3H1IE

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 45
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1iE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1iE02
1PP9E 2HMNA 4OGQD 3VMID 2Q3WA 1VM9A 2HMJA 3L74E 2E4QA 2QJYC 2YIUC 1NU1E 4P1BH 2NVEA 1L0LE 1PPJE 4H44D 4HM6A 4QDFB 1BGYE 3GCEA 4EMJB 4NBBD 1WQLA 2QJPC 1FQTA 1KB9E 2NWFA 4HM7A 2DE7D 4H0LD 3H1HE 2BCCE 2QJKC 2HMMA 2YFIA 1G8KB 4NBED 5BOKA 1SQPE 4AAYB 2DE5D 4QDCA 3DQYA 3GTSA 4H13D 5HL4A 3EN1A 1NDOA 3CX5E 1BCCE 2BMQA 4HJLA 5AEUA 2XSHA 3L70E 1SJGA 4NB8D 3D89A 3H1IE 1JM1A 5KLVE 4HM1A 4HM4A 2CKFA 3VCAA 3GKEA 3GOBA 5KKZC 3L73E 3H1KE 4PD4E 2I7FA 3FOUA 3CXHE 2B1XA 4QCKA 2B24A 3GB4A 1L0NE 3H1JE 1ULJA 4PV1D 4HKVA 2HMOA 2E75D 4HM5A 5AEWA 4D6TE 2FYUE 4U3FE 2E4PA 2A06E 4NBAD 4NBGD 1O7WA 1ZRTE 2HMLA 2YVJB 1UUWA 2BMOA 1Q90C 3EQQA 3VMHD 1SQBE 1P84E 1O7GA 3L72E 1KYOE 2YFLA 2XR8A 1G8JB 2D2CD 4QDFA 2HMKA 1EG9A 1ULIA 1O7PA 2BMRA 2E74D 1SQQE 3GZYA 1SQVE 2FYNC 2XRXA 2DE6D 4NBFD 1SQXE 4NBCD 1BE3E 2IBZE 2GBWA 1VF5D 3H1LE 3AZCA 2JO6A 3GZXA 2GBXA 2NUMA 3L71E 1RFSA 2QPZA 3VCPA 5CXMA 1O7MA 1O7NA 2NVGA 2ZYLA 1NTKE 4QDDA 3CWBE 1VCKA 3VMGD 4HM8A 4NBDD 3GTEA 1EZVE 3TGUE 2XSOA 4QUPA 4HM3A 2NVFA 1UUVA 2JZAA 4AIVA 3L75E 1NTME 4NBHD 4NB9D 5KLIC 3N0QA 4HM2A 1NYKA 3BCCE 1NTZE 3GL0A 4QURA 4HM0A 3GL2A 4QUQA 2NUKA 1O7HA 2YFJA 4P1CH 2ZT9D 3C0DA 1RIEA 2E76D
chains in the Genus database with same CATH superfamily
2Q3IA 1RQUA 1VM9A 1OZHA 1SQVD 1XTCC 1L4AA 1SQXG 3PLNA 4Y99C 1WMKA 1SQPK 3U1CA 2QJKC 1H88A 2YFIA 2HPCA 1LTTC 4DT0A 3CWBJ 3L70E 1KZUB 3OJAB 3WMM0 2CPSA 1N8RQ 2QJYB 1FOSE 3AEEC 5TISE 1Q7YQ 1AFOA 2QVAA 1BDDA 1VDFA 1OFCX 1BDCA 2D2CB 1RF1B 1OW6A 3PJSK 1KILD 1O7PA 1L0ND 3CCSP 3MUDA 4B86A 5KAIH 3I5CA 1J2JB 1KQGB 1KFMA 2FYUK 3AEBC 1GL2D 1FJKA 1VQ8P 4N78E 2I1KA 2IBZG 3H1JD 3RL0g 2YXRB 2YXQB 4I2LC 4HM2A 3LIEA 2WPSA 2W6BA 2IYPA 4NPDA 1NAFA 2FXPA 2AXTE 3VMZA 1U57A 5AVQB 1VQNP 3WUVA 1EDKA 5AW1B 2E4QA 2WSEJ 3P7KA 1SQVG 1IFDA 3UIAA 5CHXA 3RL0C 4CPGA 4EMJB 3FXDA 4IL6H 3BVHA 1UIIA 1S3JA 4H13B 3EN1A 4JYCA 4DOJA 5M1BA 5AEUA 1NGMB 2OGUA 2WPRA 4W7ZA 1W5CE 2J59M 1H89A 4KHXA 3AEDC 4PD4E 3MHVA 1S5LX 3QH9A 2IZ0A 1ZN5A 1BCCJ 1N7SC 4D6TE 2FYUE 3HUSC 1LT9A 3GLMA 4GOEA 2JDIH 1YYCA 3L73D 1MV8A 3IF4A 1EC5A 2K88A 4UB6E 4NBCD 4BWNA 1G1JA 1FZAA 1P84I 1ZRTD 2ZT9C 4ASVA 4OGQC 3U1AA 1IFJA 1SQQD 5AW4B 1IO4A 3B4SA 4QUPA 2OYIC 3H1JG 4L75A 4Y28J 1BSNA 2QE7H 3PHLA 3GF7A 1USDA 1AV1A 3CC7P 3L36A 1DD3A 5AVXB 1P84D 3TSIA 2N9BA 1P84H 2H88C 3VMID 3L74E 5KJ7D 1IC2A 1L0LE 3H25A 4H44D 3ITKA 4ASWA 1Z56A 2JJLA 2IFMA 4WY4C 1ZMEC 3L71D 2K9JA 4U7JA 2RMZA 3CC4P 1G2CA 1JY3P 3HD7C 1BCCE 2G3AA 4W80A 1URQB 1SJGA 2OTJP 2FYZA 4HM4A 3A0HE 3V2PA 3AE2C 2BEQD 3USSA 3B5NC 3LW5J 2YMYA 3G71P 4R4LA 4L76A 2KK7A 5CMZA 2A06E 2K9JB 1LTBC 2HMLA 1JCDA 3HUSA 3VMHD 2JKVA 4C7NA 1O7GA 1PGQA 2XR8A 1VF5C 1SQXE 3H1HD 2YIUB 1IFNA 1SQPD 1NH4A 2JR8A 1HJ0A 2PGDA 3TYYA 1JOCA 5KLVJ 1FBMA 1N7SB 4PD4I 3QWOC 1KQFB 3O6QA 1D7MA 2H8PD 1UIXA 4HYTB 4EI2A 4H0LC 1SQVK 2E5YA 3H1LD 2OYIA 4RJTA 1SFCC 4MN4C 4WVZA 2ZT9B 1EZVD 3CPWO 4OGQB 1L2PA 5APVA 2HMNA 3EQ2A 2WTYA 3O6QB 4PD4H 4EDFA 1BE3G 5L8RJ 1FQTA 2NPSD 1JEKA 3L71G 4OVNF 1XTGB 4WY4A 3RK3D 2HMMA 3E1IA 1PGOA 4RKUJ 1FZCC 3O8ZA 4HJLA 3HD7A 2KB7P 5C39A 3VMXA 3KHUA 3CLQA 1M57D 1M8OB 2I7FA 3CCUP 3B5NA 1L0NK 1RH5B 4YPCA 4HM5A 3CL3D 4WY4B 4YXWH 3VP8A 3AE3C 1VQPP 1CZQA 3AEAC 1NU1D 4WWIA 3GHGA 1JY3O 2PFXA 3IN6A 1SQVE 1M56D 2FYNC 1K9MQ 3H1HG 1KORA 3B5NB 1S4XA 3CCEP 2XZRA 1VQ9P 1SQPG 2WT7A 2R3CA 1EDIA 3VCPA 1SQBD 5CXMA 3HE5A 1LP1B 2M5AB 2HFED 3L72D 4I1LA 3EFGA 3H1KJ 1KMIZ 3V2NA 1LNQA 3A3YB 1A02J 1IK7A 2HODA 3PTZA 4NBHD 1VF5B 1VQ5P 1LTSC 3AE8C 1JMMA 5AW3B 2WPVB 5AVSB 4JF7A 1EZVG 1URQD 1KYOD 1KILA 3A0HH 2HMJA 3MP7B 2ZAEB 2QM8A 2POHA 2M0BA 2AEMA 3BCCD 1KILE 2OYHB 3MD0A 4NBBD 4H0LB 1TU3F 2HODB 1CW5A 4HM7A 5KAIE 1W2BO 4XE5B 5BU8B 3N4XA 3DQYA 1YHQP 1SFCB 4OWFA 5AVTB 2B87B 1FZCA 1PIXA 3TF5A 3GF3A 1RE3C 1OXZA 5E79E 1L4AC 2W27A 1J1EB 4IFDK 1NTZD 3CX5I 3WU2H 3H1JE 4L73A 1R5LA 5AEWA 1JNMA 2H89C 1VQ6P 2MJZA 2BMOA 1QLED 1FZCB 1NU1G 2C0XA 1K05A 2YFLA 3KPEA 1SQQK 1EDJA 4QDFA 1BGYD 1N2DC 3G4SP 1Q86Q 4IL6E 2K3RA 3HE4A 2GBWA 2JP3A 3CX5D 1VPCA 3H32A 3L70J 1NO4A 2C0WA 3CX5H 3H1ID 3L72G 2P67A 3CMAP 2YNYA 2IBZI 2NVFA 4L74A 1VL2A 2P58A 4DCKA 3TNUA 2G8YA 1S9KD 2FYNB 4Z1MH 2AEFA 1LTJB 4IFFA 2WSCH 2NUKA 2YFJA 1OX3A 5CCHC 1FU1A 3G9RA 4IOIH 4PV1C 2NVEA 1PPJE 1EXIA 3GCEA 2B9BA 3BCCG 3R2PA 3TNUB 3CCQP 4ZKUA 2Q1KA 4AAYB 1NTKD 5CCGC 5KTBA 1FDMA 2E76B 1JUNA 3VN0A 1RE3A 1NTMD 2M3EA 1LTIC 3HTKA 3G3ZA 2GUVA 2KZIA 1NTZG 1NYHA 3AE4C 3FGAD 3C9IA 5APQA 1H0TB 1O7WA 5AVUB 5KLVD 1Q90C 5APSA 1PP9G 1T2KD 1P84E 2O1KA 1BGYG 1T3JA 1RE4C 2BCCD 1L4AB 2KNCA 1BE3E 1VF5D 3SFDC 3AZCA 3L71E 1LT9C 2HPCB 2H7HA 3RBXA 3H1IG 2N1TD 3IFMA 4WB4A 1MFTA 3H6PA 4GDOA 1SVFA 4NB9D 2KNCB 4D6TJ 2FYUJ 2V7QH 2XU6A 1OVVA 2QA4P 1YTZT 2K9YA 2L91A 1QL1A 2W8ZA 5CCHA 3B71A 5E79H 2QG4A 1FZFA 2E75C 1Y47A 2Q7CA 4QMAA 4YTPC 1R5SA 2QM7A 3H1HE 2L5GB 1PGPA 3RK2C 4ZNCA 3CCJP 3VOPA 1LTAC 2OTLP 1SQPE 2IYOA 4WBAA 1NTKG 1VQOP 1ZR4A 5CCGA 1EQ7A 1X79B 2E74C 1JM1A 1MUUA 1NKNA 1NU1K 3FOUA 3L75D 4QCKA 2ZXEB 1NTMG 4PV1B 1ULJA 1NKZB 4BRYA 3AE6C 2PAJA 1NVOA 3SWKA 1SQBK 3FWNA 2Q6QA 2XNDH 3L74J 1L0LJ 2SPZA 1VQKP 1FDIA 2A45G 2NPSA 2BCCG 1RE4A 3M06A 2C9LY 4Y99B 2QJKB 1O7MA 1O7NA 4C7RA 4ZKPA 1FE6A 3CCMP 3T97A 3U59A 1UUVA 1L0NG 4AIVA 4I7ZC 1FDOA 2WZ7A 1ZLLA 4EIJA 4JBZA 4JYBA 1IFMA 5BU5A 1LT9B 2GA1A 4N3YB 1FZGA 2E76D 2HG5D 1NU1E 1SQXJ 4W7YA 3P8CD 3JCUH 1NTZK 2KIKA 4QDCA 1PP9J 1J1DC 2KLUA 1KQLA 4HB1A 2XSHA 3TGUD 4RESB 1M90Q 3SWYA 1KB9I 3CD6P 3L75G 1L4AD 2E75B 2HMOA 3KYQA 2KP8A 2KSEA 2Y0EA 4GODA 4EYYQ 1KYOE 1FS0E 2FXMA 2E74B 4OH8B 2D2CD 1KQSO 1EG9A 1KB9D 1KB9H 1GU4A 2WSCJ 3RL0B 3M0DC 2JO6A 2P1JA 1PV3A 2Y9YA 1KN7A 4XFJA 1JMBA 1G2CB 3F89A 1E79H 2WSFJ 1GTWA 4JPZB 3L73G 1X22A 2WMMA 5AW6B 3GHGC 3NTNA 3S1KA 2KS1A 3WU2E 1AQTA 4U3FD 2M8RA 2J58A 1NTZE 4QURA 1EZVI 3P32A 1O7HA 2M3BA 1OW7A 1NTKK 3BRVB 3VMAA 2VRSA 1X8YA 2R3SA 4GT1A 3HUSB 1PP9E 1SQQG 1SQVJ 4C7NB 1GDTA 2O1JA 1OWAA 1N86A 1BGYE 1PFIA 1NTMK 2Z5HA 2IX7C 4AQRD 1ZP0C 1HTLC 4I7ZB 3AEFC 4IFMA 4H13D 3CWBD 3CX5E 5KLVK 2FY8A 3TGUG 1KILC 3D89A 3V2RA 2LKMA 3H1IE 3VP9A 3CCVP 2ZYDA 1HGZA 1ZW0A 4R4MA 1T8ZA 1JTHA 1M1JC 3W67A 1GL2C 1JCCA 1VQ4P 2W83C 2OYIB 4IL6X 1S9KE 2YKQA 2XNXA 3EQQA 4LC1A 1J1DB 4JQ0D 5APTA 1HJBA 1GW4A 1USEA 4TT3H 1G8JB 1L0NJ 1JTHB 1NJIQ 2IBZE 2GBXA 3M0DA 4N6JA 1KD1Q 1VQMP 3D6ZA 1NTKE 2Q5UA 1VCKA 4I6MC 4HM8A 2R5BA 2IZ1A 3HD7B 3H1JJ 1NTME 4U3FG 2JEEA 2I1JA 3GL2A 1KYOI 1OIPA 1QVGO 3C0DA 2Y9ZA 1RIEA 1JO5A 3VTPC 1DEBA 3IR9A 2WSEH 1JB0J 1LWUC 3GHGB 3H1LG 2NWFA 2W6JH 2BCCE 1FZEA 2WT7B 3CWBG 3HE5B 3BRTB 1YJ9P 1KYOH 1K8AQ 1WRGA 2B24A 3GB4A 1M1JA 1L0NE 5B5EH 1GL2A 3RL0D 3TK1A 1BCCD 1SLQA 1YJWP 2AEJA 3KZIH 5AW7B 1LJ2A 1OVRA 3PRJA 3WUUA 5APYA 1YITP 1KILB 4UB8H 3RBZA 2JO1A 2KUBA 5APXA 4NBFD 2GUSA 2ZVNB 3LIDA 5EFWB 3A7OA 1M1JB 1ZXGA 1YBKA 3GZXA 3BATA 2CK3H 1Y9BA 1OW8A 1SS1A 4HKZH 1KC8Q 1N7SD 4H44C 2K37A 2IPPA 1Q2NA 3I55P 1SQXD 3AE9C 3Q5RA 1RQVA 4DZOA 2JZAA 3L75E 1WT6A 1U7JA 1N73C 2KXPB 2ZYGA 2N9YB 5GTHH 4HM0A 1HGVA 1PGJA 1VQLP 1FC2C 4A7PA 1SQBG 1RF1C 2ZT9D 1ZR2A 4OGQD 1HH0A 3Q5PA 5B66H 1YQ3C 1BE3J 2CPBA 1S5LH 4HM6A 4QDFB 2NRGA 3A5TA 4NPFX 2OQQA 1LWUA 2XKMA 4PJ0H 3L71J 3S9OA 3HE4B 3W68A 3BASA 5HL4A 1PZQA 1W2EA 3H32B 1JM0A 3JC22 3E7KA 4NB8D 2FFDA 1Y8AA 1G1IA 1QGKB 3GKEA 1HWTC 2JWAA 3L73E 5CJ0A 2BASA 1DEEG 1AVYA 1MZ9A 2ZVOB 3HRNA 3SWFA 3FX0A 1BCCG 4HH2A 4WY4D 1ZRTE 1UUWA 3MIWA 3A0BE 1K73Q 2KSJA 2WITA 2A45I 1M7LA 3HD7D 2HMKA 2WVRA 1SQQE 5AW5B 1QX8A 3H1HJ 3P8CE 1SQPJ 4AUWA 3B5ND 3JCUE 3OA7A 2ZYLA 5KJ7A 1R8EA 3TGUE 2XSOA 2NPSC 5AVYB 3RK3C 1GK6A 2OYOA 3H1LJ 1X9VA 2A45H 1MKMA 1JY3N 3HTKB 1N73A 2QSIA 1EDLA 4O9BA 3SSUA 5AW8B 1NAYA 1RF1A 1S72P 4H44B 2QEXP 2B89A 1ZV8A 1KB9E 1JY2N 3M9BA 1QEXA 4H0LD 1N73B 1G8KB 4NBED 2IDBA 4BXLA 2DE5D 2PP6A 2E5TA 2YMKA 3GG2A 2BMQA 1SFCD 1YTZI 2QIWA 5GTIH 3V4WA 5KKZC 3PP5A 2B1XA 1HUCA 3G6EP 4HKVA 1QL2A 2DW3A 1DH3A 4U3FE 1AA0A 1IFIA 4NBGD 1KTMA 3CXHI 2B88A 3NMDA 1Q81Q 1NU1J 3GMAA 1YQ4C 1H8AA 3A2AA 2XRXA 2NZ2A 1RF0A 3AE7C 1N7LA 3M91A 4EOTA 3H1LE 1URQC 3M9HA 1SQBJ 3L72J 5KLVG 4QDDA 3CWBE 1QVFO 1GU5A 3OAKA 1AJYA 3GTEA 1EZVE 4M3LA 3H1KD 5DJTB 3CXHD 5H2FH 2K1AA 3CXHH 2Q3EA 2ZYAA 5K5GB 1NYKA 1GW3A 3GL0A 3TDKA 4BRYB 3RK3E 1GK4A 5AVWB 2O01H 1L0LK 2YIUC 3D71A 2YKPA 3CI9A 3BCCJ 2NPSB 2QJPC 2Y0DA 3RK3B 5AW9B 5CBNA 5AVVB 3GTSA 4KJMA 3KDPB 1NOHA 3A0BH 3JSVC 1PPJD 5KAFH 3T97B 2IFNA 1NTZJ 1YJNP 4NBAD 4NPEA 1OMIA 1A02F 3CMEP 4GIFA 1GD2E 2YVJB 3MTUE 3NFQA 1SQBE 3KQGA 3L72E 1BGYJ 2FXOA 2KI7B 1SQXK 5KKZB 2O01N 3S4RA 2QPZA 1AVOA 1URQA 3L70D 2ZXXA 3RK2B 3H1IJ 3Q5SA 2HYNA 3Q1MA 3H1KG 1VQ7P 4HM3A 3K5BA 1BE3D 1PL5A 2Z5IA 2HLOA 5KLIC 1FAVA 3F5HA 3BCCE 5B5EE 2OTKE 5TISH 3WUTA 1LGHB 3IAOA 3KZIE 2WPQA 1GZLA 2KYVA 1Q82Q 3E1RA 2J5UA 5AVRB 2KZJA 4UB8E 2YO3A 3P8MC 1WQLA 1AQ5A 2DE7D 3CCRP 2AXCA 1T2KC 4XA4A 1N7SA 1NTKJ 1JY2P 4GKGA 3C8VA 5CJ4A 1BSHA 3L4FA 3B8EB 1HF9A 4N78D 1PPJG 4DJGA 5CCHD 1NTMJ 2I8DA 1T3UA 4PV1D 2KS1B 3Q2YA 1IJDB 5GTHE 2QJPB 2Y0CA 4K35A 1HVVA 2N1TC 2ITAA 2AXTH 2P7JA 1FOSF 5CCGD 2OYHC 1U7MA 5B66E 2ZJSE 5AW2B 1ULIA 2BMRA 3GZYA 1DD4A 1S5LE 2BCCJ 3M0AA 3Q3DA 4PJ0E 2WWWA 1RFSA 3V2QA 3L70G 3AEGC 1LT1A 2RH0A 2YO2A 3VMGD 2BEZF 2WSSH 3N7NA 3FXEA 1J1EC 4PD4D 1M1KQ 1Q90D 5AW0B 3EFFK 2V7QJ 3MGNA 4D6TD 2FYUD 2R44A 1RY3A 5BVZA 2V4HA 3AE1C 2XDJA 4UB6H 3FWLA 1LTGC 3VYIA 1T6AA 2P2UA 2JWDA 5BOKA 5KLIB 1LP1A 2M5AA 4TLFA 5DJUB 3RGUA 2HR3A 5TJHA 2KOGA 2ZFCA 3L37A 1S1CX 1DX7A 5KLVE 4HM1A 1X0TA 2CKFA 1MFZA 3L75J 1ZOYC 1FJPA 1LTJC 1FZBA 2OARA 3EWKA 1IZNB 2E75D 2UWJE 2O3JA 2E4PA 1HBWA 3KXDA 4ZMDA 2N1TA 3RK2D 3L74D 2FFDC 2QRXA 1L0LD 3ZDMA 3V4QA 1JY2O 2E74D 2OYHA 2RKLA 4YXDC 4GOFA 2DE6D 3VMYA 4LLHA 3D70A 1SFCA 2NUMA 2E76C 2YKOA 2B87A 2O01J 2NVGA 1OVUA 2N1TB 4NBDD 3L73J 5GTIE 3NXSA 2W90A 2R32A 1EXJA 2FBWC 1KV4A 2FKWB 2R5DA 1IK9A 3V6IA 4D6TG 2FYUG 2A06D 1KFNA 2E42A 3MZWB 4RO0A 4QUQA 1GL2B 1RHZB 3M9QA 4P1CH 4C46A 1IFPA 5KJ7C 2MKVA 3AE5C 2Q3WA 1SQQJ 2QJYC 4HJGH 4P1BH 2E43A 3II6A 2XV5A 3R4YA 3ABVC 1CI6A 1SP4A 4K3AA 1NDOA 3L35A 2GM4A 1PP9D 2H43A 3TGUJ 2D2CC 3GW6A 4KT0J 3VCAA 3GOBA 3H1KE 3PH0A 5H2FE 3CXHE 1E5WA 5APUA 1LTJA 2RN0A 1CI6B 2LXCB 1CSBA 3SFEC 5AVZB 3C1LA 2PRRA 3L74G 1L0LG 1DIPA 2LXBA 3MUDC 4AYCA 3LW5H 2Z4EA 3I56P 1LWUB 2W6AA 3CCLP 1GMJA 2C9NY 3D6YA 1S2EA 2WQYC 2P10A 3AECC 4LGDE 2WSFH 5APWA 2Q9IA 3OW2O 1NHLA 5KAFE 2FFDB 2IBZD 1NWQA 1YI2P 1RF0C 5CBOA 1H0TA 2KLVA 4H13C 1K04A 1YIJP 4U3FJ 3N0QA 2A06G 3CC2P 3V5BA 2LR2A
chains in the Genus database with same CATH topology
1PP9E 2HMNA 4OGQD 3VMID 2Q3WA 1VM9A 2HMJA 3L74E 2E4QA 2QJYC 2YIUC 1NU1E 4P1BH 2NVEA 1L0LE 1PPJE 4H44D 4HM6A 4QDFB 1BGYE 3GCEA 4EMJB 4NBBD 1WQLA 2QJPC 1FQTA 1KB9E 2NWFA 4HM7A 2DE7D 4H0LD 3H1HE 2BCCE 2QJKC 2HMMA 2YFIA 1G8KB 4NBED 5BOKA 1SQPE 4AAYB 2DE5D 4QDCA 3DQYA 3GTSA 4H13D 5HL4A 3EN1A 1NDOA 3CX5E 1BCCE 2BMQA 4HJLA 5AEUA 2XSHA 3L70E 1SJGA 4NB8D 3D89A 3H1IE 1JM1A 5KLVE 4HM1A 4HM4A 2CKFA 3VCAA 3GKEA 3GOBA 5KKZC 3L73E 3H1KE 4PD4E 2I7FA 3FOUA 3CXHE 2B1XA 4QCKA 2B24A 3GB4A 1L0NE 3H1JE 1ULJA 4PV1D 4HKVA 2HMOA 2E75D 4HM5A 5AEWA 4D6TE 2FYUE 4U3FE 2E4PA 2A06E 4NBAD 4NBGD 1O7WA 1ZRTE 2HMLA 2YVJB 1UUWA 2BMOA 1Q90C 3EQQA 3VMHD 1SQBE 1P84E 1O7GA 3L72E 1KYOE 2YFLA 2XR8A 1G8JB 2D2CD 4QDFA 2HMKA 1EG9A 1ULIA 1O7PA 2BMRA 2E74D 1SQQE 3GZYA 1SQVE 2FYNC 2XRXA 2DE6D 4NBFD 1SQXE 4NBCD 1BE3E 2IBZE 2GBWA 1VF5D 3H1LE 3AZCA 2JO6A 3GZXA 2GBXA 2NUMA 3L71E 1RFSA 2QPZA 3VCPA 5CXMA 1O7MA 1O7NA 2NVGA 2ZYLA 1NTKE 4QDDA 3CWBE 1VCKA 3VMGD 4HM8A 4NBDD 3GTEA 1EZVE 3TGUE 2XSOA 4QUPA 4HM3A 2NVFA 1UUVA 2JZAA 4AIVA 3L75E 1NTME 4NBHD 4NB9D 5KLIC 3N0QA 4HM2A 1NYKA 3BCCE 1NTZE 3GL0A 4QURA 4HM0A 3GL2A 4QUQA 2NUKA 1O7HA 2YFJA 4P1CH 2ZT9D 3C0DA 1RIEA 2E76D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 E;  2HMN A;  4OGQ D;  3VMI D;  2Q3W A;  1VM9 A;  2HMJ A;  3L74 E;  2E4Q A;  2QJY C;  2YIU C;  1NU1 E;  4P1B H;  2NVE A;  1L0L E;  1PPJ E;  4H44 D;  4HM6 A;  4QDF B;  1BGY E;  3GCE A;  4EMJ B;  4NBB D;  1WQL A;  2QJP C;  1FQT A;  1KB9 E;  2NWF A;  4HM7 A;  2DE7 D;  4H0L D;  3H1H E;  2BCC E;  2QJK C;  2HMM A;  2YFI A;  1G8K B;  4NBE D;  5BOK A;  1SQP E;  4AAY B;  2DE5 D;  4QDC A;  3DQY A;  3GTS A;  4H13 D;  5HL4 A;  3EN1 A;  1NDO A;  3CX5 E;  1BCC E;  2BMQ A;  4HJL A;  5AEU A;  2XSH A;  3L70 E;  1SJG A;  4NB8 D;  3D89 A;  3H1I E;  1JM1 A;  5KLV E;  4HM1 A;  4HM4 A;  2CKF A;  3VCA A;  3GKE A;  3GOB A;  5KKZ C;  3L73 E;  3H1K E;  4PD4 E;  2I7F A;  3FOU A;  3CXH E;  2B1X A;  4QCK A;  2B24 A;  3GB4 A;  1L0N E;  3H1J E;  1ULJ A;  4PV1 D;  4HKV A;  2HMO A;  2E75 D;  4HM5 A;  5AEW A;  4D6T E;  2FYU E;  4U3F E;  2E4P A;  2A06 E;  4NBA D;  4NBG D;  1O7W A;  1ZRT E;  2HML A;  2YVJ B;  1UUW A;  2BMO A;  1Q90 C;  3EQQ A;  3VMH D;  1SQB E;  1P84 E;  1O7G A;  3L72 E;  1KYO E;  2YFL A;  2XR8 A;  1G8J B;  2D2C D;  4QDF A;  2HMK A;  1EG9 A;  1ULI A;  1O7P A;  2BMR A;  2E74 D;  1SQQ E;  3GZY A;  1SQV E;  2FYN C;  2XRX A;  2DE6 D;  4NBF D;  1SQX E;  4NBC D;  1BE3 E;  2IBZ E;  2GBW A;  1VF5 D;  3H1L E;  3AZC A;  2JO6 A;  3GZX A;  2GBX A;  2NUM A;  3L71 E;  1RFS A;  2QPZ A;  3VCP A;  5CXM A;  1O7M A;  1O7N A;  2NVG A;  2ZYL A;  1NTK E;  4QDD A;  3CWB E;  1VCK A;  3VMG D;  4HM8 A;  4NBD D;  3GTE A;  1EZV E;  3TGU E;  2XSO A;  4QUP A;  4HM3 A;  2NVF A;  1UUV A;  2JZA A;  4AIV A;  3L75 E;  1NTM E;  4NBH D;  4NB9 D;  5KLI C;  3N0Q A;  4HM2 A;  1NYK A;  3BCC E;  1NTZ E;  3GL0 A;  4QUR A;  4HM0 A;  3GL2 A;  4QUQ A;  2NUK A;  1O7H A;  2YFJ A;  4P1C H;  2ZT9 D;  3C0D A;  1RIE A;  2E76 D; 
#chains in the Genus database with same CATH topology
 2Q3I A;  1RQU A;  1VM9 A;  1OZH A;  1SQV D;  1XTC C;  1L4A A;  1SQX G;  3PLN A;  4Y99 C;  1WMK A;  1SQP K;  3U1C A;  2QJK C;  1H88 A;  2YFI A;  2HPC A;  1LTT C;  4DT0 A;  3CWB J;  3L70 E;  1KZU B;  3OJA B;  3WMM 0;  2CPS A;  1N8R Q;  2QJY B;  1FOS E;  3AEE C;  5TIS E;  1Q7Y Q;  1AFO A;  2QVA A;  1BDD A;  1VDF A;  1OFC X;  1BDC A;  2D2C B;  1RF1 B;  1OW6 A;  3PJS K;  1KIL D;  1O7P A;  1L0N D;  3CCS P;  3MUD A;  4B86 A;  5KAI H;  3I5C A;  1J2J B;  1KQG B;  1KFM A;  2FYU K;  3AEB C;  1GL2 D;  1FJK A;  1VQ8 P;  4N78 E;  2I1K A;  2IBZ G;  3H1J D;  3RL0 g;  2YXR B;  2YXQ B;  4I2L C;  4HM2 A;  3LIE A;  2WPS A;  2W6B A;  2IYP A;  4NPD A;  1NAF A;  2FXP A;  2AXT E;  3VMZ A;  1U57 A;  5AVQ B;  1VQN P;  3WUV A;  1EDK A;  5AW1 B;  2E4Q A;  2WSE J;  3P7K A;  1SQV G;  1IFD A;  3UIA A;  5CHX A;  3RL0 C;  4CPG A;  4EMJ B;  3FXD A;  4IL6 H;  3BVH A;  1UII A;  1S3J A;  4H13 B;  3EN1 A;  4JYC A;  4DOJ A;  5M1B A;  5AEU A;  1NGM B;  2OGU A;  2WPR A;  4W7Z A;  1W5C E;  2J59 M;  1H89 A;  4KHX A;  3AED C;  4PD4 E;  3MHV A;  1S5L X;  3QH9 A;  2IZ0 A;  1ZN5 A;  1BCC J;  1N7S C;  4D6T E;  2FYU E;  3HUS C;  1LT9 A;  3GLM A;  4GOE A;  2JDI H;  1YYC A;  3L73 D;  1MV8 A;  3IF4 A;  1EC5 A;  2K88 A;  4UB6 E;  4NBC D;  4BWN A;  1G1J A;  1FZA A;  1P84 I;  1ZRT D;  2ZT9 C;  4ASV A;  4OGQ C;  3U1A A;  1IFJ A;  1SQQ D;  5AW4 B;  1IO4 A;  3B4S A;  4QUP A;  2OYI C;  3H1J G;  4L75 A;  4Y28 J;  1BSN A;  2QE7 H;  3PHL A;  3GF7 A;  1USD A;  1AV1 A;  3CC7 P;  3L36 A;  1DD3 A;  5AVX B;  1P84 D;  3TSI A;  2N9B A;  1P84 H;  2H88 C;  3VMI D;  3L74 E;  5KJ7 D;  1IC2 A;  1L0L E;  3H25 A;  4H44 D;  3ITK A;  4ASW A;  1Z56 A;  2JJL A;  2IFM A;  4WY4 C;  1ZME C;  3L71 D;  2K9J A;  4U7J A;  2RMZ A;  3CC4 P;  1G2C A;  1JY3 P;  3HD7 C;  1BCC E;  2G3A A;  4W80 A;  1URQ B;  1SJG A;  2OTJ P;  2FYZ A;  4HM4 A;  3A0H E;  3V2P A;  3AE2 C;  2BEQ D;  3USS A;  3B5N C;  3LW5 J;  2YMY A;  3G71 P;  4R4L A;  4L76 A;  2KK7 A;  5CMZ A;  2A06 E;  2K9J B;  1LTB C;  2HML A;  1JCD A;  3HUS A;  3VMH D;  2JKV A;  4C7N A;  1O7G A;  1PGQ A;  2XR8 A;  1VF5 C;  1SQX E;  3H1H D;  2YIU B;  1IFN A;  1SQP D;  1NH4 A;  2JR8 A;  1HJ0 A;  2PGD A;  3TYY A;  1JOC A;  5KLV J;  1FBM A;  1N7S B;  4PD4 I;  3QWO C;  1KQF B;  3O6Q A;  1D7M A;  2H8P D;  1UIX A;  4HYT B;  4EI2 A;  4H0L C;  1SQV K;  2E5Y A;  3H1L D;  2OYI A;  4RJT A;  1SFC C;  4MN4 C;  4WVZ A;  2ZT9 B;  1EZV D;  3CPW O;  4OGQ B;  1L2P A;  5APV A;  2HMN A;  3EQ2 A;  2WTY A;  3O6Q B;  4PD4 H;  4EDF A;  1BE3 G;  5L8R J;  1FQT A;  2NPS D;  1JEK A;  3L71 G;  4OVN F;  1XTG B;  4WY4 A;  3RK3 D;  2HMM A;  3E1I A;  1PGO A;  4RKU J;  1FZC C;  3O8Z A;  4HJL A;  3HD7 A;  2KB7 P;  5C39 A;  3VMX A;  3KHU A;  3CLQ A;  1M57 D;  1M8O B;  2I7F A;  3CCU P;  3B5N A;  1L0N K;  1RH5 B;  4YPC A;  4HM5 A;  3CL3 D;  4WY4 B;  4YXW H;  3VP8 A;  3AE3 C;  1VQP P;  1CZQ A;  3AEA C;  1NU1 D;  4WWI A;  3GHG A;  1JY3 O;  2PFX A;  3IN6 A;  1SQV E;  1M56 D;  2FYN C;  1K9M Q;  3H1H G;  1KOR A;  3B5N B;  1S4X A;  3CCE P;  2XZR A;  1VQ9 P;  1SQP G;  2WT7 A;  2R3C A;  1EDI A;  3VCP A;  1SQB D;  5CXM A;  3HE5 A;  1LP1 B;  2M5A B;  2HFE D;  3L72 D;  4I1L A;  3EFG A;  3H1K J;  1KMI Z;  3V2N A;  1LNQ A;  3A3Y B;  1A02 J;  1IK7 A;  2HOD A;  3PTZ A;  4NBH D;  1VF5 B;  1VQ5 P;  1LTS C;  3AE8 C;  1JMM A;  5AW3 B;  2WPV B;  5AVS B;  4JF7 A;  1EZV G;  1URQ D;  1KYO D;  1KIL A;  3A0H H;  2HMJ A;  3MP7 B;  2ZAE B;  2QM8 A;  2POH A;  2M0B A;  2AEM A;  3BCC D;  1KIL E;  2OYH B;  3MD0 A;  4NBB D;  4H0L B;  1TU3 F;  2HOD B;  1CW5 A;  4HM7 A;  5KAI E;  1W2B O;  4XE5 B;  5BU8 B;  3N4X A;  3DQY A;  1YHQ P;  1SFC B;  4OWF A;  5AVT B;  2B87 B;  1FZC A;  1PIX A;  3TF5 A;  3GF3 A;  1RE3 C;  1OXZ A;  5E79 E;  1L4A C;  2W27 A;  1J1E B;  4IFD K;  1NTZ D;  3CX5 I;  3WU2 H;  3H1J E;  4L73 A;  1R5L A;  5AEW A;  1JNM A;  2H89 C;  1VQ6 P;  2MJZ A;  2BMO A;  1QLE D;  1FZC B;  1NU1 G;  2C0X A;  1K05 A;  2YFL A;  3KPE A;  1SQQ K;  1EDJ A;  4QDF A;  1BGY D;  1N2D C;  3G4S P;  1Q86 Q;  4IL6 E;  2K3R A;  3HE4 A;  2GBW A;  2JP3 A;  3CX5 D;  1VPC A;  3H32 A;  3L70 J;  1NO4 A;  2C0W A;  3CX5 H;  3H1I D;  3L72 G;  2P67 A;  3CMA P;  2YNY A;  2IBZ I;  2NVF A;  4L74 A;  1VL2 A;  2P58 A;  4DCK A;  3TNU A;  2G8Y A;  1S9K D;  2FYN B;  4Z1M H;  2AEF A;  1LTJ B;  4IFF A;  2WSC H;  2NUK A;  2YFJ A;  1OX3 A;  5CCH C;  1FU1 A;  3G9R A;  4IOI H;  4PV1 C;  2NVE A;  1PPJ E;  1EXI A;  3GCE A;  2B9B A;  3BCC G;  3R2P A;  3TNU B;  3CCQ P;  4ZKU A;  2Q1K A;  4AAY B;  1NTK D;  5CCG C;  5KTB A;  1FDM A;  2E76 B;  1JUN A;  3VN0 A;  1RE3 A;  1NTM D;  2M3E A;  1LTI C;  3HTK A;  3G3Z A;  2GUV A;  2KZI A;  1NTZ G;  1NYH A;  3AE4 C;  3FGA D;  3C9I A;  5APQ A;  1H0T B;  1O7W A;  5AVU B;  5KLV D;  1Q90 C;  5APS A;  1PP9 G;  1T2K D;  1P84 E;  2O1K A;  1BGY G;  1T3J A;  1RE4 C;  2BCC D;  1L4A B;  2KNC A;  1BE3 E;  1VF5 D;  3SFD C;  3AZC A;  3L71 E;  1LT9 C;  2HPC B;  2H7H A;  3RBX A;  3H1I G;  2N1T D;  3IFM A;  4WB4 A;  1MFT A;  3H6P A;  4GDO A;  1SVF A;  4NB9 D;  2KNC B;  4D6T J;  2FYU J;  2V7Q H;  2XU6 A;  1OVV A;  2QA4 P;  1YTZ T;  2K9Y A;  2L91 A;  1QL1 A;  2W8Z A;  5CCH A;  3B71 A;  5E79 H;  2QG4 A;  1FZF A;  2E75 C;  1Y47 A;  2Q7C A;  4QMA A;  4YTP C;  1R5S A;  2QM7 A;  3H1H E;  2L5G B;  1PGP A;  3RK2 C;  4ZNC A;  3CCJ P;  3VOP A;  1LTA C;  2OTL P;  1SQP E;  2IYO A;  4WBA A;  1NTK G;  1VQO P;  1ZR4 A;  5CCG A;  1EQ7 A;  1X79 B;  2E74 C;  1JM1 A;  1MUU A;  1NKN A;  1NU1 K;  3FOU A;  3L75 D;  4QCK A;  2ZXE B;  1NTM G;  4PV1 B;  1ULJ A;  1NKZ B;  4BRY A;  3AE6 C;  2PAJ A;  1NVO A;  3SWK A;  1SQB K;  3FWN A;  2Q6Q A;  2XND H;  3L74 J;  1L0L J;  2SPZ A;  1VQK P;  1FDI A;  2A45 G;  2NPS A;  2BCC G;  1RE4 A;  3M06 A;  2C9L Y;  4Y99 B;  2QJK B;  1O7M A;  1O7N A;  4C7R A;  4ZKP A;  1FE6 A;  3CCM P;  3T97 A;  3U59 A;  1UUV A;  1L0N G;  4AIV A;  4I7Z C;  1FDO A;  2WZ7 A;  1ZLL A;  4EIJ A;  4JBZ A;  4JYB A;  1IFM A;  5BU5 A;  1LT9 B;  2GA1 A;  4N3Y B;  1FZG A;  2E76 D;  2HG5 D;  1NU1 E;  1SQX J;  4W7Y A;  3P8C D;  3JCU H;  1NTZ K;  2KIK A;  4QDC A;  1PP9 J;  1J1D C;  2KLU A;  1KQL A;  4HB1 A;  2XSH A;  3TGU D;  4RES B;  1M90 Q;  3SWY A;  1KB9 I;  3CD6 P;  3L75 G;  1L4A D;  2E75 B;  2HMO A;  3KYQ A;  2KP8 A;  2KSE A;  2Y0E A;  4GOD A;  4EYY Q;  1KYO E;  1FS0 E;  2FXM A;  2E74 B;  4OH8 B;  2D2C D;  1KQS O;  1EG9 A;  1KB9 D;  1KB9 H;  1GU4 A;  2WSC J;  3RL0 B;  3M0D C;  2JO6 A;  2P1J A;  1PV3 A;  2Y9Y A;  1KN7 A;  4XFJ A;  1JMB A;  1G2C B;  3F89 A;  1E79 H;  2WSF J;  1GTW A;  4JPZ B;  3L73 G;  1X22 A;  2WMM A;  5AW6 B;  3GHG C;  3NTN A;  3S1K A;  2KS1 A;  3WU2 E;  1AQT A;  4U3F D;  2M8R A;  2J58 A;  1NTZ E;  4QUR A;  1EZV I;  3P32 A;  1O7H A;  2M3B A;  1OW7 A;  1NTK K;  3BRV B;  3VMA A;  2VRS A;  1X8Y A;  2R3S A;  4GT1 A;  3HUS B;  1PP9 E;  1SQQ G;  1SQV J;  4C7N B;  1GDT A;  2O1J A;  1OWA A;  1N86 A;  1BGY E;  1PFI A;  1NTM K;  2Z5H A;  2IX7 C;  4AQR D;  1ZP0 C;  1HTL C;  4I7Z B;  3AEF C;  4IFM A;  4H13 D;  3CWB D;  3CX5 E;  5KLV K;  2FY8 A;  3TGU G;  1KIL C;  3D89 A;  3V2R A;  2LKM A;  3H1I E;  3VP9 A;  3CCV P;  2ZYD A;  1HGZ A;  1ZW0 A;  4R4M A;  1T8Z A;  1JTH A;  1M1J C;  3W67 A;  1GL2 C;  1JCC A;  1VQ4 P;  2W83 C;  2OYI B;  4IL6 X;  1S9K E;  2YKQ A;  2XNX A;  3EQQ A;  4LC1 A;  1J1D B;  4JQ0 D;  5APT A;  1HJB A;  1GW4 A;  1USE A;  4TT3 H;  1G8J B;  1L0N J;  1JTH B;  1NJI Q;  2IBZ E;  2GBX A;  3M0D A;  4N6J A;  1KD1 Q;  1VQM P;  3D6Z A;  1NTK E;  2Q5U A;  1VCK A;  4I6M C;  4HM8 A;  2R5B A;  2IZ1 A;  3HD7 B;  3H1J J;  1NTM E;  4U3F G;  2JEE A;  2I1J A;  3GL2 A;  1KYO I;  1OIP A;  1QVG O;  3C0D A;  2Y9Z A;  1RIE A;  1JO5 A;  3VTP C;  1DEB A;  3IR9 A;  2WSE H;  1JB0 J;  1LWU C;  3GHG B;  3H1L G;  2NWF A;  2W6J H;  2BCC E;  1FZE A;  2WT7 B;  3CWB G;  3HE5 B;  3BRT B;  1YJ9 P;  1KYO H;  1K8A Q;  1WRG A;  2B24 A;  3GB4 A;  1M1J A;  1L0N E;  5B5E H;  1GL2 A;  3RL0 D;  3TK1 A;  1BCC D;  1SLQ A;  1YJW P;  2AEJ A;  3KZI H;  5AW7 B;  1LJ2 A;  1OVR A;  3PRJ A;  3WUU A;  5APY A;  1YIT P;  1KIL B;  4UB8 H;  3RBZ A;  2JO1 A;  2KUB A;  5APX A;  4NBF D;  2GUS A;  2ZVN B;  3LID A;  5EFW B;  3A7O A;  1M1J B;  1ZXG A;  1YBK A;  3GZX A;  3BAT A;  2CK3 H;  1Y9B A;  1OW8 A;  1SS1 A;  4HKZ H;  1KC8 Q;  1N7S D;  4H44 C;  2K37 A;  2IPP A;  1Q2N A;  3I55 P;  1SQX D;  3AE9 C;  3Q5R A;  1RQV A;  4DZO A;  2JZA A;  3L75 E;  1WT6 A;  1U7J A;  1N73 C;  2KXP B;  2ZYG A;  2N9Y B;  5GTH H;  4HM0 A;  1HGV A;  1PGJ A;  1VQL P;  1FC2 C;  4A7P A;  1SQB G;  1RF1 C;  2ZT9 D;  1ZR2 A;  4OGQ D;  1HH0 A;  3Q5P A;  5B66 H;  1YQ3 C;  1BE3 J;  2CPB A;  1S5L H;  4HM6 A;  4QDF B;  2NRG A;  3A5T A;  4NPF X;  2OQQ A;  1LWU A;  2XKM A;  4PJ0 H;  3L71 J;  3S9O A;  3HE4 B;  3W68 A;  3BAS A;  5HL4 A;  1PZQ A;  1W2E A;  3H32 B;  1JM0 A;  3JC2 2;  3E7K A;  4NB8 D;  2FFD A;  1Y8A A;  1G1I A;  1QGK B;  3GKE A;  1HWT C;  2JWA A;  3L73 E;  5CJ0 A;  2BAS A;  1DEE G;  1AVY A;  1MZ9 A;  2ZVO B;  3HRN A;  3SWF A;  3FX0 A;  1BCC G;  4HH2 A;  4WY4 D;  1ZRT E;  1UUW A;  3MIW A;  3A0B E;  1K73 Q;  2KSJ A;  2WIT A;  2A45 I;  1M7L A;  3HD7 D;  2HMK A;  2WVR A;  1SQQ E;  5AW5 B;  1QX8 A;  3H1H J;  3P8C E;  1SQP J;  4AUW A;  3B5N D;  3JCU E;  3OA7 A;  2ZYL A;  5KJ7 A;  1R8E A;  3TGU E;  2XSO A;  2NPS C;  5AVY B;  3RK3 C;  1GK6 A;  2OYO A;  3H1L J;  1X9V A;  2A45 H;  1MKM A;  1JY3 N;  3HTK B;  1N73 A;  2QSI A;  1EDL A;  4O9B A;  3SSU A;  5AW8 B;  1NAY A;  1RF1 A;  1S72 P;  4H44 B;  2QEX P;  2B89 A;  1ZV8 A;  1KB9 E;  1JY2 N;  3M9B A;  1QEX A;  4H0L D;  1N73 B;  1G8K B;  4NBE D;  2IDB A;  4BXL A;  2DE5 D;  2PP6 A;  2E5T A;  2YMK A;  3GG2 A;  2BMQ A;  1SFC D;  1YTZ I;  2QIW A;  5GTI H;  3V4W A;  5KKZ C;  3PP5 A;  2B1X A;  1HUC A;  3G6E P;  4HKV A;  1QL2 A;  2DW3 A;  1DH3 A;  4U3F E;  1AA0 A;  1IFI A;  4NBG D;  1KTM A;  3CXH I;  2B88 A;  3NMD A;  1Q81 Q;  1NU1 J;  3GMA A;  1YQ4 C;  1H8A A;  3A2A A;  2XRX A;  2NZ2 A;  1RF0 A;  3AE7 C;  1N7L A;  3M91 A;  4EOT A;  3H1L E;  1URQ C;  3M9H A;  1SQB J;  3L72 J;  5KLV G;  4QDD A;  3CWB E;  1QVF O;  1GU5 A;  3OAK A;  1AJY A;  3GTE A;  1EZV E;  4M3L A;  3H1K D;  5DJT B;  3CXH D;  5H2F H;  2K1A A;  3CXH H;  2Q3E A;  2ZYA A;  5K5G B;  1NYK A;  1GW3 A;  3GL0 A;  3TDK A;  4BRY B;  3RK3 E;  1GK4 A;  5AVW B;  2O01 H;  1L0L K;  2YIU C;  3D71 A;  2YKP A;  3CI9 A;  3BCC J;  2NPS B;  2QJP C;  2Y0D A;  3RK3 B;  5AW9 B;  5CBN A;  5AVV B;  3GTS A;  4KJM A;  3KDP B;  1NOH A;  3A0B H;  3JSV C;  1PPJ D;  5KAF H;  3T97 B;  2IFN A;  1NTZ J;  1YJN P;  4NBA D;  4NPE A;  1OMI A;  1A02 F;  3CME P;  4GIF A;  1GD2 E;  2YVJ B;  3MTU E;  3NFQ A;  1SQB E;  3KQG A;  3L72 E;  1BGY J;  2FXO A;  2KI7 B;  1SQX K;  5KKZ B;  2O01 N;  3S4R A;  2QPZ A;  1AVO A;  1URQ A;  3L70 D;  2ZXX A;  3RK2 B;  3H1I J;  3Q5S A;  2HYN A;  3Q1M A;  3H1K G;  1VQ7 P;  4HM3 A;  3K5B A;  1BE3 D;  1PL5 A;  2Z5I A;  2HLO A;  5KLI C;  1FAV A;  3F5H A;  3BCC E;  5B5E E;  2OTK E;  5TIS H;  3WUT A;  1LGH B;  3IAO A;  3KZI E;  2WPQ A;  1GZL A;  2KYV A;  1Q82 Q;  3E1R A;  2J5U A;  5AVR B;  2KZJ A;  4UB8 E;  2YO3 A;  3P8M C;  1WQL A;  1AQ5 A;  2DE7 D;  3CCR P;  2AXC A;  1T2K C;  4XA4 A;  1N7S A;  1NTK J;  1JY2 P;  4GKG A;  3C8V A;  5CJ4 A;  1BSH A;  3L4F A;  3B8E B;  1HF9 A;  4N78 D;  1PPJ G;  4DJG A;  5CCH D;  1NTM J;  2I8D A;  1T3U A;  4PV1 D;  2KS1 B;  3Q2Y A;  1IJD B;  5GTH E;  2QJP B;  2Y0C A;  4K35 A;  1HVV A;  2N1T C;  2ITA A;  2AXT H;  2P7J A;  1FOS F;  5CCG D;  2OYH C;  1U7M A;  5B66 E;  2ZJS E;  5AW2 B;  1ULI A;  2BMR A;  3GZY A;  1DD4 A;  1S5L E;  2BCC J;  3M0A A;  3Q3D A;  4PJ0 E;  2WWW A;  1RFS A;  3V2Q A;  3L70 G;  3AEG C;  1LT1 A;  2RH0 A;  2YO2 A;  3VMG D;  2BEZ F;  2WSS H;  3N7N A;  3FXE A;  1J1E C;  4PD4 D;  1M1K Q;  1Q90 D;  5AW0 B;  3EFF K;  2V7Q J;  3MGN A;  4D6T D;  2FYU D;  2R44 A;  1RY3 A;  5BVZ A;  2V4H A;  3AE1 C;  2XDJ A;  4UB6 H;  3FWL A;  1LTG C;  3VYI A;  1T6A A;  2P2U A;  2JWD A;  5BOK A;  5KLI B;  1LP1 A;  2M5A A;  4TLF A;  5DJU B;  3RGU A;  2HR3 A;  5TJH A;  2KOG A;  2ZFC A;  3L37 A;  1S1C X;  1DX7 A;  5KLV E;  4HM1 A;  1X0T A;  2CKF A;  1MFZ A;  3L75 J;  1ZOY C;  1FJP A;  1LTJ C;  1FZB A;  2OAR A;  3EWK A;  1IZN B;  2E75 D;  2UWJ E;  2O3J A;  2E4P A;  1HBW A;  3KXD A;  4ZMD A;  2N1T A;  3RK2 D;  3L74 D;  2FFD C;  2QRX A;  1L0L D;  3ZDM A;  3V4Q A;  1JY2 O;  2E74 D;  2OYH A;  2RKL A;  4YXD C;  4GOF A;  2DE6 D;  3VMY A;  4LLH A;  3D70 A;  1SFC A;  2NUM A;  2E76 C;  2YKO A;  2B87 A;  2O01 J;  2NVG A;  1OVU A;  2N1T B;  4NBD D;  3L73 J;  5GTI E;  3NXS A;  2W90 A;  2R32 A;  1EXJ A;  2FBW C;  1KV4 A;  2FKW B;  2R5D A;  1IK9 A;  3V6I A;  4D6T G;  2FYU G;  2A06 D;  1KFN A;  2E42 A;  3MZW B;  4RO0 A;  4QUQ A;  1GL2 B;  1RHZ B;  3M9Q A;  4P1C H;  4C46 A;  1IFP A;  5KJ7 C;  2MKV A;  3AE5 C;  2Q3W A;  1SQQ J;  2QJY C;  4HJG H;  4P1B H;  2E43 A;  3II6 A;  2XV5 A;  3R4Y A;  3ABV C;  1CI6 A;  1SP4 A;  4K3A A;  1NDO A;  3L35 A;  2GM4 A;  1PP9 D;  2H43 A;  3TGU J;  2D2C C;  3GW6 A;  4KT0 J;  3VCA A;  3GOB A;  3H1K E;  3PH0 A;  5H2F E;  3CXH E;  1E5W A;  5APU A;  1LTJ A;  2RN0 A;  1CI6 B;  2LXC B;  1CSB A;  3SFE C;  5AVZ B;  3C1L A;  2PRR A;  3L74 G;  1L0L G;  1DIP A;  2LXB A;  3MUD C;  4AYC A;  3LW5 H;  2Z4E A;  3I56 P;  1LWU B;  2W6A A;  3CCL P;  1GMJ A;  2C9N Y;  3D6Y A;  1S2E A;  2WQY C;  2P10 A;  3AEC C;  4LGD E;  2WSF H;  5APW A;  2Q9I A;  3OW2 O;  1NHL A;  5KAF E;  2FFD B;  2IBZ D;  1NWQ A;  1YI2 P;  1RF0 C;  5CBO A;  1H0T A;  2KLV A;  4H13 C;  1K04 A;  1YIJ P;  4U3F J;  3N0Q A;  2A06 G;  3CC2 P;  3V5B A;  2LR2 A; 
#chains in the Genus database with same CATH homology
 1PP9 E;  2HMN A;  4OGQ D;  3VMI D;  2Q3W A;  1VM9 A;  2HMJ A;  3L74 E;  2E4Q A;  2QJY C;  2YIU C;  1NU1 E;  4P1B H;  2NVE A;  1L0L E;  1PPJ E;  4H44 D;  4HM6 A;  4QDF B;  1BGY E;  3GCE A;  4EMJ B;  4NBB D;  1WQL A;  2QJP C;  1FQT A;  1KB9 E;  2NWF A;  4HM7 A;  2DE7 D;  4H0L D;  3H1H E;  2BCC E;  2QJK C;  2HMM A;  2YFI A;  1G8K B;  4NBE D;  5BOK A;  1SQP E;  4AAY B;  2DE5 D;  4QDC A;  3DQY A;  3GTS A;  4H13 D;  5HL4 A;  3EN1 A;  1NDO A;  3CX5 E;  1BCC E;  2BMQ A;  4HJL A;  5AEU A;  2XSH A;  3L70 E;  1SJG A;  4NB8 D;  3D89 A;  3H1I E;  1JM1 A;  5KLV E;  4HM1 A;  4HM4 A;  2CKF A;  3VCA A;  3GKE A;  3GOB A;  5KKZ C;  3L73 E;  3H1K E;  4PD4 E;  2I7F A;  3FOU A;  3CXH E;  2B1X A;  4QCK A;  2B24 A;  3GB4 A;  1L0N E;  3H1J E;  1ULJ A;  4PV1 D;  4HKV A;  2HMO A;  2E75 D;  4HM5 A;  5AEW A;  4D6T E;  2FYU E;  4U3F E;  2E4P A;  2A06 E;  4NBA D;  4NBG D;  1O7W A;  1ZRT E;  2HML A;  2YVJ B;  1UUW A;  2BMO A;  1Q90 C;  3EQQ A;  3VMH D;  1SQB E;  1P84 E;  1O7G A;  3L72 E;  1KYO E;  2YFL A;  2XR8 A;  1G8J B;  2D2C D;  4QDF A;  2HMK A;  1EG9 A;  1ULI A;  1O7P A;  2BMR A;  2E74 D;  1SQQ E;  3GZY A;  1SQV E;  2FYN C;  2XRX A;  2DE6 D;  4NBF D;  1SQX E;  4NBC D;  1BE3 E;  2IBZ E;  2GBW A;  1VF5 D;  3H1L E;  3AZC A;  2JO6 A;  3GZX A;  2GBX A;  2NUM A;  3L71 E;  1RFS A;  2QPZ A;  3VCP A;  5CXM A;  1O7M A;  1O7N A;  2NVG A;  2ZYL A;  1NTK E;  4QDD A;  3CWB E;  1VCK A;  3VMG D;  4HM8 A;  4NBD D;  3GTE A;  1EZV E;  3TGU E;  2XSO A;  4QUP A;  4HM3 A;  2NVF A;  1UUV A;  2JZA A;  4AIV A;  3L75 E;  1NTM E;  4NBH D;  4NB9 D;  5KLI C;  3N0Q A;  4HM2 A;  1NYK A;  3BCC E;  1NTZ E;  3GL0 A;  4QUR A;  4HM0 A;  3GL2 A;  4QUQ A;  2NUK A;  1O7H A;  2YFJ A;  4P1C H;  2ZT9 D;  3C0D A;  1RIE A;  2E76 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...