3H1IE

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 45
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1iE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1iE02
4HM6A 2I7FA 4H13D 5KLIC 1O7HA 2GBWA 2QJKC 4PD4E 1SQQE 4HM1A 1NU1E 4QCKA 1ULJA 2YFLA 4NBGD 2QJYC 2YIUC 3GCEA 2BMRA 3GOBA 2BCCE 4NB9D 1O7WA 5BOKA 5AEWA 3VCAA 5KLVE 2D2CD 1O7NA 4QUPA 2BMQA 1RFSA 3EQQA 2B1XA 1BE3E 1NDOA 4NBAD 2HMKA 3C0DA 1VF5D 2QPZA 3GTEA 3BCCE 1NTKE 1NTME 3CX5E 3H1JE 1NYKA 3DQYA 3L70E 3GZYA 2CKFA 2XR8A 4P1CH 2E4PA 4QUQA 1VM9A 2XSHA 1Q90C 2NVEA 3L74E 2Q3WA 3CWBE 4HM2A 3H1LE 5HL4A 4QDDA 3VCPA 2FYNC 1SQXE 4OGQD 4HJLA 3L71E 3GB4A 4QURA 2E76D 2FYUE 4HM8A 2DE7D 2NUMA 1O7PA 1SQBE 5KKZC 2JO6A 4NBFD 1P84E 1JM1A 2E75D 1L0LE 1ULIA 2QJPC 3N0QA 4NBHD 2XRXA 1NTZE 2NUKA 1UUWA 1EZVE 2JZAA 3D89A 2NVGA 4NB8D 4PV1D 1UUVA 2BMOA 2YFJA 3AZCA 2DE6D 5AEUA 1KB9E 1WQLA 3H1HE 4P1BH 3GL2A 4NBBD 3TGUE 1EG9A 4AAYB 2A06E 2NVFA 1G8JB 3CXHE 3H1IE 1BGYE 2E74D 2HMJA 2ZT9D 1KYOE 3VMHD 4HM4A 1RIEA 2GBXA 3L72E 3EN1A 2IBZE 4D6TE 4HM5A 4NBED 1O7MA 1PP9E 2ZYLA 4QDFA 3VMGD 3H1KE 3GL0A 3GKEA 2YVJB 4H44D 1ZRTE 2HMNA 2YFIA 2HMLA 1FQTA 4QDFB 2NWFA 4AIVA 3L75E 1PPJE 1L0NE 4QDCA 5CXMA 4EMJB 2HMOA 3GZXA 3GTSA 1SQVE 3VMID 2HMMA 4NBDD 1SJGA 2E4QA 4HM7A 1VCKA 4NBCD 1G8KB 4HM0A 1BCCE 2B24A 2XSOA 4HM3A 3L73E 1SQPE 1O7GA 4U3FE 2DE5D 4H0LD 4HKVA 3FOUA
chains in the Genus database with same CATH superfamily
2IYOA 1O7HA 1EZVD 4NPDA 4QMAA 5KLVK 3CCSP 1N2DC 2BCCE 2QIWA 3NXSA 3RL0D 2YKPA 3SWFA 4DT0A 3GTEA 3H1ID 3V2RA 2FFDC 2XSHA 1LNQA 4WY4C 2Z4EA 4JBZA 3H1LE 1S9KD 3WUUA 3B4SA 2H43A 1L0LE 1SQPG 2XRXA 1RF0A 1J2JB 3CX5D 2O01H 3II6A 2KI7B 1G2CA 2ZT9C 1W5CE 5APYA 3RBXA 2WT7A 1JTHA 1SQBG 3H1JJ 1NTZG 5KLVD 4HM4A 4JF7A 3CL3D 3CWBJ 1VQNP 1NKZB 3CLQA 3AE3C 2HODB 5TJHA 3VN0A 1R8EA 1P84I 1IFMA 2DW3A 3CD6P 1KILA 3TGUG 3AE9C 3GL0A 5KTBA 1SQXG 2WSEJ 1SFCB 1GDTA 2HPCA 1X79B 3F5HA 1HUCA 2OYIB 5AW3B 3LW5H 1N7LA 1SJGA 2ZYDA 3CXHD 3PRJA 2W90A 3VP9A 1URQC 3MP7B 1JMBA 1FZEA 2JWAA 2KUBA 2P58A 3VCAA 4QUPA 4DOJA 3KZIH 2SPZA 4LLHA 3CCUP 3BCCE 2WZ7A 1Q86Q 1SQQG 1HBWA 3WMM0 1SFCD 4BRYB 5KAFE 2M5AB 3M0AA 3V2QA 4GODA 3L72J 3CMEP 1L0LK 2I8DA 2K9YA 2P2UA 3CC2P 3IN6A 2HLOA 3L75D 2LXCB 3F89A 2YO3A 4NBHD 1WRGA 1NU1J 1NTKD 2FXMA 5BU5A 2A45G 1BCCD 2DE6D 1KB9E 1LTGC 1S72P 4DJGA 3D6YA 4N6JA 3SWYA 2OTKE 3W68A 2BCCD 2KSEA 1J1DC 4K3AA 1P84D 3W67A 3AEEC 3AECC 2YVJB 1CSBA 2OYHA 3A3YB 1KD1Q 2HMLA 2M0BA 2AXCA 3GZXA 2G3AA 3L36A 4I1LA 4NBCD 2XSOA 1SQPE 5AW7B 1L0LD 1EDIA 2AEMA 2NPSA 2GBWA 5KKZB 3H1IJ 2I1JA 4Y99B 2QJYC 1L0NG 3GCEA 4JPZB 2KSJA 2OTJP 3GW6A 1KB9I 2NZ2A 1GK6A 5CCHD 1NYHA 2ZYAA 5KLIC 4D6TG 1KZUB 1NYKA 2XV5A 2QE7H 4OGQC 2B87A 1VM9A 2RH0A 1IZNB 4IL6H 5TISH 3VP8A 3OAKA 5CCGC 1PZQA 1SQXE 2OYOA 4W7ZA 2ZVNB 1RF0C 1YBKA 1LWUC 1LTTC 2M3BA 3L73G 2ZYGA 2NRGA 2I1KA 2W6BA 2E42A 2YMKA 3VTPC 1EXIA 3D89A 4WWIA 2KB7P 5KLVJ 1IK9A 1HJBA 4HYTB 3CPWO 1R5LA 3A5TA 3HUSC 1QLED 1H89A 1DD3A 1KILC 3RK2B 2E5TA 1GU4A 1FS0E 3U1CA 3BCCD 1YJNP 1Y8AA 1M56D 2LR2A 2L5GB 1YQ3C 2FYUG 5APXA 1N73C 1FQTA 2WSCJ 1PPJE 2FFDB 4EMJB 2WQYC 4WY4B 1QGKB 1SQPK 2R3CA 2B24A 1M7LA 2XDJA 1T2KC 1MKMA 1EDLA 3KXDA 1NKNA 3CMAP 1M1JA 1KB9D 1BGYG 1BDCA 1LTJA 2HYNA 3LIDA 3TDKA 1M8OB 3D6ZA 1DD4A 3LIEA 2KZIA 1L4AA 1PL5A 5APQA 1N86A 5AVUB 3L75J 1SQXK 1GZLA 5APSA 4ASWA 2FBWC 4XA4A 1H0TB 1BCCJ 4WY4D 2DE7D 1RE4A 1G1IA 1LTIC 5AVWB 4BXLA 2IFMA 2J5UA 2M8RA 3HRNA 1SQPD 1AA0A 5B66H 1HJ0A 1LT9B 4AAYB 2O1KA 1W2BO 1RHZB 2PP6A 3N7NA 5KJ7D 1ZP0C 2A45I 1KQGB 1URQB 5AVXB 2XNXA 2ZT9D 2K9JA 3BASA 2WMMA 3L37A 5CMZA 1SQBD 3P8MC 3MD0A 3H1LJ 4D6TE 1Q7YQ 2OYHC 4EI2A 3L74G 1NTZD 2B9BA 3BRVB 3M0DC 4UB6E 3JCUH 5BVZA 2Y0DA 1L0LJ 1OW8A 2NWFA 3TGUD 1SQXD 3V2PA 1VQ8P 1Y9BA 2Q5UA 1NOHA 2KNCB 3L73E 4HKVA 1RF1B 4HM6A 3ABVC 1S9KE 2Q3IA 2E75C 3VOPA 1VF5C 2YIUC 2E5YA 3IF4A 1URQD 2O3JA 4ZNCA 1BE3E 2HMKA 2IZ0A 3QH9A 3CX5E 5CJ4A 1H0TA 1W2EA 4QUQA 3ZDMA 5APUA 1J1EB 3C8VA 1PIXA 1CZQA 4HM2A 1S5LE 2H7HA 1JY2P 3KHUA 1XTGB 3V5BA 4H44B 1OVRA 2FYUE 2POHA 1LT1A 4YXDC 1E79H 3VYIA 1JY3N 3VMZA 1FOSE 1LT9A 2ZVOB 4I6MC 2KS1A 3A7OA 4KJMA 2KOGA 2J59M 1OX3A 1DIPA 1IFIA 3BCCJ 3CXHE 1BGYE 3WU2E 1K73Q 1T3JA 1IJDB 4GOEA 2GUSA 3PH0A 4H44D 1HVVA 1OXZA 2XNDH 4KT0J 1K9MQ 4OGQB 2KNCA 1EQ7A 1RF1A 2E4QA 1QVFO 4ASVA 2YKOA 1O7GA 3TF5A 1M1JC 1LTJC 1IC2A 3L71J 1KMIZ 2QJKC 1JMMA 1LWUB 1NJIQ 4QCKA 4ZMDA 4C7NA 3FWNA 3JSVC 2AEJA 4W80A 1YITP 1X9VA 1NTKE 1K05A 3H1HJ 3VMYA 5KAIH 3B5NB 3L74E 4D6TD 1RE4C 5GTIE 1EC5A 2FYUK 4OGQD 3HTKB 3M9QA 2KLVA 1SQVG 1SQPJ 2ZXXA 1P84E 2N1TB 1FBMA 1PP9J 1ULIA 4EYYQ 4DCKA 1M90Q 1N73B 3HE4B 3L73D 1S5LX 3N4XA 2ITAA 4NBBD 5AW8B 2FYZA 3SFDC 1X0TA 3L70G 5L8RJ 1BE3D 2YO2A 1KYOH 2WWWA 3B5ND 1SQXJ 1Y47A 3IFMA 3ITKA 3FWLA 1GU5A 1MFZA 3GKEA 2R5DA 4M3LA 4LGDE 1T8ZA 3V2NA 2N1TD 3AE7C 3VMXA 2FYUD 2Q1KA 4HM0A 1LTAC 1VQ9P 5H2FE 4PD4E 1HTLC 3AEFC 3HD7C 2A06G 4NB9D 2WTYA 1T2KD 4PV1C 1NTKK 4NBAD 2IBZG 2WPRA 3TSIA 1N7SC 1VL2A 1BGYD 1NAYA 5AW2B 1BDDA 2E4PA 3CCQP 4XE5B 3GF3A 1VQ6P 4GT1A 1FZBA 1CW5A 1OVUA 2BEQD 3GHGB 1AJYA 2WSEH 1OWAA 1GL2C 2NVGA 3R4YA 1UUVA 2BMOA 1YQ4C 3QWOC 1RQUA 3A0HE 3V4QA 2N9YB 3U59A 4AUWA 3T97B 4PD4I 2IZ1A 5AVSB 3WUTA 1Q90D 1QL1A 2XKMA 3E1RA 1ZLLA 1MV8A 3L4FA 1VF5B 2D2CC 4AYCA 1AV1A 1FZCB 3PTZA 2WSSH 1JY3O 1USDA 3CCLP 1ZW0A 3L74D 1D7MA 2UWJE 4AIVA 2HODA 1SQVE 3RK3C 3EFGA 2KXPB 1VQLP 1RE3A 1KC8Q 1MUUA 1SFCA 2Y9ZA 1IFJA 2W83C 1FDOA 1BSNA 4XFJA 2OYIA 1O7WA 5BOKA 4W7YA 2BMQA 3O6QB 4D6TJ 2CPSA 3L72G 1KTMA 3CC4P 1PV3A 1VF5D 3L70E 2IFNA 2XR8A 1SVFA 2V7QJ 3AEDC 2E76C 2E74C 5E79H 1A02J 3CI9A 4IFMA 3GHGA 5AVQB 4HM8A 3L73J 1SQBE 1H8AA 3N0QA 1NTZE 1UUWA 2C0WA 1JM0A 4TLFA 4BRYA 3RBZA 2K3RA 2M5AA 2WPVB 3T97A 4PJ0H 1BE3J 2P67A 3TGUE 3AEAC 4I2LC 3KPEA 2A06E 4PD4D 2V7QH 2FY8A 3I5CA 5C39A 2ZFCA 1IO4A 2P10A 2AEFA 2QJKB 2P7JA 1FZCA 2IBZE 3OW2O 1FDIA 4MN4C 4NBED 2B89A 3D71A 3RL0C 2ZYLA 3FX0A 2FYUJ 4I7ZC 2KLUA 1NAFA 2WVRA 4JYCA 1DX7A 1SQVK 5DJTB 4QDCA 5CCHA 1RY3A 3MUDA 4L75A 2I7FA 2PAJA 1BGYJ 1SQQE 3KZIE 2CK3H 2B1XA 4HJGH 5GTHH 1QL2A 1YHQP 1QEXA 2IBZI 2R32A 5KLVG 5HL4A 3AE4C 2BASA 1SQBK 1A02F 2Y0EA 1ZMEC 1NTZK 4UB8H 1JM1A 2QA4P 1UIIA 2RMZA 4N78E 2QJPC 2ZT9B 1SQVD 4EDFA 1QX8A 1SS1A 3S9OA 3RK3E 2KZJA 2FXOA 2WSCH 1HF9A 2QG4A 2XZRA 1NTKJ 1ZV8A 1JCCA 2KP8A 1VQ4P 1NO4A 1RH5B 2HMJA 1NTMG 2GBXA 3L72E 2PGDA 3HD7B 1CI6B 3S1KA 1KQLA 1O7MA 1PGPA 2BCCJ 3L70D 1SLQA 2OARA 3BVHA 3B71A 1JEKA 2Q6QA 3CCJP 1LTBC 1L0NE 3I56P 4H13C 1M1KQ 1YI2P 3MGNA 2HMMA 4NBDD 2C0XA 3EFFK 1G8KB 1K04A 2PFXA 1SQQK 5APVA 1S2EA 3OJAB 3P8CE 2WITA 2CPBA 2FFDA 4R4MA 3CC7P 2H8PD 4WY4A 1OIPA 1YTZI 5AEWA 5GTIH 1NGMB 2A06D 3S4RA 1BCCG 3H32B 3HD7D 1JUNA 3AE5C 4HM5A 2NPSC 4IL6E 2IBZD 2FKWB 3GLMA 3VMAA 1K8AQ 1NWQA 5KJ7A 4HJLA 2H88C 3GB4A 5AVRB 4WBAA 1KFNA 3C1LA 1VQ7P 3AE1C 1OMIA 4ZKPA 1KILE 3KQGA 3H1LG 3E7KA 4AQRD 2Q7CA 4P1BH 1M57D 3RK3B 1GW3A 2OTLP 1PGOA 1S4XA 1J1DB 1SQQD 4YTPC 3AEBC 1Q82Q 1CI6A 3M9BA 3A2AA 1FJKA 4YXWH 2OGUA 3TNUB 1FC2C 3D70A 2IYPA 1VDFA 3Q3DA 2KIKA 1MFTA 5AVZB 1LJ2A 1GD2E 3K5BA 3Q5PA 5CCHC 1URQA 2MJZA 1L0NK 3Q5RA 1FAVA 5CXMA 1G1JA 2E76B 3CCMP 4L73A 1R5SA 4RO0A 3IAOA 1YYCA 1X22A 2QJYB 2G8YA 4N78D 2M3EA 3SFEC 2YXQB 4HM1A 3RK3D 4YPCA 2JR8A 2YFLA 4NBGD 3H25A 5KLIB 2Z5IA 3H6PA 1HGZA 4Y99C 1LP1B 1NTME 3DQYA 3BRTB 2Z5HA 3H1KG 4RKUJ 4Z1MH 3L72D 2K88A 4Y28J 1NHLA 1KV4A 3VCPA 1SQVJ 2GUVA 1G2CB 2E76D 1LTSC 1O7PA 2WT7B 5AW0B 5KAFH 1TU3F 3EWKA 4NBFD 3CCRP 3PP5A 4IL6X 1L4AC 1L0ND 3CCVP 4I7ZB 2HR3A 4U3FG 1YJWP 1ZR2A 5B66E 1JOCA 3AZCA 3Q5SA 5AEUA 5B5EE 3HUSB 2W6AA 1KILB 3PHLA 3P8CD 1KB9H 4HKZH 2GM4A 1VQMP 3L70J 1KN7A 5CCGD 3JCUE 2Y0CA 1JY2O 3RK2C 1SQBJ 2J58A 3L71G 1PFIA 3KYQA 1DEEG 3FXDA 2O01J 1NTZJ 1T3UA 3SSUA 5AW9B 4RESB 3MHVA 3TGUJ 1GK4A 2QM7A 1HWTC 3H1HG 4OWFA 1KILD 1JY3P 1LP1A 2QJPB 3USSA 2WSFJ 2H89C 1FJPA 5CCGA 1NTMK 4C7RA 3C0DA 2QVAA 1E5WA 3MTUE 2CKFA 1LWUA 1IFNA 1PP9G 5KJ7C 3LW5J 1IK7A 3G3ZA 2AXTE 3M9HA 3RGUA 1KQSO 1BSHA 1VQ5P 3B8EB 3B5NA 5CJ0A 1SQQJ 3HUSA 1FZAA 4WVZA 1OVVA 2WSFH 3HTKA 4H13B 1EG9A 2N1TA 3PJSK 2NVFA 2IPPA 1LT9C 2OYHB 1IFPA 3H1JG 3VMHD 4B86A 1N73A 2LXBA 3HE4A 2HFED 1AQ5A 4OVNF 1KORA 3CWBG 1NTMD 1EXJA 3FXEA 3H1KE 2RKLA 4IFDK 1ZRTE 2NPSB 5CHXA 2HMNA 1USEA 1U7JA 2KYVA 2R5BA 1OW7A 5CBOA 2YKQA 2E75B 3MIWA 4U3FE 2YNYA 2YIUB 2P1JA 2Q3EA 3CCEP 3R2PA 4H13D 2JDIH 3A0BE 2JEEA 2B87B 2K37A 1N8RQ 3JC22 1IFDA 1PPJG 4TT3H 1RF1C 2BMRA 1UIXA 2A45H 1AFOA 1NDOA 5AW5B 1YIJP 2C9LY 4EOTA 5KAIE 3TYYA 3G6EP 2QPZA 1QVGO 4IOIH 2QSIA 2MKVA 2NVEA 1Q81Q 4O9BA 1L0NJ 2NPSD 1DH3A 4QDDA 2Y9YA 1GMJA 3L71E 1J1EC 1JO5A 1H88A 2NUMA 2E75D 2W6JH 4H44C 3WUVA 3RL0g 1RQVA 1PGJA 2JWDA 2JZAA 4NB8D 2YFJA 1NU1G 3NMDA 1WQLA 4CPGA 3H1HE 3H1LD 3M0DA 3NTNA 1G8JB 4GKGA 4EIJA 1KYOE 1GTWA 3EN1A 1PP9E 3Q1MA 1ZR4A 2W8ZA 1LGHB 3O8ZA 2GA1A 1HGVA 1DEBA 4H0LC 4UB6H 3GTSA 4HB1A 1M1JB 2BEZF 4HM7A 1LTJB 2ZJSE 1EZVG 1VCKA 2KK7A 3OA7A 2B88A 2OQQA 1X8YA 3PLNA 2QEXP 3FGAD 2IX7C 1L4AB 3GOBA 1L2PA 3H1IG 3EQ2A 1U7MA 1GW4A 4NPFX 3H1JE 1SP4A 1MZ9A 4KHXA 2E43A 5DJUB 1KYOI 1JB0J 2R44A 3CX5H 2Q3WA 3CWBE 2O1JA 3O6QA 2FYNC 3KDPB 3H1KD 4QURA 1BE3G 3B5NC 1S5LH 1ZRTD 1S1CX 2IDBA 4RJTA 2K9JB 2N1TC 1L4AD 4U3FD 4U7JA 3SWKA 4DZOA 2WPSA 1EDKA 1NTMJ 1NH4A 1WMKA 3G9RA 4K35A 5AW6B 3G71P 1VQKP 5AW4B 1JY2N 1AVYA 4JYBA 4LC1A 3CXHH 3WU2H 2YXRB 5CBNA 4L74A 1ZOYC 2YFIA 2L91A 1YJ9P 1ZXGA 1KQFB 3RK2D 2HMOA 1XTCC 4GOFA 3L71D 1T6AA 3L74J 4HM3A 3M06A 2DE5D 3FOUA 5M1BA 3AEGC 4PV1B 1S3JA 2ZAEB 1NU1E 1N7SB 3H1HD 4GDOA 1O7NA 3V4WA 3EQQA 1FE6A 1RE3C 2N9BA 2FXPA 1SFCC 1U57A 4C46A 5E79E 3GZYA 1KYOD 1FOSF 2OYIC 1Q90C 3AE8C 1NVOA 1Q2NA 2W27A 3GG2A 3HE5B 1PP9D 3L75G 4IFFA 3P7KA 4HH2A 5B5EH 2KS1B 2JO6A 4JQ0D 1NTKG 1OW6A 1GL2B 5AW1B 4PJ0E 5TISE 3TK1A 1EZVE 1P84H 4PV1D 3UIAA 3BATA 2HG5D 3GHGC 2BCCG 1N7SD 4L76A 4NPEA 1FDMA 3H1IE 2D2CB 1WT6A 4N3YB 4OH8B 5EFWB 2RN0A 3M91A 3H1JD 5APTA 2ZXEB 2V4HA 2O01N 2XU6A 3CWBD 4QDFB 1ZN5A 2LKMA 2R3SA 1FZCC 1GL2D 1JNMA 4GIFA 2YMYA 3HD7A 4C7NB 4WB4A 2K1AA 1L0LG 2VRSA 3IR9A 5K5GB 1AQTA 1OFCX 1NU1K 1N7SA 1EZVI 1ULJA 5H2FH 5AVVB 3MUDC 5GTHE 1VPCA 3C9IA 1FZGA 4PD4H 2D2CD 5KLVE 2JJLA 1RFSA 1JCDA 2AXTH 1FZFA 3I55P 2E74B 1PPJD 4BWNA 3VMID 3H1KJ 3AE6C 5AVTB 2QM8A 4P1CH 3HE5A 3E1IA 3L35A 1PGQA 1GL2A 2JO1A 4UB8E 1VQPP 3H32A 5BU8B 3Q2YA 4U3FJ 5KKZC 1EDJA 3AE2C 3G4SP 2C9NY 2NUKA 5APWA 3GMAA 1VQOP 3U1AA 3CX5I 4R4LA 4H0LB 3GL2A 1AVOA 1NU1D 3A0HH 2JKVA 2E74D 2QRXA 3BCCG 1JTHB 3RL0B 1RIEA 1OZHA 2JP3A 2PRRA 1Z56A 1YTZT 4QDFA 1HH0A 1FU1A 4ZKUA 3VMGD 2Q9IA 5AVYB 3A0BH 3TNUA 3L75E 3P32A 3GF7A 3MZWB 1KFMA 4A7PA 2HPCB 3CXHI 1BCCE 2FYNB 3NFQA 3V6IA 2WPQA 4H0LD
chains in the Genus database with same CATH topology
4HM6A 2I7FA 4H13D 5KLIC 1O7HA 2GBWA 2QJKC 4PD4E 1SQQE 4HM1A 1NU1E 4QCKA 1ULJA 2YFLA 4NBGD 2QJYC 2YIUC 3GCEA 2BMRA 3GOBA 2BCCE 4NB9D 1O7WA 5BOKA 5AEWA 3VCAA 5KLVE 2D2CD 1O7NA 4QUPA 2BMQA 1RFSA 3EQQA 2B1XA 1BE3E 1NDOA 4NBAD 2HMKA 3C0DA 1VF5D 2QPZA 3GTEA 3BCCE 1NTKE 1NTME 3CX5E 3H1JE 1NYKA 3DQYA 3L70E 3GZYA 2CKFA 2XR8A 4P1CH 2E4PA 4QUQA 1VM9A 2XSHA 1Q90C 2NVEA 3L74E 2Q3WA 3CWBE 4HM2A 3H1LE 5HL4A 4QDDA 3VCPA 2FYNC 1SQXE 4OGQD 4HJLA 3L71E 3GB4A 4QURA 2E76D 2FYUE 4HM8A 2DE7D 2NUMA 1O7PA 1SQBE 5KKZC 2JO6A 4NBFD 1P84E 1JM1A 2E75D 1L0LE 1ULIA 2QJPC 3N0QA 4NBHD 2XRXA 1NTZE 2NUKA 1UUWA 1EZVE 2JZAA 3D89A 2NVGA 4NB8D 4PV1D 1UUVA 2BMOA 2YFJA 3AZCA 2DE6D 5AEUA 1KB9E 1WQLA 3H1HE 4P1BH 3GL2A 4NBBD 3TGUE 1EG9A 4AAYB 2A06E 2NVFA 1G8JB 3CXHE 3H1IE 1BGYE 2E74D 2HMJA 2ZT9D 1KYOE 3VMHD 4HM4A 1RIEA 2GBXA 3L72E 3EN1A 2IBZE 4D6TE 4HM5A 4NBED 1O7MA 1PP9E 2ZYLA 4QDFA 3VMGD 3H1KE 3GL0A 3GKEA 2YVJB 4H44D 1ZRTE 2HMNA 2YFIA 2HMLA 1FQTA 4QDFB 2NWFA 4AIVA 3L75E 1PPJE 1L0NE 4QDCA 5CXMA 4EMJB 2HMOA 3GZXA 3GTSA 1SQVE 3VMID 2HMMA 4NBDD 1SJGA 2E4QA 4HM7A 1VCKA 4NBCD 1G8KB 4HM0A 1BCCE 2B24A 2XSOA 4HM3A 3L73E 1SQPE 1O7GA 4U3FE 2DE5D 4H0LD 4HKVA 3FOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM6 A;  2I7F A;  4H13 D;  5KLI C;  1O7H A;  2GBW A;  2QJK C;  4PD4 E;  1SQQ E;  4HM1 A;  1NU1 E;  4QCK A;  1ULJ A;  2YFL A;  4NBG D;  2QJY C;  2YIU C;  3GCE A;  2BMR A;  3GOB A;  2BCC E;  4NB9 D;  1O7W A;  5BOK A;  5AEW A;  3VCA A;  5KLV E;  2D2C D;  1O7N A;  4QUP A;  2BMQ A;  1RFS A;  3EQQ A;  2B1X A;  1BE3 E;  1NDO A;  4NBA D;  2HMK A;  3C0D A;  1VF5 D;  2QPZ A;  3GTE A;  3BCC E;  1NTK E;  1NTM E;  3CX5 E;  3H1J E;  1NYK A;  3DQY A;  3L70 E;  3GZY A;  2CKF A;  2XR8 A;  4P1C H;  2E4P A;  4QUQ A;  1VM9 A;  2XSH A;  1Q90 C;  2NVE A;  3L74 E;  2Q3W A;  3CWB E;  4HM2 A;  3H1L E;  5HL4 A;  4QDD A;  3VCP A;  2FYN C;  1SQX E;  4OGQ D;  4HJL A;  3L71 E;  3GB4 A;  4QUR A;  2E76 D;  2FYU E;  4HM8 A;  2DE7 D;  2NUM A;  1O7P A;  1SQB E;  5KKZ C;  2JO6 A;  4NBF D;  1P84 E;  1JM1 A;  2E75 D;  1L0L E;  1ULI A;  2QJP C;  3N0Q A;  4NBH D;  2XRX A;  1NTZ E;  2NUK A;  1UUW A;  1EZV E;  2JZA A;  3D89 A;  2NVG A;  4NB8 D;  4PV1 D;  1UUV A;  2BMO A;  2YFJ A;  3AZC A;  2DE6 D;  5AEU A;  1KB9 E;  1WQL A;  3H1H E;  4P1B H;  3GL2 A;  4NBB D;  3TGU E;  1EG9 A;  4AAY B;  2A06 E;  2NVF A;  1G8J B;  3CXH E;  3H1I E;  1BGY E;  2E74 D;  2HMJ A;  2ZT9 D;  1KYO E;  3VMH D;  4HM4 A;  1RIE A;  2GBX A;  3L72 E;  3EN1 A;  2IBZ E;  4D6T E;  4HM5 A;  4NBE D;  1O7M A;  1PP9 E;  2ZYL A;  4QDF A;  3VMG D;  3H1K E;  3GL0 A;  3GKE A;  2YVJ B;  4H44 D;  1ZRT E;  2HMN A;  2YFI A;  2HML A;  1FQT A;  4QDF B;  2NWF A;  4AIV A;  3L75 E;  1PPJ E;  1L0N E;  4QDC A;  5CXM A;  4EMJ B;  2HMO A;  3GZX A;  3GTS A;  1SQV E;  3VMI D;  2HMM A;  4NBD D;  1SJG A;  2E4Q A;  4HM7 A;  1VCK A;  4NBC D;  1G8K B;  4HM0 A;  1BCC E;  2B24 A;  2XSO A;  4HM3 A;  3L73 E;  1SQP E;  1O7G A;  4U3F E;  2DE5 D;  4H0L D;  4HKV A;  3FOU A; 
#chains in the Genus database with same CATH topology
 2IYO A;  1O7H A;  1EZV D;  4NPD A;  4QMA A;  5KLV K;  3CCS P;  1N2D C;  2BCC E;  2QIW A;  3NXS A;  3RL0 D;  2YKP A;  3SWF A;  4DT0 A;  3GTE A;  3H1I D;  3V2R A;  2FFD C;  2XSH A;  1LNQ A;  4WY4 C;  2Z4E A;  4JBZ A;  3H1L E;  1S9K D;  3WUU A;  3B4S A;  2H43 A;  1L0L E;  1SQP G;  2XRX A;  1RF0 A;  1J2J B;  3CX5 D;  2O01 H;  3II6 A;  2KI7 B;  1G2C A;  2ZT9 C;  1W5C E;  5APY A;  3RBX A;  2WT7 A;  1JTH A;  1SQB G;  3H1J J;  1NTZ G;  5KLV D;  4HM4 A;  4JF7 A;  3CL3 D;  3CWB J;  1VQN P;  1NKZ B;  3CLQ A;  3AE3 C;  2HOD B;  5TJH A;  3VN0 A;  1R8E A;  1P84 I;  1IFM A;  2DW3 A;  3CD6 P;  1KIL A;  3TGU G;  3AE9 C;  3GL0 A;  5KTB A;  1SQX G;  2WSE J;  1SFC B;  1GDT A;  2HPC A;  1X79 B;  3F5H A;  1HUC A;  2OYI B;  5AW3 B;  3LW5 H;  1N7L A;  1SJG A;  2ZYD A;  3CXH D;  3PRJ A;  2W90 A;  3VP9 A;  1URQ C;  3MP7 B;  1JMB A;  1FZE A;  2JWA A;  2KUB A;  2P58 A;  3VCA A;  4QUP A;  4DOJ A;  3KZI H;  2SPZ A;  4LLH A;  3CCU P;  3BCC E;  2WZ7 A;  1Q86 Q;  1SQQ G;  1HBW A;  3WMM 0;  1SFC D;  4BRY B;  5KAF E;  2M5A B;  3M0A A;  3V2Q A;  4GOD A;  3L72 J;  3CME P;  1L0L K;  2I8D A;  2K9Y A;  2P2U A;  3CC2 P;  3IN6 A;  2HLO A;  3L75 D;  2LXC B;  3F89 A;  2YO3 A;  4NBH D;  1WRG A;  1NU1 J;  1NTK D;  2FXM A;  5BU5 A;  2A45 G;  1BCC D;  2DE6 D;  1KB9 E;  1LTG C;  1S72 P;  4DJG A;  3D6Y A;  4N6J A;  3SWY A;  2OTK E;  3W68 A;  2BCC D;  2KSE A;  1J1D C;  4K3A A;  1P84 D;  3W67 A;  3AEE C;  3AEC C;  2YVJ B;  1CSB A;  2OYH A;  3A3Y B;  1KD1 Q;  2HML A;  2M0B A;  2AXC A;  3GZX A;  2G3A A;  3L36 A;  4I1L A;  4NBC D;  2XSO A;  1SQP E;  5AW7 B;  1L0L D;  1EDI A;  2AEM A;  2NPS A;  2GBW A;  5KKZ B;  3H1I J;  2I1J A;  4Y99 B;  2QJY C;  1L0N G;  3GCE A;  4JPZ B;  2KSJ A;  2OTJ P;  3GW6 A;  1KB9 I;  2NZ2 A;  1GK6 A;  5CCH D;  1NYH A;  2ZYA A;  5KLI C;  4D6T G;  1KZU B;  1NYK A;  2XV5 A;  2QE7 H;  4OGQ C;  2B87 A;  1VM9 A;  2RH0 A;  1IZN B;  4IL6 H;  5TIS H;  3VP8 A;  3OAK A;  5CCG C;  1PZQ A;  1SQX E;  2OYO A;  4W7Z A;  2ZVN B;  1RF0 C;  1YBK A;  1LWU C;  1LTT C;  2M3B A;  3L73 G;  2ZYG A;  2NRG A;  2I1K A;  2W6B A;  2E42 A;  2YMK A;  3VTP C;  1EXI A;  3D89 A;  4WWI A;  2KB7 P;  5KLV J;  1IK9 A;  1HJB A;  4HYT B;  3CPW O;  1R5L A;  3A5T A;  3HUS C;  1QLE D;  1H89 A;  1DD3 A;  1KIL C;  3RK2 B;  2E5T A;  1GU4 A;  1FS0 E;  3U1C A;  3BCC D;  1YJN P;  1Y8A A;  1M56 D;  2LR2 A;  2L5G B;  1YQ3 C;  2FYU G;  5APX A;  1N73 C;  1FQT A;  2WSC J;  1PPJ E;  2FFD B;  4EMJ B;  2WQY C;  4WY4 B;  1QGK B;  1SQP K;  2R3C A;  2B24 A;  1M7L A;  2XDJ A;  1T2K C;  1MKM A;  1EDL A;  3KXD A;  1NKN A;  3CMA P;  1M1J A;  1KB9 D;  1BGY G;  1BDC A;  1LTJ A;  2HYN A;  3LID A;  3TDK A;  1M8O B;  3D6Z A;  1DD4 A;  3LIE A;  2KZI A;  1L4A A;  1PL5 A;  5APQ A;  1N86 A;  5AVU B;  3L75 J;  1SQX K;  1GZL A;  5APS A;  4ASW A;  2FBW C;  4XA4 A;  1H0T B;  1BCC J;  4WY4 D;  2DE7 D;  1RE4 A;  1G1I A;  1LTI C;  5AVW B;  4BXL A;  2IFM A;  2J5U A;  2M8R A;  3HRN A;  1SQP D;  1AA0 A;  5B66 H;  1HJ0 A;  1LT9 B;  4AAY B;  2O1K A;  1W2B O;  1RHZ B;  2PP6 A;  3N7N A;  5KJ7 D;  1ZP0 C;  2A45 I;  1KQG B;  1URQ B;  5AVX B;  2XNX A;  2ZT9 D;  2K9J A;  3BAS A;  2WMM A;  3L37 A;  5CMZ A;  1SQB D;  3P8M C;  3MD0 A;  3H1L J;  4D6T E;  1Q7Y Q;  2OYH C;  4EI2 A;  3L74 G;  1NTZ D;  2B9B A;  3BRV B;  3M0D C;  4UB6 E;  3JCU H;  5BVZ A;  2Y0D A;  1L0L J;  1OW8 A;  2NWF A;  3TGU D;  1SQX D;  3V2P A;  1VQ8 P;  1Y9B A;  2Q5U A;  1NOH A;  2KNC B;  3L73 E;  4HKV A;  1RF1 B;  4HM6 A;  3ABV C;  1S9K E;  2Q3I A;  2E75 C;  3VOP A;  1VF5 C;  2YIU C;  2E5Y A;  3IF4 A;  1URQ D;  2O3J A;  4ZNC A;  1BE3 E;  2HMK A;  2IZ0 A;  3QH9 A;  3CX5 E;  5CJ4 A;  1H0T A;  1W2E A;  4QUQ A;  3ZDM A;  5APU A;  1J1E B;  3C8V A;  1PIX A;  1CZQ A;  4HM2 A;  1S5L E;  2H7H A;  1JY2 P;  3KHU A;  1XTG B;  3V5B A;  4H44 B;  1OVR A;  2FYU E;  2POH A;  1LT1 A;  4YXD C;  1E79 H;  3VYI A;  1JY3 N;  3VMZ A;  1FOS E;  1LT9 A;  2ZVO B;  4I6M C;  2KS1 A;  3A7O A;  4KJM A;  2KOG A;  2J59 M;  1OX3 A;  1DIP A;  1IFI A;  3BCC J;  3CXH E;  1BGY E;  3WU2 E;  1K73 Q;  1T3J A;  1IJD B;  4GOE A;  2GUS A;  3PH0 A;  4H44 D;  1HVV A;  1OXZ A;  2XND H;  4KT0 J;  1K9M Q;  4OGQ B;  2KNC A;  1EQ7 A;  1RF1 A;  2E4Q A;  1QVF O;  4ASV A;  2YKO A;  1O7G A;  3TF5 A;  1M1J C;  1LTJ C;  1IC2 A;  3L71 J;  1KMI Z;  2QJK C;  1JMM A;  1LWU B;  1NJI Q;  4QCK A;  4ZMD A;  4C7N A;  3FWN A;  3JSV C;  2AEJ A;  4W80 A;  1YIT P;  1X9V A;  1NTK E;  1K05 A;  3H1H J;  3VMY A;  5KAI H;  3B5N B;  3L74 E;  4D6T D;  1RE4 C;  5GTI E;  1EC5 A;  2FYU K;  4OGQ D;  3HTK B;  3M9Q A;  2KLV A;  1SQV G;  1SQP J;  2ZXX A;  1P84 E;  2N1T B;  1FBM A;  1PP9 J;  1ULI A;  4EYY Q;  4DCK A;  1M90 Q;  1N73 B;  3HE4 B;  3L73 D;  1S5L X;  3N4X A;  2ITA A;  4NBB D;  5AW8 B;  2FYZ A;  3SFD C;  1X0T A;  3L70 G;  5L8R J;  1BE3 D;  2YO2 A;  1KYO H;  2WWW A;  3B5N D;  1SQX J;  1Y47 A;  3IFM A;  3ITK A;  3FWL A;  1GU5 A;  1MFZ A;  3GKE A;  2R5D A;  4M3L A;  4LGD E;  1T8Z A;  3V2N A;  2N1T D;  3AE7 C;  3VMX A;  2FYU D;  2Q1K A;  4HM0 A;  1LTA C;  1VQ9 P;  5H2F E;  4PD4 E;  1HTL C;  3AEF C;  3HD7 C;  2A06 G;  4NB9 D;  2WTY A;  1T2K D;  4PV1 C;  1NTK K;  4NBA D;  2IBZ G;  2WPR A;  3TSI A;  1N7S C;  1VL2 A;  1BGY D;  1NAY A;  5AW2 B;  1BDD A;  2E4P A;  3CCQ P;  4XE5 B;  3GF3 A;  1VQ6 P;  4GT1 A;  1FZB A;  1CW5 A;  1OVU A;  2BEQ D;  3GHG B;  1AJY A;  2WSE H;  1OWA A;  1GL2 C;  2NVG A;  3R4Y A;  1UUV A;  2BMO A;  1YQ4 C;  3QWO C;  1RQU A;  3A0H E;  3V4Q A;  2N9Y B;  3U59 A;  4AUW A;  3T97 B;  4PD4 I;  2IZ1 A;  5AVS B;  3WUT A;  1Q90 D;  1QL1 A;  2XKM A;  3E1R A;  1ZLL A;  1MV8 A;  3L4F A;  1VF5 B;  2D2C C;  4AYC A;  1AV1 A;  1FZC B;  3PTZ A;  2WSS H;  1JY3 O;  1USD A;  3CCL P;  1ZW0 A;  3L74 D;  1D7M A;  2UWJ E;  4AIV A;  2HOD A;  1SQV E;  3RK3 C;  3EFG A;  2KXP B;  1VQL P;  1RE3 A;  1KC8 Q;  1MUU A;  1SFC A;  2Y9Z A;  1IFJ A;  2W83 C;  1FDO A;  1BSN A;  4XFJ A;  2OYI A;  1O7W A;  5BOK A;  4W7Y A;  2BMQ A;  3O6Q B;  4D6T J;  2CPS A;  3L72 G;  1KTM A;  3CC4 P;  1PV3 A;  1VF5 D;  3L70 E;  2IFN A;  2XR8 A;  1SVF A;  2V7Q J;  3AED C;  2E76 C;  2E74 C;  5E79 H;  1A02 J;  3CI9 A;  4IFM A;  3GHG A;  5AVQ B;  4HM8 A;  3L73 J;  1SQB E;  1H8A A;  3N0Q A;  1NTZ E;  1UUW A;  2C0W A;  1JM0 A;  4TLF A;  4BRY A;  3RBZ A;  2K3R A;  2M5A A;  2WPV B;  3T97 A;  4PJ0 H;  1BE3 J;  2P67 A;  3TGU E;  3AEA C;  4I2L C;  3KPE A;  2A06 E;  4PD4 D;  2V7Q H;  2FY8 A;  3I5C A;  5C39 A;  2ZFC A;  1IO4 A;  2P10 A;  2AEF A;  2QJK B;  2P7J A;  1FZC A;  2IBZ E;  3OW2 O;  1FDI A;  4MN4 C;  4NBE D;  2B89 A;  3D71 A;  3RL0 C;  2ZYL A;  3FX0 A;  2FYU J;  4I7Z C;  2KLU A;  1NAF A;  2WVR A;  4JYC A;  1DX7 A;  1SQV K;  5DJT B;  4QDC A;  5CCH A;  1RY3 A;  3MUD A;  4L75 A;  2I7F A;  2PAJ A;  1BGY J;  1SQQ E;  3KZI E;  2CK3 H;  2B1X A;  4HJG H;  5GTH H;  1QL2 A;  1YHQ P;  1QEX A;  2IBZ I;  2R32 A;  5KLV G;  5HL4 A;  3AE4 C;  2BAS A;  1SQB K;  1A02 F;  2Y0E A;  1ZME C;  1NTZ K;  4UB8 H;  1JM1 A;  2QA4 P;  1UII A;  2RMZ A;  4N78 E;  2QJP C;  2ZT9 B;  1SQV D;  4EDF A;  1QX8 A;  1SS1 A;  3S9O A;  3RK3 E;  2KZJ A;  2FXO A;  2WSC H;  1HF9 A;  2QG4 A;  2XZR A;  1NTK J;  1ZV8 A;  1JCC A;  2KP8 A;  1VQ4 P;  1NO4 A;  1RH5 B;  2HMJ A;  1NTM G;  2GBX A;  3L72 E;  2PGD A;  3HD7 B;  1CI6 B;  3S1K A;  1KQL A;  1O7M A;  1PGP A;  2BCC J;  3L70 D;  1SLQ A;  2OAR A;  3BVH A;  3B71 A;  1JEK A;  2Q6Q A;  3CCJ P;  1LTB C;  1L0N E;  3I56 P;  4H13 C;  1M1K Q;  1YI2 P;  3MGN A;  2HMM A;  4NBD D;  2C0X A;  3EFF K;  1G8K B;  1K04 A;  2PFX A;  1SQQ K;  5APV A;  1S2E A;  3OJA B;  3P8C E;  2WIT A;  2CPB A;  2FFD A;  4R4M A;  3CC7 P;  2H8P D;  4WY4 A;  1OIP A;  1YTZ I;  5AEW A;  5GTI H;  1NGM B;  2A06 D;  3S4R A;  1BCC G;  3H32 B;  3HD7 D;  1JUN A;  3AE5 C;  4HM5 A;  2NPS C;  4IL6 E;  2IBZ D;  2FKW B;  3GLM A;  3VMA A;  1K8A Q;  1NWQ A;  5KJ7 A;  4HJL A;  2H88 C;  3GB4 A;  5AVR B;  4WBA A;  1KFN A;  3C1L A;  1VQ7 P;  3AE1 C;  1OMI A;  4ZKP A;  1KIL E;  3KQG A;  3H1L G;  3E7K A;  4AQR D;  2Q7C A;  4P1B H;  1M57 D;  3RK3 B;  1GW3 A;  2OTL P;  1PGO A;  1S4X A;  1J1D B;  1SQQ D;  4YTP C;  3AEB C;  1Q82 Q;  1CI6 A;  3M9B A;  3A2A A;  1FJK A;  4YXW H;  2OGU A;  3TNU B;  1FC2 C;  3D70 A;  2IYP A;  1VDF A;  3Q3D A;  2KIK A;  1MFT A;  5AVZ B;  1LJ2 A;  1GD2 E;  3K5B A;  3Q5P A;  5CCH C;  1URQ A;  2MJZ A;  1L0N K;  3Q5R A;  1FAV A;  5CXM A;  1G1J A;  2E76 B;  3CCM P;  4L73 A;  1R5S A;  4RO0 A;  3IAO A;  1YYC A;  1X22 A;  2QJY B;  2G8Y A;  4N78 D;  2M3E A;  3SFE C;  2YXQ B;  4HM1 A;  3RK3 D;  4YPC A;  2JR8 A;  2YFL A;  4NBG D;  3H25 A;  5KLI B;  2Z5I A;  3H6P A;  1HGZ A;  4Y99 C;  1LP1 B;  1NTM E;  3DQY A;  3BRT B;  2Z5H A;  3H1K G;  4RKU J;  4Z1M H;  3L72 D;  2K88 A;  4Y28 J;  1NHL A;  1KV4 A;  3VCP A;  1SQV J;  2GUV A;  1G2C B;  2E76 D;  1LTS C;  1O7P A;  2WT7 B;  5AW0 B;  5KAF H;  1TU3 F;  3EWK A;  4NBF D;  3CCR P;  3PP5 A;  4IL6 X;  1L4A C;  1L0N D;  3CCV P;  4I7Z B;  2HR3 A;  4U3F G;  1YJW P;  1ZR2 A;  5B66 E;  1JOC A;  3AZC A;  3Q5S A;  5AEU A;  5B5E E;  3HUS B;  2W6A A;  1KIL B;  3PHL A;  3P8C D;  1KB9 H;  4HKZ H;  2GM4 A;  1VQM P;  3L70 J;  1KN7 A;  5CCG D;  3JCU E;  2Y0C A;  1JY2 O;  3RK2 C;  1SQB J;  2J58 A;  3L71 G;  1PFI A;  3KYQ A;  1DEE G;  3FXD A;  2O01 J;  1NTZ J;  1T3U A;  3SSU A;  5AW9 B;  4RES B;  3MHV A;  3TGU J;  1GK4 A;  2QM7 A;  1HWT C;  3H1H G;  4OWF A;  1KIL D;  1JY3 P;  1LP1 A;  2QJP B;  3USS A;  2WSF J;  2H89 C;  1FJP A;  5CCG A;  1NTM K;  4C7R A;  3C0D A;  2QVA A;  1E5W A;  3MTU E;  2CKF A;  1LWU A;  1IFN A;  1PP9 G;  5KJ7 C;  3LW5 J;  1IK7 A;  3G3Z A;  2AXT E;  3M9H A;  3RGU A;  1KQS O;  1BSH A;  1VQ5 P;  3B8E B;  3B5N A;  5CJ0 A;  1SQQ J;  3HUS A;  1FZA A;  4WVZ A;  1OVV A;  2WSF H;  3HTK A;  4H13 B;  1EG9 A;  2N1T A;  3PJS K;  2NVF A;  2IPP A;  1LT9 C;  2OYH B;  1IFP A;  3H1J G;  3VMH D;  4B86 A;  1N73 A;  2LXB A;  3HE4 A;  2HFE D;  1AQ5 A;  4OVN F;  1KOR A;  3CWB G;  1NTM D;  1EXJ A;  3FXE A;  3H1K E;  2RKL A;  4IFD K;  1ZRT E;  2NPS B;  5CHX A;  2HMN A;  1USE A;  1U7J A;  2KYV A;  2R5B A;  1OW7 A;  5CBO A;  2YKQ A;  2E75 B;  3MIW A;  4U3F E;  2YNY A;  2YIU B;  2P1J A;  2Q3E A;  3CCE P;  3R2P A;  4H13 D;  2JDI H;  3A0B E;  2JEE A;  2B87 B;  2K37 A;  1N8R Q;  3JC2 2;  1IFD A;  1PPJ G;  4TT3 H;  1RF1 C;  2BMR A;  1UIX A;  2A45 H;  1AFO A;  1NDO A;  5AW5 B;  1YIJ P;  2C9L Y;  4EOT A;  5KAI E;  3TYY A;  3G6E P;  2QPZ A;  1QVG O;  4IOI H;  2QSI A;  2MKV A;  2NVE A;  1Q81 Q;  4O9B A;  1L0N J;  2NPS D;  1DH3 A;  4QDD A;  2Y9Y A;  1GMJ A;  3L71 E;  1J1E C;  1JO5 A;  1H88 A;  2NUM A;  2E75 D;  2W6J H;  4H44 C;  3WUV A;  3RL0 g;  1RQV A;  1PGJ A;  2JWD A;  2JZA A;  4NB8 D;  2YFJ A;  1NU1 G;  3NMD A;  1WQL A;  4CPG A;  3H1H E;  3H1L D;  3M0D A;  3NTN A;  1G8J B;  4GKG A;  4EIJ A;  1KYO E;  1GTW A;  3EN1 A;  1PP9 E;  3Q1M A;  1ZR4 A;  2W8Z A;  1LGH B;  3O8Z A;  2GA1 A;  1HGV A;  1DEB A;  4H0L C;  4UB6 H;  3GTS A;  4HB1 A;  1M1J B;  2BEZ F;  4HM7 A;  1LTJ B;  2ZJS E;  1EZV G;  1VCK A;  2KK7 A;  3OA7 A;  2B88 A;  2OQQ A;  1X8Y A;  3PLN A;  2QEX P;  3FGA D;  2IX7 C;  1L4A B;  3GOB A;  1L2P A;  3H1I G;  3EQ2 A;  1U7M A;  1GW4 A;  4NPF X;  3H1J E;  1SP4 A;  1MZ9 A;  4KHX A;  2E43 A;  5DJU B;  1KYO I;  1JB0 J;  2R44 A;  3CX5 H;  2Q3W A;  3CWB E;  2O1J A;  3O6Q A;  2FYN C;  3KDP B;  3H1K D;  4QUR A;  1BE3 G;  3B5N C;  1S5L H;  1ZRT D;  1S1C X;  2IDB A;  4RJT A;  2K9J B;  2N1T C;  1L4A D;  4U3F D;  4U7J A;  3SWK A;  4DZO A;  2WPS A;  1EDK A;  1NTM J;  1NH4 A;  1WMK A;  3G9R A;  4K35 A;  5AW6 B;  3G71 P;  1VQK P;  5AW4 B;  1JY2 N;  1AVY A;  4JYB A;  4LC1 A;  3CXH H;  3WU2 H;  2YXR B;  5CBN A;  4L74 A;  1ZOY C;  2YFI A;  2L91 A;  1YJ9 P;  1ZXG A;  1KQF B;  3RK2 D;  2HMO A;  1XTC C;  4GOF A;  3L71 D;  1T6A A;  3L74 J;  4HM3 A;  3M06 A;  2DE5 D;  3FOU A;  5M1B A;  3AEG C;  4PV1 B;  1S3J A;  2ZAE B;  1NU1 E;  1N7S B;  3H1H D;  4GDO A;  1O7N A;  3V4W A;  3EQQ A;  1FE6 A;  1RE3 C;  2N9B A;  2FXP A;  1SFC C;  1U57 A;  4C46 A;  5E79 E;  3GZY A;  1KYO D;  1FOS F;  2OYI C;  1Q90 C;  3AE8 C;  1NVO A;  1Q2N A;  2W27 A;  3GG2 A;  3HE5 B;  1PP9 D;  3L75 G;  4IFF A;  3P7K A;  4HH2 A;  5B5E H;  2KS1 B;  2JO6 A;  4JQ0 D;  1NTK G;  1OW6 A;  1GL2 B;  5AW1 B;  4PJ0 E;  5TIS E;  3TK1 A;  1EZV E;  1P84 H;  4PV1 D;  3UIA A;  3BAT A;  2HG5 D;  3GHG C;  2BCC G;  1N7S D;  4L76 A;  4NPE A;  1FDM A;  3H1I E;  2D2C B;  1WT6 A;  4N3Y B;  4OH8 B;  5EFW B;  2RN0 A;  3M91 A;  3H1J D;  5APT A;  2ZXE B;  2V4H A;  2O01 N;  2XU6 A;  3CWB D;  4QDF B;  1ZN5 A;  2LKM A;  2R3S A;  1FZC C;  1GL2 D;  1JNM A;  4GIF A;  2YMY A;  3HD7 A;  4C7N B;  4WB4 A;  2K1A A;  1L0L G;  2VRS A;  3IR9 A;  5K5G B;  1AQT A;  1OFC X;  1NU1 K;  1N7S A;  1EZV I;  1ULJ A;  5H2F H;  5AVV B;  3MUD C;  5GTH E;  1VPC A;  3C9I A;  1FZG A;  4PD4 H;  2D2C D;  5KLV E;  2JJL A;  1RFS A;  1JCD A;  2AXT H;  1FZF A;  3I55 P;  2E74 B;  1PPJ D;  4BWN A;  3VMI D;  3H1K J;  3AE6 C;  5AVT B;  2QM8 A;  4P1C H;  3HE5 A;  3E1I A;  3L35 A;  1PGQ A;  1GL2 A;  2JO1 A;  4UB8 E;  1VQP P;  3H32 A;  5BU8 B;  3Q2Y A;  4U3F J;  5KKZ C;  1EDJ A;  3AE2 C;  3G4S P;  2C9N Y;  2NUK A;  5APW A;  3GMA A;  1VQO P;  3U1A A;  3CX5 I;  4R4L A;  4H0L B;  3GL2 A;  1AVO A;  1NU1 D;  3A0H H;  2JKV A;  2E74 D;  2QRX A;  3BCC G;  1JTH B;  3RL0 B;  1RIE A;  1OZH A;  2JP3 A;  2PRR A;  1Z56 A;  1YTZ T;  4QDF A;  1HH0 A;  1FU1 A;  4ZKU A;  3VMG D;  2Q9I A;  5AVY B;  3A0B H;  3TNU A;  3L75 E;  3P32 A;  3GF7 A;  3MZW B;  1KFM A;  4A7P A;  2HPC B;  3CXH I;  1BCC E;  2FYN B;  3NFQ A;  3V6I A;  2WPQ A;  4H0L D; 
#chains in the Genus database with same CATH homology
 4HM6 A;  2I7F A;  4H13 D;  5KLI C;  1O7H A;  2GBW A;  2QJK C;  4PD4 E;  1SQQ E;  4HM1 A;  1NU1 E;  4QCK A;  1ULJ A;  2YFL A;  4NBG D;  2QJY C;  2YIU C;  3GCE A;  2BMR A;  3GOB A;  2BCC E;  4NB9 D;  1O7W A;  5BOK A;  5AEW A;  3VCA A;  5KLV E;  2D2C D;  1O7N A;  4QUP A;  2BMQ A;  1RFS A;  3EQQ A;  2B1X A;  1BE3 E;  1NDO A;  4NBA D;  2HMK A;  3C0D A;  1VF5 D;  2QPZ A;  3GTE A;  3BCC E;  1NTK E;  1NTM E;  3CX5 E;  3H1J E;  1NYK A;  3DQY A;  3L70 E;  3GZY A;  2CKF A;  2XR8 A;  4P1C H;  2E4P A;  4QUQ A;  1VM9 A;  2XSH A;  1Q90 C;  2NVE A;  3L74 E;  2Q3W A;  3CWB E;  4HM2 A;  3H1L E;  5HL4 A;  4QDD A;  3VCP A;  2FYN C;  1SQX E;  4OGQ D;  4HJL A;  3L71 E;  3GB4 A;  4QUR A;  2E76 D;  2FYU E;  4HM8 A;  2DE7 D;  2NUM A;  1O7P A;  1SQB E;  5KKZ C;  2JO6 A;  4NBF D;  1P84 E;  1JM1 A;  2E75 D;  1L0L E;  1ULI A;  2QJP C;  3N0Q A;  4NBH D;  2XRX A;  1NTZ E;  2NUK A;  1UUW A;  1EZV E;  2JZA A;  3D89 A;  2NVG A;  4NB8 D;  4PV1 D;  1UUV A;  2BMO A;  2YFJ A;  3AZC A;  2DE6 D;  5AEU A;  1KB9 E;  1WQL A;  3H1H E;  4P1B H;  3GL2 A;  4NBB D;  3TGU E;  1EG9 A;  4AAY B;  2A06 E;  2NVF A;  1G8J B;  3CXH E;  3H1I E;  1BGY E;  2E74 D;  2HMJ A;  2ZT9 D;  1KYO E;  3VMH D;  4HM4 A;  1RIE A;  2GBX A;  3L72 E;  3EN1 A;  2IBZ E;  4D6T E;  4HM5 A;  4NBE D;  1O7M A;  1PP9 E;  2ZYL A;  4QDF A;  3VMG D;  3H1K E;  3GL0 A;  3GKE A;  2YVJ B;  4H44 D;  1ZRT E;  2HMN A;  2YFI A;  2HML A;  1FQT A;  4QDF B;  2NWF A;  4AIV A;  3L75 E;  1PPJ E;  1L0N E;  4QDC A;  5CXM A;  4EMJ B;  2HMO A;  3GZX A;  3GTS A;  1SQV E;  3VMI D;  2HMM A;  4NBD D;  1SJG A;  2E4Q A;  4HM7 A;  1VCK A;  4NBC D;  1G8K B;  4HM0 A;  1BCC E;  2B24 A;  2XSO A;  4HM3 A;  3L73 E;  1SQP E;  1O7G A;  4U3F E;  2DE5 D;  4H0L D;  4HKV A;  3FOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...