A 4EYYQ 2WSCJ 1NTMG 2YKOA 2I1JA 4TLFA 1GW4A 1DD4A 3VMZA 5AVYB 2K9YA 1HUCA 2WMMA 1SQQE 3D70A 4N78E 4RESB 2LKMA 4L74A 2YKQA 1Y9BA 4DT0A 1IFIA 2HODB 5KAIE 4K3AA 1S5LE 3RK2C 2E5TA 1G8JB 2WSFJ 3JC22 1AQTA 1NU1K 4GKGA 3B5NC 1EDLA 1MZ9A 1SQXJ 4BRYB 2PRRA 1LTAC 1SQBJ 2B89A 1Q81Q 4GIFA 5CCGD 3LIEA 1JM1A 2QM7A 1CW5A 2IYOA 1KORA 4D6TJ 4NBAD 1PPJD 3N7NA 4I6MC 1L0NG 1JOCA 1SQBK 1BGYG 2YXQB 2M5AB 2OYIB 3MGNA 4EDFA 1Q2NA 3HTKA 2DE5D 1L4AD 1SQBE 4EI2A 2NVGA 2R3SA 1G2CB 1BGYJ 3TNUB 1EDJA 2HFED 1YITP 3L71G 4PJ0E 1HJ0A 1L2PA 4AQRD 1YQ4C 1VQ4P 3B5NB 3KPEA 3BCCG 3U59A 3RBZA 5BU5A 1JY3P 2GBXA 2UWJE 3RBXA 1SQPE 2XNXA 2J58A 2OGUA 1CI6A 1BE3E 3EWKA 1A02J 2A06G 5AVUB 1L0ND 3H1IJ 1OX3A 1DX7A 1NKNA 3H1KJ 2R5BA 1CSBA 2MJZA 3L75G 2D2CD 4M3LA 2YIUC 3L74E 2FFDB 1IK7A 1MKMA 1NVOA 2H8PD 4LGDE 2IBZG 2W6AA 2H7HA 1N7LA 1S1CX 1OVVA 2ZXXA 5KKZC 3H1HD 3L74J 2XSHA 1RF0A 3H1ID 2QIWA 5BOKA 1FZCC 3IAOA 3AEGC 1OW8A 2CPBA 3FOUA 4H44C 3AEDC 2W8ZA 1GL2D 3CCEP 4D6TD 1FZGA 1FJKA 4XE5B 3G71P 3F89A 4U3FJ 1LT1A 2LR2A 1OMIA 4A7PA 1T2KC 1N7SB 3H25A 2XR8A 3RL0g 3C0DA 3HTKB 2L91A 2XDJA 4UB6E 2QG4A 3SSUA 4NBCD 2M0BA 2YFJA 2B88A 3LW5J 4QMAA 2JP3A 2N1TD 3Q2YA 5CXMA 4LC1A 2E74C 4C7NA 1FJPA 3RGUA 5CHXA 4KJMA 1LT9B 2Z4EA 3DQYA 2IZ1A 3D6ZA 2YNYA 1SQBD 2FYUD 2CKFA 1RY3A 3HE5A 5L8RJ 2O1KA 2MKVA 2WPQA 2FYUK 1JTHA 3L70G 3WUVA 4H44B 3CXHH 4GT1A 2BCCG 1M56D 3CMEP 2JZAA 2C0XA 2XU6A 2E4QA 4I1LA 2IBZE 1T6AA 4HJLA 3VMXA 3HD7C 3M06A 2K9JA 1KILE 3UIAA 1SQXD 4QUPA 3L72E 4NPDA 3D6YA 4EMJB 2B9BA 1X0TA 4QDCA 2RKLA 1Y47A 3VN0A 4UB8H 2OYHC 1EC5A 3HE4A 3L70E 3AE2C 1DIPA 1BSHA 4PV1B 1EQ7A 2DE7D 3RL0C 4AAYB 3ZDMA 2Q3IA 3CWBJ 4Y99B 1KB9E 1PP9J 3L73D 1NAFA 5AVZB 2AXTE 2KNCA 1KFMA 3QH9A 1VQNP 1SLQA 2E76C 2JO6A 2BMOA 1WQLA 3CCRP 4N6JA 1GL2C 3L71J 2JR8A 3C1LA 3MHVA 1YQ3C 2HLOA 2QJPB 1SFCB 3PP5A 1SQXG 4NBGD 4NBED 1EDKA 2POHA 4PV1D 1JB0J 2Z5HA 2HODA 2WITA 3RK2D 1MFZA 3CXHI 5AVXB 1URQD 3RK3D 1VQ9P 1IFNA 1EZVG 1URQA 2IDBA 3H1KD 1ZXGA 4Y99C 2YFIA 5E79H 1USEA 2WSEH 1K9MQ 3HD7A 2GA1A 5AW0B 1SQXE 3VP9A 1NTKJ 1NYKA 2KI7B 5AVVB 1PP9D 2BCCE 4GDOA 3RK3B 4BWNA 2Q5UA 3GHGA 3BATA 1KYOH 3EQ2A 2IBZD 3K5BA 1R5SA 1QL2A 2M3EA 2FXOA 2DW3A 4PD4E 2YMKA 2KLVA 3A0HE 3AECC 1KB9I 2XNDH 2FFDA 2I1KA 4WBAA 2Q3WA 3L75E 1JCDA 1S5LX 3H1JJ 4NB8D 3CI9A 1T8ZA 4WY4C 3TGUG 2A45G 4C46A 1VQ5P 2K88A 1VQ6P 3CMAP 2N9YB 4H0LB 4P1CH 2J5UA 4P1BH 3RL0D 1QL1A 5B5EE 3M0AA 1UIXA 1ZR4A 1SS1A 3E1IA 1OZHA 3MTUE 2GM4A 1RF0C 3TGUE 2NWFA 3H6PA 1T3JA 2VRSA 2BCCJ 2E75C 5AW7B 5B5EH 1SQVD 1LTBC 2WSFH 1OXZA 2E42A 1PGJA 1J1EB 1E5WA 1R5LA 1N73B 1X8YA 1FZFA 3L72J 3AE7C 3IF4A 2NPSD 3HE4B 1M90Q 5KLIC 4GODA 4AUWA 3Q3DA 2A45H 3HD7B 1L0LD 2V7QH 1N7SA 1Y8AA 2QEXP 1H88A 2Q3EA 3GLMA 3V2RA 1KYOI 4PD4H 3AEBC 1N86A 2ZVNB 1YTZT 1BE3D 1VDFA 3TGUJ 3L71D 2Q1KA 4B86A 2O01N 2WQYC 2QRXA 5KLVJ 3L70D 2AEFA 1S3JA 5KTBA 3C8VA 1JCCA 3AEFC 2FFDC 1MFTA 5DJUB 4JF7A 3A0HH 5AW8B 3I55P 3GHGC 5KJ7A 3C9IA 4Y28J 3H1HG 3ITKA 2P7JA 3JCUE 1SQQG 4IFFA 1T3UA 5K5GB 2FYUE 5E79E 2H89C 2KLUA 5BU8B 1MV8A 1NO4A 1L4AA 3S1KA 1IO4A 3KDPB 5CMZA 2B24A 1L0LJ 3H1JD 4UB6H 3A0BE 1Q82Q 1PPJE 3BRTB 5H2FE 2Y0CA 3CCVP 1SQPJ 3CX5I 2PP6A 3MIWA 3V2NA 2YKPA 3VMYA 1SQVK 1FC2C 2KSJA 5APTA 4JYCA 3MD0A 5KLVK 3GB4A 2WSCH 2KNCB 1S2EA 3H1LJ 2JO1A 5KKZB 3S4RA 1N73C 3I56P 1NDOA 1M8OB 3CCJP 1YI2P 5AVTB 1M1JC 1JEKA 4IOIH 2RMZA 2C0WA 1EZVI 2YVJB 1IFPA 3BASA 1XTGB 4W7YA 3RK2B 2JWAA 3CPWO 2IFMA 3FX0A 3SWFA 3G4SP 3H1JG 1HJBA 1PP9G 3CCSP 2RN0A 1EXIA 3AE8C 1H8AA 2ITAA 1KC8Q 2KP8A 5B66E 1FZBA 1VQMP 1URQC 2KYVA 3H1HE 1R8EA 2E4PA 2OYIA 1L0NE 1EDIA 1EZVE 3CXHE 2OTJP 2WPRA 3NMDA 4QUQA 2KXPB 1OW7A 3H1LD 4WVZA 1SFCC 3M91A 3Q1MA 1LP1A 4OGQD 1YYCA 4OH8B 4JYBA 2D2CB 3VMID 5KJ7C 2JJLA 2E76D 1KILB 1PL5A 2Q7CA 1G8KB 3VMGD 2N9BA 2D2CC 5H2FH 4IFDK 5APUA 1A02F 2OYOA 3GCEA 3M0DA 3FWLA 1ZOYC 3W68A 2ZXEB 3VOPA 4NPEA 3Q5SA 1O7PA 1W2EA 2JDIH 1GZLA 1K73Q 1NTME 1LWUC 1EXJA 1QGKB 4XFJA 3GZXA 1BE3J 1GU5A 4W7ZA 1VQPP 3RL0B 5AW6B 2A06E 3CX5E 1JM0A 2BEZF 2J59M 1NTZE 2KS1A 2ZYLA 2N1TB 2QJYC 2W83C 1S5LH 3M9HA 4AYCA 3IR9A 1M57D 2OTLP 1NU1G 3CCUP 4RO0A 2KZJA 1PV3A 3WUUA 3I5CA 5AW3B 1U7JA 1LT9A 2OQQA 4U7JA 1SFCD 2E74B 1E79H 3IFMA 1IFDA 2QM8A 4DJGA 3P8MC 2GUSA 5CCGA 1XTCC 4QDFA 3EN1A 2NPSB 3A3YB 3CWBG 1SQBG 4U3FE 3LW5H 1L0LE 2IFNA 3H32B 3P8CD 4YXDC 2ZT9C 3II6A 2O01H 5AVWB 2Y9YA 1FAVA 1UUVA 3T97B 1ULJA 3KYQA 3M0DC 3A7OA 2KSEA 2ZT9B 4R4LA 3A2AA 2HMJA 2K9JB 1HVVA 3CC4P 2HMNA 2R5DA 2L5GB 3GW6A 3L35A 4HM7A 2B1XA 1NH4A 4PJ0H 5AW1B 1NU1D 3GKEA 1KB9D 4HM4A 1BCCJ 2M8RA 1AVYA 1O7WA 1L0NJ 3PJSK 1Q90D 5AVRB 4KHXA 5DJTB 3AE3C 4YXWH 3N4XA 1K04A 3FXDA 1L4AC 2W6BA 2B87B 3A0BH 1OVRA 1WT6A 3N0QA 4I7ZC 2YIUB 3HUSB 3CWBD 3P8CE 2Y9ZA 3VMHD 4PD4I 1NTKE 3B8EB 1RF1C 3TYYA 1L0LK 1LJ2A 5AVSB 4ZNCA 2FBWC 2GBWA 5AVQB 1HGZA 1FZAA 3VTPC 3SWKA 3L75D 2A06D 1DEEG 2WWWA 1N8RQ 1NU1J 5AW9B 1QLED 1CI6B 1SQXK 1GMJA 2K3RA 2RH0A 1NWQA 1G1JA 4BRYA 4YPCA 1VF5D 4YTPC 2W90A 1FZCB 4OVNF 1JY2O 3JSVC 3OA7A 2QSIA 3FGAD 3CWBE 3V4QA 1HGVA 4JQ0D 4H0LC 2WT7B 1G1IA 2KB7P 1RHZB 4HM5A 4NBBD 3Q5PA 2Y0EA 3G9RA 1FBMA 1G2CA 5KJ7D 1YJ9P 1VQ7P 1P84E 2R32A 5AW4B 3USSA 2Q9IA 4QURA 1PPJG 2NRGA 2AXTH 1AVOA 5KLVE 4AIVA 2QA4P 4H13D 1KB9H 1Q86Q 2HPCB 4EOTA 3L70J 2QE7H 2AEJA 1LWUB 2QJKC 5BVZA 2PFXA 1O7HA 2LXCB 3HUSA 4OWFA 1IK9A 2R3CA 1PIXA 3O8ZA 2OARA 3BCCD 4HM2A 1IZNB 3H32A 3R4YA 4R4MA 1K8AQ 1S9KE 1VQ8P 3AE4C 3ABVC 3TF5A 2YO2A 3WU2E 5TJHA 3AE5C 5HL4A 1VQOP 3P7KA 1RF1A 2FYUJ 4WY4B 3SFEC 1OVUA 1PZQA 1X22A 1H89A 1FZCA 1GDTA 1QX8A 3L75J 4TT3H 1YIJP 1GU4A 1LTJA 2FXPA 3EFFK 1PGQA 2ZYDA 1RQUA 3PHLA 1PGOA 1SQVG 3GOBA 2C9NY 2P1JA 3PH0A 1YJWP 1UIIA 1U7MA 1P84H 2XKMA 2BMRA 4H13C 1USDA 4L76A 1J2JB 5APQA 1AJYA 5CJ4A 3R2PA 3WU2H 2WZ7A 3L74G 1LGHB 2C9LY 1M1JB 2DE6D 4XA4A 2KOGA 1MUUA 1HH0A 3MUDC 5AW2B 3O6QA 3GF3A 1FE6A 1J1DC 2WSSH 5M1BA 2QJKB 1K05A 3KQGA 4U3FG 4QCKA 3SWYA 1JY2N 2O1JA 3H1JE 3GMAA 1JTHB 1VF5B 4D6TE 2IX7C 2I8DA 4PV1C 3BVHA 4GOEA 1KN7A 3T97A 4ZKUA 1BCCG 2HG5D 1DH3A 3L71E 3HUSC 1BCCD 3H1HJ 3AE9C 1NU1E 5TISE 1GL2B 3CXHD 1SQVJ 2O3JA 3GTSA 2E76B 1SQQK 1BDCA 2FY8A 4HM8A 3V4WA 2GUVA 2H43A 1SVFA 3CCMP 3L72G 2WTYA 1W2BO 2PAJA 2ZYAA 1LTJC 3H1IE 5APWA 1LTJB 1EG9A 4CPGA 3NTNA 1OIPA 1RE3A 2B87A 4IL6H 3L36A 1JY3N 2BASA 1UUWA 2ZVOB 3GF7A 4I7ZB 1BCCE 1AV1A 2K37A 2ZAEB 1NTKK 1L4AB 1LTIC 3V6IA 3AEAC 1NKZB 1KFNA 1SQPD 1W5CE 2QVAA 4I2LC 2FYUG 1D7MA 2I7FA 1JY2P 2WPSA 1H0TB 2H88C 1SQPK 2K1AA 1P84D 1IJDB 2NPSC 1SJGA 1GK4A 4BXLA 4HB1A 3CL3D 3U1CA 1ZN5A 1AFOA 1RQVA 2HR3A 1AQ5A 1NTMK 4N3YB 2OYHA 1BSNA 1S72P 3KZIE 1JO5A 2W6JH 3RK3C 1NGMB 1FDMA 1RFSA 1RH5B 3M9QA 4QDDA 5KAFE 2N1TC 4W80A 3V2QA 2R44A 2KIKA 1BDDA 3G3ZA 1FDIA 4L73A 1N2DC 5CCHD 1ZR2A 3VCPA 1NTKG 5APVA 2AEMA 2YMYA 2ZFCA 5CCHA 2FYNB 5KLVG 1KQLA 1LWUA 1S4XA 5CJ0A 3W67A 1O7GA 1P84I 2NVEA 3GL2A 1JY3O 4HM3A 4DZOA 4DCKA 3PRJA 2P67A 1IFMA 3VP8A 1KILA 1KYOD 2XRXA 3WUTA 1DD3A 3BRVB 2A45I 1KQFB 1Z56A 1VCKA 3HD7D 3EQQA 2QJPC 4WWIA 3KHUA 5AW5B 4O9BA 5KLIB
chains in the Genus database with same CATH topology
3FOUA 1RIEA 2E76D 3L72E 4QUPA 2HMKA 4QDFA 3EN1A 1G8KB 1SJGA 4EMJB 4QCKA 4QDCA 3VMGD 1SQXE 1VM9A 1PP9E 3BCCE 4U3FE 3H1JE 1L0LE 2DE5D 2ZT9D 1O7MA 1SQBE 3GB4A 2NVGA 4HM0A 5KLIC 1NYKA 1ULIA 1Q90C 1ZRTE 1FQTA 2BCCE 4D6TE 3GCEA 2XR8A 3C0DA 3GL0A 3L70E 1UUVA 3GZYA 1VF5D 5HL4A 1ULJA 1NDOA 2DE7D 5AEUA 3L71E 4NBCD 1KYOE 1RFSA 4AAYB 1O7PA 3D89A 3GTEA 2HMJA 2YFJA 1KB9E 1NU1E 2NVFA 4PD4E 2HMMA 4QDDA 2HMNA 3CWBE 4H0LD 2GBXA 1NTME 3GTSA 2B1XA 4HM7A 1SQPE 4HM1A 1BGYE 2YVJB 3GKEA 4HM4A 3VCPA 4HM8A 2E75D 2JO6A 5CXMA 2BMOA 1WQLA 2BMQA 2QPZA 4HM5A 2NUKA 4NBBD 1BE3E 3AZCA 2Q3WA 1SQQE 3L75E 4NB9D 1O7WA 4NBFD 3GZXA 4NB8D 1P84E 4HM6A 4NBGD 4NBED 3DQYA 2A06E 4QURA 3GOBA 1O7GA 3CX5E 3H1IE 2NVEA 3GL2A 1EG9A 4PV1D 2CKFA 5KLVE 2D2CD 4HM3A 4P1CH 4AIVA 3L74E 2YIUC 4H13D 3N0QA 4P1BH 1NTZE 3H1LE 2FYUE 2ZYLA 2FYNC 2HMLA 1UUWA 4NBHD 1G8JB 2BMRA 2QJYC 2YFLA 4QDFB 1BCCE 4NBDD 2XRXA 3H1HE 2E4PA 2NUMA 1L0NE 1EZVE 3CXHE 3L73E 1SQVE 3TGUE 4QUQA 2QJKC 3VCAA 2NWFA 3H1KE 1O7NA 2B24A 3VMHD 1NTKE 1O7HA 5KKZC 1PPJE 2JZAA 1VCKA 2E4QA 3EQQA 2DE6D 2QJPC 1JM1A 2IBZE 4HKVA 2YFIA 2XSHA 2E74D 2GBWA 4HJLA 4OGQD 2I7FA 5BOKA 2XSOA 4NBAD 4H44D 3VMID 5AEWA 2HMOA 4HM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOU A;  1RIE A;  2E76 D;  3L72 E;  4QUP A;  2HMK A;  4QDF A;  3EN1 A;  1G8K B;  1SJG A;  4EMJ B;  4QCK A;  4QDC A;  3VMG D;  1SQX E;  1VM9 A;  1PP9 E;  3BCC E;  4U3F E;  3H1J E;  1L0L E;  2DE5 D;  2ZT9 D;  1O7M A;  1SQB E;  3GB4 A;  2NVG A;  4HM0 A;  5KLI C;  1NYK A;  1ULI A;  1Q90 C;  1ZRT E;  1FQT A;  2BCC E;  4D6T E;  3GCE A;  2XR8 A;  3C0D A;  3GL0 A;  3L70 E;  1UUV A;  3GZY A;  1VF5 D;  5HL4 A;  1ULJ A;  1NDO A;  2DE7 D;  5AEU A;  3L71 E;  4NBC D;  1KYO E;  1RFS A;  4AAY B;  1O7P A;  3D89 A;  3GTE A;  2HMJ A;  2YFJ A;  1KB9 E;  1NU1 E;  2NVF A;  4PD4 E;  2HMM A;  4QDD A;  2HMN A;  3CWB E;  4H0L D;  2GBX A;  1NTM E;  3GTS A;  2B1X A;  4HM7 A;  1SQP E;  4HM1 A;  1BGY E;  2YVJ B;  3GKE A;  4HM4 A;  3VCP A;  4HM8 A;  2E75 D;  2JO6 A;  5CXM A;  2BMO A;  1WQL A;  2BMQ A;  2QPZ A;  4HM5 A;  2NUK A;  4NBB D;  1BE3 E;  3AZC A;  2Q3W A;  1SQQ E;  3L75 E;  4NB9 D;  1O7W A;  4NBF D;  3GZX A;  4NB8 D;  1P84 E;  4HM6 A;  4NBG D;  4NBE D;  3DQY A;  2A06 E;  4QUR A;  3GOB A;  1O7G A;  3CX5 E;  3H1I E;  2NVE A;  3GL2 A;  1EG9 A;  4PV1 D;  2CKF A;  5KLV E;  2D2C D;  4HM3 A;  4P1C H;  4AIV A;  3L74 E;  2YIU C;  4H13 D;  3N0Q A;  4P1B H;  1NTZ E;  3H1L E;  2FYU E;  2ZYL A;  2FYN C;  2HML A;  1UUW A;  4NBH D;  1G8J B;  2BMR A;  2QJY C;  2YFL A;  4QDF B;  1BCC E;  4NBD D;  2XRX A;  3H1H E;  2E4P A;  2NUM A;  1L0N E;  1EZV E;  3CXH E;  3L73 E;  1SQV E;  3TGU E;  4QUQ A;  2QJK C;  3VCA A;  2NWF A;  3H1K E;  1O7N A;  2B24 A;  3VMH D;  1NTK E;  1O7H A;  5KKZ C;  1PPJ E;  2JZA A;  1VCK A;  2E4Q A;  3EQQ A;  2DE6 D;  2QJP C;  1JM1 A;  2IBZ E;  4HKV A;  2YFI A;  2XSH A;  2E74 D;  2GBW A;  4HJL A;  4OGQ D;  2I7F A;  5BOK A;  2XSO A;  4NBA D;  4H44 D;  3VMI D;  5AEW A;  2HMO A;  4HM2 A; 
#chains in the Genus database with same CATH topology
 4N78 D;  4WY4 A;  2HMK A;  2V4H A;  1SQQ D;  3KXD A;  1VM9 A;  3VMA A;  3BCC E;  4HKZ H;  5TIS H;  1T2K D;  1O7M A;  4C7N B;  2W27 A;  2JWD A;  1FQT A;  1NTZ J;  1FU1 A;  3A5T A;  3PTZ A;  1SP4 A;  2IBZ I;  3GZY A;  1FOS E;  4D6T G;  1X79 B;  1KQG B;  5AEU A;  3U1A A;  3GTE A;  3FXE A;  2V7Q J;  4Z1M H;  1PFI A;  1NYH A;  2OTK E;  3HRN A;  5GTI H;  2OYI C;  1BGY E;  2NPS A;  1QVF O;  1KV4 A;  2KS1 B;  4WB4 A;  1JMB A;  1HTL C;  2BMQ A;  2JEE A;  2NUK A;  3VYI A;  3AZC A;  5GTH H;  3L37 A;  4NB9 D;  1NHL A;  3L73 J;  4HYT B;  2M3B A;  3E1R A;  3H1I G;  3P32 A;  4HM6 A;  3CC7 P;  3EFG A;  1ZRT D;  3IN6 A;  2WSE J;  1RE4 A;  1HWT C;  1FZE A;  1VF5 C;  4NBH D;  1LNQ A;  2N1T A;  4UB8 E;  2KZI A;  2Z5I A;  2YFL A;  4QDF B;  2KK7 A;  2YXR B;  2NUM A;  3B4S A;  3CCQ P;  4PD4 D;  2ZJS E;  1KIL C;  1SFC A;  3OW2 O;  1FDO A;  3CD6 P;  1NTZ D;  1H0T A;  3CCL P;  2E5Y A;  1AA0 A;  1TU3 F;  3MP7 B;  1M1J A;  1HF9 A;  1Q7Y Q;  2XSO A;  3WMM 0;  2WVR A;  1RIE A;  2BCC D;  1BE3 G;  1KQS O;  1GD2 E;  2M5A A;  1L0N K;  1PP9 E;  2ZT9 D;  1OW6 A;  2PGD A;  4H13 B;  1ZP0 C;  1FOS F;  1ZRT E;  4IL6 X;  5EFW B;  3NXS A;  3CX5 H;  5CBN A;  3H1L G;  2CK3 H;  1KD1 Q;  1LTG C;  1VPC A;  1YHQ P;  1JNM A;  1N7S C;  2P2U A;  1NTK D;  1OFC X;  3AEE C;  5B66 H;  1QEX A;  2NVF A;  3RK3 E;  1GL2 A;  2P10 A;  4HM1 A;  5KAF H;  3SFD C;  1LTS C;  1SQQ J;  2QPZ A;  1URQ B;  2O01 J;  3GG2 A;  3V2P A;  5APX A;  4WY4 D;  1ZW0 A;  1FS0 E;  1RE3 C;  5APS A;  1S9K D;  2P58 A;  2WPV B;  1GTW A;  3D71 A;  3JCU H;  1VQL P;  1KMI Z;  1WRG A;  4OGQ B;  1YJN P;  1RE4 C;  2G8Y A;  3H1L E;  1IFJ A;  3M9B A;  2FYN C;  2IPP A;  1CZQ A;  4U3F D;  1KZU B;  3E7K A;  2JKV A;  3L73 E;  1JUN A;  1SQV E;  3AE6 C;  3GHG B;  1VL2 A;  1M7L A;  4HKV A;  3TGU D;  2E74 D;  2OYH B;  5CCG C;  2YO3 A;  2SPZ A;  5AEW A;  3L74 D;  5KLV D;  2HMO A;  3L4F A;  4JBZ A;  1ZV8 A;  1NOH A;  1LTT C;  3BCC J;  4EIJ A;  3Q5R A;  1WMK A;  1PGP A;  4IL6 E;  2HPC A;  3G6E P;  4HM0 A;  4KT0 J;  1ULI A;  4C7R A;  2IZ0 A;  4L75 A;  2FYZ A;  2IYP A;  3GL0 A;  1NTZ G;  3L73 G;  4ZKP A;  3L72 D;  2E43 A;  1KTM A;  1KIL D;  1N73 A;  1KYO E;  1YTZ I;  1LP1 B;  4K35 A;  2ZYG A;  2FXM A;  1N7S D;  1NTM J;  2NZ2 A;  3B5N D;  2HMM A;  4H0L D;  5CCH C;  4OGQ C;  3MZW B;  3B5N A;  2Y0D A;  4ZMD A;  2AXC A;  4NPF X;  1HBW A;  1DEB A;  2E75 D;  2WT7 A;  3CX5 D;  2HYN A;  3OAK A;  1J1E C;  1NJI Q;  3V5B A;  1NTZ K;  1LT9 C;  1ZME C;  4NBF D;  5GTH E;  2XV5 A;  1ZLL A;  4HH2 A;  3OJA B;  1NAY A;  1GW3 A;  2Q6Q A;  5GTI E;  5APY A;  1L0L G;  1NTM D;  3HE5 B;  3LID A;  3PLN A;  2HML A;  1JMM A;  3F5H A;  4NBD D;  1U57 A;  4MN4 C;  4LLH A;  1X9V A;  4DOJ A;  3VCA A;  3CC2 P;  3H1K E;  1O7N A;  1J1D B;  1BGY D;  4RJT A;  3S9O A;  2FKW B;  2E75 B;  4HJG H;  1OWA A;  2LXB A;  4H44 D;  4RKU J;  1RF1 B;  3B71 A;  5C39 A;  4JPZ B;  1YBK A;  3QWO C;  3KZI H;  2CPS A;  2KUB A;  2G3A A;  3TNU A;  3MUD A;  3TK1 A;  3TDK A;  2XZR A;  1Q90 C;  4ASW A;  3TSI A;  1VQK P;  3NFQ A;  5CBO A;  4IFM A;  2BEQ D;  1QVG O;  1M1K Q;  1SQP G;  5KAI H;  1EZV D;  1IC2 A;  3AE1 C;  3D89 A;  3CLQ A;  4ASV A;  3H1K G;  2QJY B;  3O6Q B;  4GOF A;  3FWN A;  1GK6 A;  4EYY Q;  2WSC J;  1NTM G;  2YKO A;  2I1J A;  4TLF A;  1GW4 A;  1DD4 A;  3VMZ A;  5AVY B;  2K9Y A;  1HUC A;  2WMM A;  1SQQ E;  3D70 A;  4N78 E;  4RES B;  2LKM A;  4L74 A;  2YKQ A;  1Y9B A;  4DT0 A;  1IFI A;  2HOD B;  5KAI E;  4K3A A;  1S5L E;  3RK2 C;  2E5T A;  1G8J B;  2WSF J;  3JC2 2;  1AQT A;  1NU1 K;  4GKG A;  3B5N C;  1EDL A;  1MZ9 A;  1SQX J;  4BRY B;  2PRR A;  1LTA C;  1SQB J;  2B89 A;  1Q81 Q;  4GIF A;  5CCG D;  3LIE A;  1JM1 A;  2QM7 A;  1CW5 A;  2IYO A;  1KOR A;  4D6T J;  4NBA D;  1PPJ D;  3N7N A;  4I6M C;  1L0N G;  1JOC A;  1SQB K;  1BGY G;  2YXQ B;  2M5A B;  2OYI B;  3MGN A;  4EDF A;  1Q2N A;  3HTK A;  2DE5 D;  1L4A D;  1SQB E;  4EI2 A;  2NVG A;  2R3S A;  1G2C B;  1BGY J;  3TNU B;  1EDJ A;  2HFE D;  1YIT P;  3L71 G;  4PJ0 E;  1HJ0 A;  1L2P A;  4AQR D;  1YQ4 C;  1VQ4 P;  3B5N B;  3KPE A;  3BCC G;  3U59 A;  3RBZ A;  5BU5 A;  1JY3 P;  2GBX A;  2UWJ E;  3RBX A;  1SQP E;  2XNX A;  2J58 A;  2OGU A;  1CI6 A;  1BE3 E;  3EWK A;  1A02 J;  2A06 G;  5AVU B;  1L0N D;  3H1I J;  1OX3 A;  1DX7 A;  1NKN A;  3H1K J;  2R5B A;  1CSB A;  2MJZ A;  3L75 G;  2D2C D;  4M3L A;  2YIU C;  3L74 E;  2FFD B;  1IK7 A;  1MKM A;  1NVO A;  2H8P D;  4LGD E;  2IBZ G;  2W6A A;  2H7H A;  1N7L A;  1S1C X;  1OVV A;  2ZXX A;  5KKZ C;  3H1H D;  3L74 J;  2XSH A;  1RF0 A;  3H1I D;  2QIW A;  5BOK A;  1FZC C;  3IAO A;  3AEG C;  1OW8 A;  2CPB A;  3FOU A;  4H44 C;  3AED C;  2W8Z A;  1GL2 D;  3CCE P;  4D6T D;  1FZG A;  1FJK A;  4XE5 B;  3G71 P;  3F89 A;  4U3F J;  1LT1 A;  2LR2 A;  1OMI A;  4A7P A;  1T2K C;  1N7S B;  3H25 A;  2XR8 A;  3RL0 g;  3C0D A;  3HTK B;  2L91 A;  2XDJ A;  4UB6 E;  2QG4 A;  3SSU A;  4NBC D;  2M0B A;  2YFJ A;  2B88 A;  3LW5 J;  4QMA A;  2JP3 A;  2N1T D;  3Q2Y A;  5CXM A;  4LC1 A;  2E74 C;  4C7N A;  1FJP A;  3RGU A;  5CHX A;  4KJM A;  1LT9 B;  2Z4E A;  3DQY A;  2IZ1 A;  3D6Z A;  2YNY A;  1SQB D;  2FYU D;  2CKF A;  1RY3 A;  3HE5 A;  5L8R J;  2O1K A;  2MKV A;  2WPQ A;  2FYU K;  1JTH A;  3L70 G;  3WUV A;  4H44 B;  3CXH H;  4GT1 A;  2BCC G;  1M56 D;  3CME P;  2JZA A;  2C0X A;  2XU6 A;  2E4Q A;  4I1L A;  2IBZ E;  1T6A A;  4HJL A;  3VMX A;  3HD7 C;  3M06 A;  2K9J A;  1KIL E;  3UIA A;  1SQX D;  4QUP A;  3L72 E;  4NPD A;  3D6Y A;  4EMJ B;  2B9B A;  1X0T A;  4QDC A;  2RKL A;  1Y47 A;  3VN0 A;  4UB8 H;  2OYH C;  1EC5 A;  3HE4 A;  3L70 E;  3AE2 C;  1DIP A;  1BSH A;  4PV1 B;  1EQ7 A;  2DE7 D;  3RL0 C;  4AAY B;  3ZDM A;  2Q3I A;  3CWB J;  4Y99 B;  1KB9 E;  1PP9 J;  3L73 D;  1NAF A;  5AVZ B;  2AXT E;  2KNC A;  1KFM A;  3QH9 A;  1VQN P;  1SLQ A;  2E76 C;  2JO6 A;  2BMO A;  1WQL A;  3CCR P;  4N6J A;  1GL2 C;  3L71 J;  2JR8 A;  3C1L A;  3MHV A;  1YQ3 C;  2HLO A;  2QJP B;  1SFC B;  3PP5 A;  1SQX G;  4NBG D;  4NBE D;  1EDK A;  2POH A;  4PV1 D;  1JB0 J;  2Z5H A;  2HOD A;  2WIT A;  3RK2 D;  1MFZ A;  3CXH I;  5AVX B;  1URQ D;  3RK3 D;  1VQ9 P;  1IFN A;  1EZV G;  1URQ A;  2IDB A;  3H1K D;  1ZXG A;  4Y99 C;  2YFI A;  5E79 H;  1USE A;  2WSE H;  1K9M Q;  3HD7 A;  2GA1 A;  5AW0 B;  1SQX E;  3VP9 A;  1NTK J;  1NYK A;  2KI7 B;  5AVV B;  1PP9 D;  2BCC E;  4GDO A;  3RK3 B;  4BWN A;  2Q5U A;  3GHG A;  3BAT A;  1KYO H;  3EQ2 A;  2IBZ D;  3K5B A;  1R5S A;  1QL2 A;  2M3E A;  2FXO A;  2DW3 A;  4PD4 E;  2YMK A;  2KLV A;  3A0H E;  3AEC C;  1KB9 I;  2XND H;  2FFD A;  2I1K A;  4WBA A;  2Q3W A;  3L75 E;  1JCD A;  1S5L X;  3H1J J;  4NB8 D;  3CI9 A;  1T8Z A;  4WY4 C;  3TGU G;  2A45 G;  4C46 A;  1VQ5 P;  2K88 A;  1VQ6 P;  3CMA P;  2N9Y B;  4H0L B;  4P1C H;  2J5U A;  4P1B H;  3RL0 D;  1QL1 A;  5B5E E;  3M0A A;  1UIX A;  1ZR4 A;  1SS1 A;  3E1I A;  1OZH A;  3MTU E;  2GM4 A;  1RF0 C;  3TGU E;  2NWF A;  3H6P A;  1T3J A;  2VRS A;  2BCC J;  2E75 C;  5AW7 B;  5B5E H;  1SQV D;  1LTB C;  2WSF H;  1OXZ A;  2E42 A;  1PGJ A;  1J1E B;  1E5W A;  1R5L A;  1N73 B;  1X8Y A;  1FZF A;  3L72 J;  3AE7 C;  3IF4 A;  2NPS D;  3HE4 B;  1M90 Q;  5KLI C;  4GOD A;  4AUW A;  3Q3D A;  2A45 H;  3HD7 B;  1L0L D;  2V7Q H;  1N7S A;  1Y8A A;  2QEX P;  1H88 A;  2Q3E A;  3GLM A;  3V2R A;  1KYO I;  4PD4 H;  3AEB C;  1N86 A;  2ZVN B;  1YTZ T;  1BE3 D;  1VDF A;  3TGU J;  3L71 D;  2Q1K A;  4B86 A;  2O01 N;  2WQY C;  2QRX A;  5KLV J;  3L70 D;  2AEF A;  1S3J A;  5KTB A;  3C8V A;  1JCC A;  3AEF C;  2FFD C;  1MFT A;  5DJU B;  4JF7 A;  3A0H H;  5AW8 B;  3I55 P;  3GHG C;  5KJ7 A;  3C9I A;  4Y28 J;  3H1H G;  3ITK A;  2P7J A;  3JCU E;  1SQQ G;  4IFF A;  1T3U A;  5K5G B;  2FYU E;  5E79 E;  2H89 C;  2KLU A;  5BU8 B;  1MV8 A;  1NO4 A;  1L4A A;  3S1K A;  1IO4 A;  3KDP B;  5CMZ A;  2B24 A;  1L0L J;  3H1J D;  4UB6 H;  3A0B E;  1Q82 Q;  1PPJ E;  3BRT B;  5H2F E;  2Y0C A;  3CCV P;  1SQP J;  3CX5 I;  2PP6 A;  3MIW A;  3V2N A;  2YKP A;  3VMY A;  1SQV K;  1FC2 C;  2KSJ A;  5APT A;  4JYC A;  3MD0 A;  5KLV K;  3GB4 A;  2WSC H;  2KNC B;  1S2E A;  3H1L J;  2JO1 A;  5KKZ B;  3S4R A;  1N73 C;  3I56 P;  1NDO A;  1M8O B;  3CCJ P;  1YI2 P;  5AVT B;  1M1J C;  1JEK A;  4IOI H;  2RMZ A;  2C0W A;  1EZV I;  2YVJ B;  1IFP A;  3BAS A;  1XTG B;  4W7Y A;  3RK2 B;  2JWA A;  3CPW O;  2IFM A;  3FX0 A;  3SWF A;  3G4S P;  3H1J G;  1HJB A;  1PP9 G;  3CCS P;  2RN0 A;  1EXI A;  3AE8 C;  1H8A A;  2ITA A;  1KC8 Q;  2KP8 A;  5B66 E;  1FZB A;  1VQM P;  1URQ C;  2KYV A;  3H1H E;  1R8E A;  2E4P A;  2OYI A;  1L0N E;  1EDI A;  1EZV E;  3CXH E;  2OTJ P;  2WPR A;  3NMD A;  4QUQ A;  2KXP B;  1OW7 A;  3H1L D;  4WVZ A;  1SFC C;  3M91 A;  3Q1M A;  1LP1 A;  4OGQ D;  1YYC A;  4OH8 B;  4JYB A;  2D2C B;  3VMI D;  5KJ7 C;  2JJL A;  2E76 D;  1KIL B;  1PL5 A;  2Q7C A;  1G8K B;  3VMG D;  2N9B A;  2D2C C;  5H2F H;  4IFD K;  5APU A;  1A02 F;  2OYO A;  3GCE A;  3M0D A;  3FWL A;  1ZOY C;  3W68 A;  2ZXE B;  3VOP A;  4NPE A;  3Q5S A;  1O7P A;  1W2E A;  2JDI H;  1GZL A;  1K73 Q;  1NTM E;  1LWU C;  1EXJ A;  1QGK B;  4XFJ A;  3GZX A;  1BE3 J;  1GU5 A;  4W7Z A;  1VQP P;  3RL0 B;  5AW6 B;  2A06 E;  3CX5 E;  1JM0 A;  2BEZ F;  2J59 M;  1NTZ E;  2KS1 A;  2ZYL A;  2N1T B;  2QJY C;  2W83 C;  1S5L H;  3M9H A;  4AYC A;  3IR9 A;  1M57 D;  2OTL P;  1NU1 G;  3CCU P;  4RO0 A;  2KZJ A;  1PV3 A;  3WUU A;  3I5C A;  5AW3 B;  1U7J A;  1LT9 A;  2OQQ A;  4U7J A;  1SFC D;  2E74 B;  1E79 H;  3IFM A;  1IFD A;  2QM8 A;  4DJG A;  3P8M C;  2GUS A;  5CCG A;  1XTC C;  4QDF A;  3EN1 A;  2NPS B;  3A3Y B;  3CWB G;  1SQB G;  4U3F E;  3LW5 H;  1L0L E;  2IFN A;  3H32 B;  3P8C D;  4YXD C;  2ZT9 C;  3II6 A;  2O01 H;  5AVW B;  2Y9Y A;  1FAV A;  1UUV A;  3T97 B;  1ULJ A;  3KYQ A;  3M0D C;  3A7O A;  2KSE A;  2ZT9 B;  4R4L A;  3A2A A;  2HMJ A;  2K9J B;  1HVV A;  3CC4 P;  2HMN A;  2R5D A;  2L5G B;  3GW6 A;  3L35 A;  4HM7 A;  2B1X A;  1NH4 A;  4PJ0 H;  5AW1 B;  1NU1 D;  3GKE A;  1KB9 D;  4HM4 A;  1BCC J;  2M8R A;  1AVY A;  1O7W A;  1L0N J;  3PJS K;  1Q90 D;  5AVR B;  4KHX A;  5DJT B;  3AE3 C;  4YXW H;  3N4X A;  1K04 A;  3FXD A;  1L4A C;  2W6B A;  2B87 B;  3A0B H;  1OVR A;  1WT6 A;  3N0Q A;  4I7Z C;  2YIU B;  3HUS B;  3CWB D;  3P8C E;  2Y9Z A;  3VMH D;  4PD4 I;  1NTK E;  3B8E B;  1RF1 C;  3TYY A;  1L0L K;  1LJ2 A;  5AVS B;  4ZNC A;  2FBW C;  2GBW A;  5AVQ B;  1HGZ A;  1FZA A;  3VTP C;  3SWK A;  3L75 D;  2A06 D;  1DEE G;  2WWW A;  1N8R Q;  1NU1 J;  5AW9 B;  1QLE D;  1CI6 B;  1SQX K;  1GMJ A;  2K3R A;  2RH0 A;  1NWQ A;  1G1J A;  4BRY A;  4YPC A;  1VF5 D;  4YTP C;  2W90 A;  1FZC B;  4OVN F;  1JY2 O;  3JSV C;  3OA7 A;  2QSI A;  3FGA D;  3CWB E;  3V4Q A;  1HGV A;  4JQ0 D;  4H0L C;  2WT7 B;  1G1I A;  2KB7 P;  1RHZ B;  4HM5 A;  4NBB D;  3Q5P A;  2Y0E A;  3G9R A;  1FBM A;  1G2C A;  5KJ7 D;  1YJ9 P;  1VQ7 P;  1P84 E;  2R32 A;  5AW4 B;  3USS A;  2Q9I A;  4QUR A;  1PPJ G;  2NRG A;  2AXT H;  1AVO A;  5KLV E;  4AIV A;  2QA4 P;  4H13 D;  1KB9 H;  1Q86 Q;  2HPC B;  4EOT A;  3L70 J;  2QE7 H;  2AEJ A;  1LWU B;  2QJK C;  5BVZ A;  2PFX A;  1O7H A;  2LXC B;  3HUS A;  4OWF A;  1IK9 A;  2R3C A;  1PIX A;  3O8Z A;  2OAR A;  3BCC D;  4HM2 A;  1IZN B;  3H32 A;  3R4Y A;  4R4M A;  1K8A Q;  1S9K E;  1VQ8 P;  3AE4 C;  3ABV C;  3TF5 A;  2YO2 A;  3WU2 E;  5TJH A;  3AE5 C;  5HL4 A;  1VQO P;  3P7K A;  1RF1 A;  2FYU J;  4WY4 B;  3SFE C;  1OVU A;  1PZQ A;  1X22 A;  1H89 A;  1FZC A;  1GDT A;  1QX8 A;  3L75 J;  4TT3 H;  1YIJ P;  1GU4 A;  1LTJ A;  2FXP A;  3EFF K;  1PGQ A;  2ZYD A;  1RQU A;  3PHL A;  1PGO A;  1SQV G;  3GOB A;  2C9N Y;  2P1J A;  3PH0 A;  1YJW P;  1UII A;  1U7M A;  1P84 H;  2XKM A;  2BMR A;  4H13 C;  1USD A;  4L76 A;  1J2J B;  5APQ A;  1AJY A;  5CJ4 A;  3R2P A;  3WU2 H;  2WZ7 A;  3L74 G;  1LGH B;  2C9L Y;  1M1J B;  2DE6 D;  4XA4 A;  2KOG A;  1MUU A;  1HH0 A;  3MUD C;  5AW2 B;  3O6Q A;  3GF3 A;  1FE6 A;  1J1D C;  2WSS H;  5M1B A;  2QJK B;  1K05 A;  3KQG A;  4U3F G;  4QCK A;  3SWY A;  1JY2 N;  2O1J A;  3H1J E;  3GMA A;  1JTH B;  1VF5 B;  4D6T E;  2IX7 C;  2I8D A;  4PV1 C;  3BVH A;  4GOE A;  1KN7 A;  3T97 A;  4ZKU A;  1BCC G;  2HG5 D;  1DH3 A;  3L71 E;  3HUS C;  1BCC D;  3H1H J;  3AE9 C;  1NU1 E;  5TIS E;  1GL2 B;  3CXH D;  1SQV J;  2O3J A;  3GTS A;  2E76 B;  1SQQ K;  1BDC A;  2FY8 A;  4HM8 A;  3V4W A;  2GUV A;  2H43 A;  1SVF A;  3CCM P;  3L72 G;  2WTY A;  1W2B O;  2PAJ A;  2ZYA A;  1LTJ C;  3H1I E;  5APW A;  1LTJ B;  1EG9 A;  4CPG A;  3NTN A;  1OIP A;  1RE3 A;  2B87 A;  4IL6 H;  3L36 A;  1JY3 N;  2BAS A;  1UUW A;  2ZVO B;  3GF7 A;  4I7Z B;  1BCC E;  1AV1 A;  2K37 A;  2ZAE B;  1NTK K;  1L4A B;  1LTI C;  3V6I A;  3AEA C;  1NKZ B;  1KFN A;  1SQP D;  1W5C E;  2QVA A;  4I2L C;  2FYU G;  1D7M A;  2I7F A;  1JY2 P;  2WPS A;  1H0T B;  2H88 C;  1SQP K;  2K1A A;  1P84 D;  1IJD B;  2NPS C;  1SJG A;  1GK4 A;  4BXL A;  4HB1 A;  3CL3 D;  3U1C A;  1ZN5 A;  1AFO A;  1RQV A;  2HR3 A;  1AQ5 A;  1NTM K;  4N3Y B;  2OYH A;  1BSN A;  1S72 P;  3KZI E;  1JO5 A;  2W6J H;  3RK3 C;  1NGM B;  1FDM A;  1RFS A;  1RH5 B;  3M9Q A;  4QDD A;  5KAF E;  2N1T C;  4W80 A;  3V2Q A;  2R44 A;  2KIK A;  1BDD A;  3G3Z A;  1FDI A;  4L73 A;  1N2D C;  5CCH D;  1ZR2 A;  3VCP A;  1NTK G;  5APV A;  2AEM A;  2YMY A;  2ZFC A;  5CCH A;  2FYN B;  5KLV G;  1KQL A;  1LWU A;  1S4X A;  5CJ0 A;  3W67 A;  1O7G A;  1P84 I;  2NVE A;  3GL2 A;  1JY3 O;  4HM3 A;  4DZO A;  4DCK A;  3PRJ A;  2P67 A;  1IFM A;  3VP8 A;  1KIL A;  1KYO D;  2XRX A;  3WUT A;  1DD3 A;  3BRV B;  2A45 I;  1KQF B;  1Z56 A;  1VCK A;  3HD7 D;  3EQQ A;  2QJP C;  4WWI A;  3KHU A;  5AW5 B;  4O9B A;  5KLI B; 
#chains in the Genus database with same CATH homology
 3FOU A;  1RIE A;  2E76 D;  3L72 E;  4QUP A;  2HMK A;  4QDF A;  3EN1 A;  1G8K B;  1SJG A;  4EMJ B;  4QCK A;  4QDC A;  3VMG D;  1SQX E;  1VM9 A;  1PP9 E;  3BCC E;  4U3F E;  3H1J E;  1L0L E;  2DE5 D;  2ZT9 D;  1O7M A;  1SQB E;  3GB4 A;  2NVG A;  4HM0 A;  5KLI C;  1NYK A;  1ULI A;  1Q90 C;  1ZRT E;  1FQT A;  2BCC E;  4D6T E;  3GCE A;  2XR8 A;  3C0D A;  3GL0 A;  3L70 E;  1UUV A;  3GZY A;  1VF5 D;  5HL4 A;  1ULJ A;  1NDO A;  2DE7 D;  5AEU A;  3L71 E;  4NBC D;  1KYO E;  1RFS A;  4AAY B;  1O7P A;  3D89 A;  3GTE A;  2HMJ A;  2YFJ A;  1KB9 E;  1NU1 E;  2NVF A;  4PD4 E;  2HMM A;  4QDD A;  2HMN A;  3CWB E;  4H0L D;  2GBX A;  1NTM E;  3GTS A;  2B1X A;  4HM7 A;  1SQP E;  4HM1 A;  1BGY E;  2YVJ B;  3GKE A;  4HM4 A;  3VCP A;  4HM8 A;  2E75 D;  2JO6 A;  5CXM A;  2BMO A;  1WQL A;  2BMQ A;  2QPZ A;  4HM5 A;  2NUK A;  4NBB D;  1BE3 E;  3AZC A;  2Q3W A;  1SQQ E;  3L75 E;  4NB9 D;  1O7W A;  4NBF D;  3GZX A;  4NB8 D;  1P84 E;  4HM6 A;  4NBG D;  4NBE D;  3DQY A;  2A06 E;  4QUR A;  3GOB A;  1O7G A;  3CX5 E;  3H1I E;  2NVE A;  3GL2 A;  1EG9 A;  4PV1 D;  2CKF A;  5KLV E;  2D2C D;  4HM3 A;  4P1C H;  4AIV A;  3L74 E;  2YIU C;  4H13 D;  3N0Q A;  4P1B H;  1NTZ E;  3H1L E;  2FYU E;  2ZYL A;  2FYN C;  2HML A;  1UUW A;  4NBH D;  1G8J B;  2BMR A;  2QJY C;  2YFL A;  4QDF B;  1BCC E;  4NBD D;  2XRX A;  3H1H E;  2E4P A;  2NUM A;  1L0N E;  1EZV E;  3CXH E;  3L73 E;  1SQV E;  3TGU E;  4QUQ A;  2QJK C;  3VCA A;  2NWF A;  3H1K E;  1O7N A;  2B24 A;  3VMH D;  1NTK E;  1O7H A;  5KKZ C;  1PPJ E;  2JZA A;  1VCK A;  2E4Q A;  3EQQ A;  2DE6 D;  2QJP C;  1JM1 A;  2IBZ E;  4HKV A;  2YFI A;  2XSH A;  2E74 D;  2GBW A;  4HJL A;  4OGQ D;  2I7F A;  5BOK A;  2XSO A;  4NBA D;  4H44 D;  3VMI D;  5AEW A;  2HMO A;  4HM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...