3H1IE

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
total genus 45
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1iE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1iE02
1NTKE 4HM6A 1EG9A 1NTZE 1ULJA 3CX5E 3GOBA 2B24A 1G8JB 2QJYC 1RIEA 4OGQD 4U3FE 2ZYLA 2JO6A 4QUQA 3L75E 1KYOE 2B1XA 4QUPA 5BOKA 1WQLA 3GZXA 4QDFA 3H1KE 4P1BH 4P1CH 1SQPE 4QCKA 3L70E 4HM1A 2Q3WA 3GL2A 1L0NE 4H44D 3D89A 1O7HA 2HMLA 5KLVE 1O7PA 4NBGD 1Q90C 1VF5D 4NBCD 3GTSA 2I7FA 1O7GA 4HKVA 1NTME 3H1JE 4AIVA 4HM7A 1VM9A 4H0LD 3GB4A 3VMHD 3VCAA 1EZVE 4NBHD 4PD4E 2XSHA 4AAYB 5AEWA 1UUWA 4QDFB 3AZCA 2NVGA 3GL0A 4NB8D 1KB9E 4EMJB 5HL4A 1PP9E 2NVEA 4HM8A 5AEUA 2NUKA 4HM4A 4HM5A 5KLIC 1UUVA 2QJPC 5KKZC 3L71E 4D6TE 2HMMA 1SQQE 2YFJA 3DQYA 1NU1E 1SQBE 2FYUE 1BE3E 1P84E 1PPJE 3GCEA 4NBDD 2DE7D 1BCCE 2YIUC 4HM2A 3VCPA 1L0LE 3H1IE 1NDOA 1O7WA 2IBZE 3L73E 2XRXA 2YVJB 2BMOA 2HMJA 3VMGD 1NYKA 2E4QA 2YFLA 2BCCE 4QDDA 1SJGA 1VCKA 4NBBD 3CXHE 2A06E 3BCCE 1RFSA 1SQXE 1ZRTE 2NWFA 2QJKC 1O7MA 1BGYE 3VMID 2E75D 4QURA 2BMRA 2HMNA 3GKEA 4NB9D 3EN1A 3CWBE 4PV1D 2DE5D 2HMOA 2E4PA 1JM1A 2JZAA 3N0QA 5CXMA 3GZYA 3FOUA 4QDCA 4HJLA 2QPZA 1SQVE 3GTEA 3TGUE 2GBWA 3H1HE 2XR8A 2HMKA 4HM3A 1G8KB 3H1LE 2GBXA 2ZT9D 3L74E 2XSOA 1O7NA 3C0DA 3EQQA 2E74D 3L72E 4H13D 2NUMA 2YFIA 4NBED 4NBAD 1FQTA 2BMQA 2DE6D 2FYNC 2E76D 4NBFD 1ULIA 2CKFA 2D2CD 2NVFA 4HM0A
chains in the Genus database with same CATH superfamily
3E1IA 1LTGC 1FZFA 1L0NK 2KI7B 1IK7A 2P58A 2FYZA 1LTAC 1JY3O 2E42A 1WQLA 2M8RA 1KQGB 2CK3H 1L0LD 1P84I 3TYYA 3KZIH 4NBGD 2B88A 1EXIA 3EFFK 2QG4A 2YIUB 3D6ZA 1VM9A 1M1JC 1N73C 3LIEA 3E7KA 4EI2A 2OYIA 2Y0EA 5KKZC 5AW0B 1SQQE 4DZOA 1JY3N 2FYUE 1MKMA 2YKQA 2KYVA 4C7NA 3VCPA 4NPFX 1RF1C 1KV4A 2M5AA 2LR2A 3S1KA 5APSA 2BMOA 2OQQA 2E4QA 2YFLA 4M3LA 1H89A 2K3RA 3AE7C 3CXHE 1YYCA 2H89C 3M9BA 4TT3H 1SFCC 3VMID 1L4AA 1LJ2A 1T3JA 4JYBA 2Y9ZA 2QM8A 3HE4A 2ZJSE 2WVRA 1ZR4A 3HRNA 3MUDC 2Z5HA 3H1HE 1LTIC 1HGVA 1KQFB 1VQOP 2FYUJ 2V7QH 2WSFH 2NUMA 2YFIA 1IK9A 4IFMA 5GTIE 3QWOC 2J59M 5M1BA 1EG9A 2QIWA 1VF5B 3EFGA 1IFIA 1CZQA 2P7JA 1LTBC 4XFJA 5KLVJ 3AE9C 3VMAA 3AE1C 3RL0g 3MZWB 1AQ5A 1RY3A 2N1TD 2O01H 1K04A 1DX7A 3TGUD 3FWLA 4GODA 2QSIA 3C8VA 1SQPJ 1IFNA 2FYUG 1NVOA 1OXZA 2KZIA 2NVEA 5APWA 1N2DC 4HM5A 3NFQA 4BRYB 1SQXD 3GF3A 3L36A 1NTZJ 3H1JD 1VQ5P 1IFJA 3AE2C 1RHZB 2MJZA 3L72J 4ZKUA 1BDDA 4H44C 2FYUD 3A0BH 1RH5B 4H0LB 1SJGA 4EIJA 3HTKB 1N7SD 2YXRB 2IBZI 3AE3C 2KSJA 1NJIQ 4GIFA 2GUVA 3PJSK 3FOUA 4W80A 3RL0B 2KS1B 3BATA 1NWQA 5B5EH 4XE5B 4NBED 3G3ZA 4WVZA 2IBZG 3GHGC 4HYTB 4OGQD 1LT9C 2KUBA 3HUSB 3H32A 5BOKA 3HD7A 3N4XA 1QL1A 1OW7A 1LT9B 1NU1K 1O7HA 1KZUB 2NPSC 2I7FA 4AIVA 4H0LD 1BE3G 5DJTB 3L75G 1UUWA 3CPWO 1SFCD 1LTJB 4BXLA 3FXDA 3PLNA 4YTPC 1FZGA 1URQC 1KTMA 3IN6A 4UB8E 3Q5SA 3CCSP 1BCCE 1S3JA 1X22A 1RF0C 2G3AA 3CCMP 3HE5A 1OVVA 2ZAEB 4Y99C 2Q1KA 1EDIA 2B87B 5CCGC 1X0TA 3N0QA 1WT6A 2QPZA 3GTEA 1HH0A 1G1IA 1VPCA 1HBWA 5CMZA 1PIXA 1NAFA 2WMMA 1OFCX 4U7JA 1JNMA 2IYOA 1OW8A 1LTTC 1KILC 2WSCH 3TNUB 4QDFA 4JBZA 4A7PA 4NPDA 2M3EA 1L0NG 5AVXB 4UB8H 1Q90C 3AE4C 4K35A 2UWJE 3AE5C 4HM7A 2WPQA 1UIXA 2N9YB 4NBHD 4R4LA 1OW6A 4AAYB 2Q9IA 3KYQA 3WMM0 1HGZA 4RKUJ 1AV1A 2LXBA 2ZXEB 1UUVA 2WSSH 1PGJA 1GZLA 3GLMA 2HMMA 4PD4I 1R5SA 1SQBE 1JUNA 3ZDMA 1BCCG 3MD0A 4NBDD 1SQQJ 1K8AQ 4Y99B 1L0LE 3CX5H 4DOJA 2H8PD 1BSNA 4N78D 1VCKA 2JWAA 3VP8A 3H25A 1NGMB 1TU3F 3BRVB 1SQQK 4PV1D 3SFDC 3CCRP 2OGUA 3B5NA 1BGYD 2JZAA 2XNXA 3V5BA 5APYA 1G1JA 1SQVE 2O01J 5CCHC 3L73D 1LP1B 4OVNF 4NBAD 2IDBA 1FQTA 2L91A 3I56P 1VQ9P 4LC1A 1DH3A 3WU2H 3P8CD 3K5BA 2W6AA 5KTBA 2AXTH 3OW2O 4WY4C 1KYOE 1VQ6P 5EFWB 3RK2B 3B4SA 4EDFA 5KLIB 4H0LC 4PD4D 4GOEA 2K88A 3HD7D 1WMKA 2Y0DA 2JEEA 1VF5D 3L37A 1NTME 3UIAA 3H1JE 2H43A 2I1JA 2KNCA 4NB8D 5AW2B 2IFNA 3H32B 2A45H 5GTHH 3AECC 4L74A 2M3BA 1BGYG 1L0LJ 2KK7A 4D6TG 5GTIH 2YNYA 4GDOA 1BE3E 3H1LJ 2PP6A 2OYIB 1CI6A 1H0TB 3NMDA 3L75D 2A45G 3S9OA 1G2CA 3HTKA 1VL2A 1EZVG 3GW6A 3HUSC 1NH4A 2BCCE 4BRYA 2IFMA 4C46A 1LWUC 1RFSA 2QJKC 1BGYE 3FGAD 4QURA 3V6IA 1N7SB 1WRGA 1SQVK 1YJWP 4U3FJ 4QMAA 2I8DA 1LGHB 1KYOD 1JM1A 2E4PA 3D6YA 4QDCA 4HJLA 1EZVI 2IX7C 1L0NJ 2PGDA 2YMKA 3L74E 5BVZA 3C0DA 1SQVJ 4IL6X 1JM0A 1IFDA 4GT1A 2PAJA 3H1KD 3H1IG 1W5CE 3LW5J 1SQBD 3NXSA 1YQ3C 1M1JB 1N73B 1AVYA 4L76A 2B1XA 1URQA 1NO4A 3CXHI 2B89A 3L74G 2WSCJ 1Q82Q 2K9JB 4IFDK 1KYOH 1P84D 1MFTA 1DD3A 5CCHA 2W8ZA 1VQLP 3VMHD 3VCAA 1QX8A 1GL2D 2XSHA 3GMAA 3VN0A 2NVGA 3V2RA 2IZ1A 1Q90D 2O01N 4W7YA 2QA4P 2OYHC 4U3FG 5CBNA 1GK4A 3P32A 1SS1A 1PPJE 4AUWA 2QM7A 3W68A 1EZVD 4DCKA 1NDOA 3G9RA 1NYKA 3R4YA 2W90A 2N1TC 4N78E 2C0XA 1SQBG 2HMNA 2ZT9C 4KHXA 4Z1MH 3V4WA 4U3FD 2E74C 1JOCA 3D70A 1S4XA 1YJNP 3CXHD 3TGUG 3KZIE 2JKVA 3KPEA 2IBZD 2J5UA 2HPCA 2FY8A 2BEZF 5KKZB 5KJ7D 2AEFA 3HUSA 2D2CD 1NTKE 1SQPK 3H6PA 1JY2P 4MN4C 2XU6A 3OAKA 1PGPA 1VQKP 3M9QA 1DEEG 1J2JB 2FFDB 5CCGD 3H1KG 1EDJA 5TISH 1GMJA 1NAYA 2WTYA 1KB9I 5AVTB 5AW3B 2R5DA 3GTSA 3CC4P 3W67A 2YMYA 3CXHH 1FZCC 2ZVNB 2QJPB 5BU8B 4PD4E 5AVZB 5AVYB 2RN0A 4EMJB 2HPCB 2M0BA 1M7LA 3SSUA 1R5LA 1FJKA 4I7ZC 3PTZA 2JJLA 4HM2A 2KLUA 2E43A 2Q7CA 2OYHB 2IBZE 4GOFA 2XRXA 1NOHA 3RBZA 4I7ZB 4PJ0E 3CCLP 3SWFA 2BASA 1ZRTE 1O7MA 2ZFCA 4PJ0H 1FS0E 1Y47A 1IC2A 3VP9A 3TK1A 1M57D 1JY2N 3I5CA 2XKMA 5KJ7C 2V4HA 3L72G 1FU1A 4PV1B 1NTKJ 2MKVA 3CWBG 2WT7A 2XZRA 2WITA 4IL6E 3A0HE 2E76D 3O8ZA 1YQ4C 2VRSA 1RE4C 2OTJP 1QEXA 3H1JG 3CX5E 2B24A 2HYNA 2IPPA 4WB4A 1KILE 3L71J 3MUDA 1CI6B 1YTZI 3JSVC 2XV5A 3GZXA 3H1KE 1SQPE 1OVUA 1NTMJ 2FYUK 1L0NE 1E5WA 1BDCA 2KB7P 2ZYGA 1LWUA 1YJ9P 3CWBJ 1EZVE 3CCQP 3GL0A 1H8AA 2KLVA 3L70G 1NTMK 1UIIA 1NYHA 4HM4A 1CW5A 3L71E 5C39A 3TGUJ 1KQSO 1PP9D 2QE7H 3JCUE 2KP8A 4R4MA 1SQXG 3CMEP 1OMIA 5APTA 3TSIA 1S72P 1JTHA 1X79B 1SQXJ 3LIDA 1BE3D 1SQQG 4I6MC 3H1HD 2D2CC 3M9HA 1K73Q 1YTZT 1AA0A 2BCCJ 3CWBE 1Q7YQ 5DJUB 2JWDA 5CXMA 1MFZA 3R2PA 3PH0A 5AVUB 2Q3EA 3RK3D 3RK2C 2YO3A 2GBXA 2JP3A 4OGQC 1S1CX 4WY4D 1BCCJ 5BU5A 2BMQA 3PP5A 4KJMA 1YI2P 4ASWA 3A2AA 1OZHA 4EYYQ 2OARA 1BSHA 3GG2A 1L4AC 2AEJA 3G4SP 2YO2A 1T8ZA 1CSBA 3GL2A 3IFMA 3AEGC 2KSEA 2JDIH 1DD4A 1L4AD 2YXQB 2W27A 3KQGA 4N6JA 2WT7B 1MUUA 2CPBA 3KXDA 3II6A 1RE4A 4LLHA 4C7NB 5KLIC 3L73J 1Y8AA 1KQLA 1FC2C 3RK2D 2I1KA 2D2CB 2NPSA 4H13C 5KAIE 1KILB 4D6TJ 2V7QJ 2BEQD 1RQVA 2KIKA 5AVQB 1JMMA 1D7MA 4N3YB 3D71A 4QDDA 1YIJP 2A06G 1W2EA 2FFDC 4LGDE 2NWFA 1FZEA 4NB9D 2B87A 2C0WA 1J1EC 1T6AA 4OH8B 1NTZG 2GUSA 3QH9A 1SQQD 4RO0A 1FDIA 2P1JA 3C9IA 3L35A 2FYNB 3NTNA 3CMAP 1NTMG 2XSOA 2WWWA 2B9BA 1JY3P 3L72E 3M0AA 3A0HH 2Q5UA 1KYOI 3MIWA 1RE3C 1M56D 1IFPA 1NTZE 1M8OB 1ZMEC 1XTCC 1N8RQ 2CPSA 1HVVA 2JO6A 3WU2E 1Q2NA 2E76B 1ZOYC 1VF5C 1SQBJ 3M06A 3GF7A 3L73G 1VQPP 1Z56A 2W6BA 2O3JA 4O9BA 2K37A 1HF9A 2Q6QA 1OIPA 1ZR2A 1L0ND 1HTLC 1SVFA 1KILA 1HUCA 3VMYA 4HB1A 1U57A 1KB9E 5AEUA 5KLVD 2N1TB 1S5LX 1BE3J 1VQ8P 2A45I 2QJKB 3AE6C 4BWNA 1NTKG 2YFJA 1NU1E 3IR9A 1N86A 2R3SA 4H44B 1AFOA 1KD1Q 3H1IE 1A02J 4WY4B 3Q1MA 1GW4A 5APQA 5KAFE 1SQVG 1EQ7A 1YITP 3G71P 5CBOA 1S5LE 1NU1G 1FOSE 4L73A 4HKZH 2P2UA 1X9VA 3E1RA 1IO4A 2Z4EA 1JY2O 1N7LA 3H1HG 3GZYA 4JYCA 3A0BE 4RJTA 5CJ4A 2A06D 2GBWA 2G8YA 3OJAB 2XR8A 2HMKA 1G8KB 2NZ2A 4RESB 1M1KQ 2NPSB 2XNDH 5AW4B 4NBFD 1ULIA 2CKFA 4OWFA 1IZNB 4HM6A 1T2KC 3RK3C 1ULJA 5B5EE 1PZQA 3SWKA 3CCEP 1S9KE 1PPJD 3PHLA 4QCKA 4PV1C 3T97B 1NTKK 2QJYB 2HFED 2JR8A 4IFFA 3D89A 2W83C 3H1KJ 1NTZK 2H7HA 4TLFA 2OYOA 1LT1A 1JEKA 4QDFB 1YBKA 1BGYJ 5HL4A 1PGOA 2FXOA 4OGQB 1T2KD 1KC8Q 1P84E 2C9LY 2DW3A 1J1DB 1GL2A 4HJGH 4AQRD 1PL5A 2HMJA 3VMGD 1OWAA 2HG5D 3ITKA 1N7SA 1LNQA 1S5LH 3L74D 3BCCG 3WUTA 2DE5D 1ZN5A 1FZCB 3L72D 1URQB 2N9BA 3L70J 2R44A 2R5BA 2KS1A 2K9YA 5E79H 1EDKA 1AJYA 3RGUA 5APXA 1S2EA 3RK3E 2OTKE 3CL3D 1Q81Q 1PP9J 2QJYC 1QLED 2RH0A 2BCCD 1ZV8A 1QGKB 5KAIH 3Q3DA 3CC7P 3H1HJ 1USDA 4YPCA 1USEA 1OVRA 1O7GA 2OTLP 4HKVA 4I1LA 3KDPB 3BASA 3VTPC 3L70D 3M0DC 2WPVB 3Q2YA 1NTMD 2ZYAA 3KHUA 2NPSD 2QRXA 2KXPB 5CCGA 2O1JA 1SQXK 1KILD 3VMXA 2NUKA 3PRJA 1QL2A 1GW3A 1SLQA 3CWBD 2YIUC 2KNCB 1R8EA 4C7RA 1JMBA 3FX0A 1L4AB 2POHA 5L8RJ 2IYPA 3B5NB 1J1DC 3HE4B 3BCCE 3A7OA 2E75D 4WWIA 5CHXA 2ZYDA 2R3CA 3MP7B 2FXMA 1DIPA 1OX3A 2HMOA 1PP9G 1SQVD 5KJ7A 3BVHA 5AW7B 5KLVG 1N7SC 4WY4A 2HODB 1HJ0A 4HM3A 3HD7C 3WUUA 2KOGA 3H1LG 4EOTA 2OYHA 1DEBA 2DE6D 1HJBA 1S9KD 1GTWA 3MTUE 1FE6A 1H88A 1U7MA 1YHQP 3B5NC 2R32A 1G8JB 3P8CE 1VQ7P 1L2PA 2E75C 5H2FH 3SWYA 4P1CH 3V2QA 1KN7A 2Y0CA 1NU1D 2WSFJ 3L75J 1JCCA 1NHLA 3O6QA 2Q3WA 3VMZA 1Y9BA 3AEFC 1K9MQ 3H1LD 1FDMA 5KLVE 1O7PA 1QVFO 2XDJA 1KB9H 2H88C 3O6QB 4IL6H 1FAVA 3CD6P 5KLVK 5AW5B 2YKOA 3AZCA 2Q3IA 4HM8A 3P8MC 4Y28J 3M91A 3AEEC 3VYIA 1P84H 1FDOA 1FZAA 3L74J 2E75B 3LW5H 1J1EB 3GCEA 2K1AA 2J58A 2DE7D 3AEDC 1NU1J 3RK3B 1PPJG 3SFEC 1VDFA 3L73E 2YVJB 2WSEH 3B5ND 2ZT9B 3VOPA 4DJGA 1FOSF 2A06E 4L75A 3H1JJ 1NTZD 1BCCD 1KB9D 5APUA 3HD7B 3MGNA 5AVRB 2LXCB 2WPSA 1ZLLA 5E79E 1FZBA 2PRRA 3V4QA 2C9NY 1GK6A 1GDTA 2NVFA 5CJ0A 5CCHD 1XTGB 4ZMDA 3B71A 3V2PA 2ZYLA 2ZVOB 3L75E 1LT9A 4UB6E 5AVVB 4P1BH 5TISE 3RL0D 3USSA 3L70E 3EWKA 1GL2C 3CCUP 3AE8C 1X8YA 3BCCD 5B66H 1L0LK 2HODA 4H13B 2ZXXA 2O1KA 4IOIH 1RF1B 3BCCJ 4GKGA 1URQD 5TJHA 2E76C 1NKNA 1PP9E 1PFIA 5AW9B 1GD2E 4D6TE 5AW8B 2AEMA 4WBAA 5AW6B 1KMIZ 5AW1B 4JQ0D 2BCCG 1RE3A 1LTSC 1PGQA 3ABVC 3A3YB 1IJDB 1SP4A 2K9JA 2E74B 1FZCA 2BMRA 5B66E 3GHGB 1L0LG 3BRTB 3MHVA 3U1AA 3G6EP 3CX5D 1M1JA 1W2BO 1N73A 3B8EB 3CC2P 3I55P 4UB6H 3L71G 3CCVP 2N1TA 3JC22 4H13D 1G2CB 3C1LA 5K5GB 1VQ4P 1GL2B 4QUPA 2FKWB 1LTJC 4B86A 4ASVA 4HM1A 2YKPA 4ZNCA 1VQNP 1JB0J 4H44D 2HMLA 1GU4A 4NBCD 2P10A 1KFMA 3CI9A 2ITAA 2LKMA 2L5GB 2JO1A 2RMZA 5KAFH 4K3AA 4PD4H 2QVAA 3H1IJ 5APVA 1VQMP 1JTHB 2Y9YA 3OA7A 3CLQA 1H0TA 4AYCA 2IZ0A 3CX5I 1E79H 4W7ZA 1O7WA 1ZXGA 1MZ9A 4HH2A 4NBBD 1A02F 3RBXA 4D6TD 3V2NA 1K05A 1SQXE 3IF4A 1FJPA 2HLOA 2NRGA 1T3UA 2WZ7A 2GA1A 1NKZB 5AVWB 1ZW0A 1SQPG 3S4RA 1RF0A 3Q5RA 1EC5A 1LP1A 3TGUE 1IFMA 1O7NA 2WQYC 1JCDA 3EQQA 2E74D 2FFDA 1AVOA 1RQUA 3T97A 3N7NA 3P7KA 3F89A 2Z5IA 2WPRA 4KT0J 2QEXP 4YXWH 4JF7A 2OYIC 4XA4A 3GOBA 1ZRTD 2P67A 3L71D 1RIEA 3M0DA 4U3FE 3HE5B 4QUQA 1KFNA 1PV3A 1GU5A 3F5HA 3WUVA 1EDLA 1EXJA 3FWNA 3TDKA 1LWUB 2E5TA 1JO5A 1NTKD 2AXTE 2WSEJ 1KORA 4DT0A 3RL0C 2HR3A 3GB4A 1HWTC 2W6JH 2KZJA 2RKLA 3CCJP 5AEWA 3EQ2A 5AVSB 3FXEA 2QJPC 4CPGA 3DQYA 2M5AB 3A5TA 1QVGO 2FXPA 1LTJA 4ZKPA 1AQTA 3AEBC 4JPZB 1RF1A 1SFCB 2AXCA 1Q86Q 2PFXA 4I2LC 1FBMA 3JCUH 3U59A 3H1ID 5H2FE 1SFCA 3GKEA 1SQPD 3EN1A 3AEAC 1ZP0C 3GHGA 2GM4A 1U7JA 1MV8A 2FBWC 1SQBK 3L4FA 3IAOA 3H1LE 2ZT9D 2E5YA 3U1CA 3TNUA 2SPZA 1M90Q 4NPEA 3TF5A 2FYNC 4YXDC 5GTHE 4HM0A 3Q5PA
chains in the Genus database with same CATH topology
1NTKE 4HM6A 1EG9A 1NTZE 1ULJA 3CX5E 3GOBA 2B24A 1G8JB 2QJYC 1RIEA 4OGQD 4U3FE 2ZYLA 2JO6A 4QUQA 3L75E 1KYOE 2B1XA 4QUPA 5BOKA 1WQLA 3GZXA 4QDFA 3H1KE 4P1BH 4P1CH 1SQPE 4QCKA 3L70E 4HM1A 2Q3WA 3GL2A 1L0NE 4H44D 3D89A 1O7HA 2HMLA 5KLVE 1O7PA 4NBGD 1Q90C 1VF5D 4NBCD 3GTSA 2I7FA 1O7GA 4HKVA 1NTME 3H1JE 4AIVA 4HM7A 1VM9A 4H0LD 3GB4A 3VMHD 3VCAA 1EZVE 4NBHD 4PD4E 2XSHA 4AAYB 5AEWA 1UUWA 4QDFB 3AZCA 2NVGA 3GL0A 4NB8D 1KB9E 4EMJB 5HL4A 1PP9E 2NVEA 4HM8A 5AEUA 2NUKA 4HM4A 4HM5A 5KLIC 1UUVA 2QJPC 5KKZC 3L71E 4D6TE 2HMMA 1SQQE 2YFJA 3DQYA 1NU1E 1SQBE 2FYUE 1BE3E 1P84E 1PPJE 3GCEA 4NBDD 2DE7D 1BCCE 2YIUC 4HM2A 3VCPA 1L0LE 3H1IE 1NDOA 1O7WA 2IBZE 3L73E 2XRXA 2YVJB 2BMOA 2HMJA 3VMGD 1NYKA 2E4QA 2YFLA 2BCCE 4QDDA 1SJGA 1VCKA 4NBBD 3CXHE 2A06E 3BCCE 1RFSA 1SQXE 1ZRTE 2NWFA 2QJKC 1O7MA 1BGYE 3VMID 2E75D 4QURA 2BMRA 2HMNA 3GKEA 4NB9D 3EN1A 3CWBE 4PV1D 2DE5D 2HMOA 2E4PA 1JM1A 2JZAA 3N0QA 5CXMA 3GZYA 3FOUA 4QDCA 4HJLA 2QPZA 1SQVE 3GTEA 3TGUE 2GBWA 3H1HE 2XR8A 2HMKA 4HM3A 1G8KB 3H1LE 2GBXA 2ZT9D 3L74E 2XSOA 1O7NA 3C0DA 3EQQA 2E74D 3L72E 4H13D 2NUMA 2YFIA 4NBED 4NBAD 1FQTA 2BMQA 2DE6D 2FYNC 2E76D 4NBFD 1ULIA 2CKFA 2D2CD 2NVFA 4HM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK E;  4HM6 A;  1EG9 A;  1NTZ E;  1ULJ A;  3CX5 E;  3GOB A;  2B24 A;  1G8J B;  2QJY C;  1RIE A;  4OGQ D;  4U3F E;  2ZYL A;  2JO6 A;  4QUQ A;  3L75 E;  1KYO E;  2B1X A;  4QUP A;  5BOK A;  1WQL A;  3GZX A;  4QDF A;  3H1K E;  4P1B H;  4P1C H;  1SQP E;  4QCK A;  3L70 E;  4HM1 A;  2Q3W A;  3GL2 A;  1L0N E;  4H44 D;  3D89 A;  1O7H A;  2HML A;  5KLV E;  1O7P A;  4NBG D;  1Q90 C;  1VF5 D;  4NBC D;  3GTS A;  2I7F A;  1O7G A;  4HKV A;  1NTM E;  3H1J E;  4AIV A;  4HM7 A;  1VM9 A;  4H0L D;  3GB4 A;  3VMH D;  3VCA A;  1EZV E;  4NBH D;  4PD4 E;  2XSH A;  4AAY B;  5AEW A;  1UUW A;  4QDF B;  3AZC A;  2NVG A;  3GL0 A;  4NB8 D;  1KB9 E;  4EMJ B;  5HL4 A;  1PP9 E;  2NVE A;  4HM8 A;  5AEU A;  2NUK A;  4HM4 A;  4HM5 A;  5KLI C;  1UUV A;  2QJP C;  5KKZ C;  3L71 E;  4D6T E;  2HMM A;  1SQQ E;  2YFJ A;  3DQY A;  1NU1 E;  1SQB E;  2FYU E;  1BE3 E;  1P84 E;  1PPJ E;  3GCE A;  4NBD D;  2DE7 D;  1BCC E;  2YIU C;  4HM2 A;  3VCP A;  1L0L E;  3H1I E;  1NDO A;  1O7W A;  2IBZ E;  3L73 E;  2XRX A;  2YVJ B;  2BMO A;  2HMJ A;  3VMG D;  1NYK A;  2E4Q A;  2YFL A;  2BCC E;  4QDD A;  1SJG A;  1VCK A;  4NBB D;  3CXH E;  2A06 E;  3BCC E;  1RFS A;  1SQX E;  1ZRT E;  2NWF A;  2QJK C;  1O7M A;  1BGY E;  3VMI D;  2E75 D;  4QUR A;  2BMR A;  2HMN A;  3GKE A;  4NB9 D;  3EN1 A;  3CWB E;  4PV1 D;  2DE5 D;  2HMO A;  2E4P A;  1JM1 A;  2JZA A;  3N0Q A;  5CXM A;  3GZY A;  3FOU A;  4QDC A;  4HJL A;  2QPZ A;  1SQV E;  3GTE A;  3TGU E;  2GBW A;  3H1H E;  2XR8 A;  2HMK A;  4HM3 A;  1G8K B;  3H1L E;  2GBX A;  2ZT9 D;  3L74 E;  2XSO A;  1O7N A;  3C0D A;  3EQQ A;  2E74 D;  3L72 E;  4H13 D;  2NUM A;  2YFI A;  4NBE D;  4NBA D;  1FQT A;  2BMQ A;  2DE6 D;  2FYN C;  2E76 D;  4NBF D;  1ULI A;  2CKF A;  2D2C D;  2NVF A;  4HM0 A; 
#chains in the Genus database with same CATH topology
 3E1I A;  1LTG C;  1FZF A;  1L0N K;  2KI7 B;  1IK7 A;  2P58 A;  2FYZ A;  1LTA C;  1JY3 O;  2E42 A;  1WQL A;  2M8R A;  1KQG B;  2CK3 H;  1L0L D;  1P84 I;  3TYY A;  3KZI H;  4NBG D;  2B88 A;  1EXI A;  3EFF K;  2QG4 A;  2YIU B;  3D6Z A;  1VM9 A;  1M1J C;  1N73 C;  3LIE A;  3E7K A;  4EI2 A;  2OYI A;  2Y0E A;  5KKZ C;  5AW0 B;  1SQQ E;  4DZO A;  1JY3 N;  2FYU E;  1MKM A;  2YKQ A;  2KYV A;  4C7N A;  3VCP A;  4NPF X;  1RF1 C;  1KV4 A;  2M5A A;  2LR2 A;  3S1K A;  5APS A;  2BMO A;  2OQQ A;  2E4Q A;  2YFL A;  4M3L A;  1H89 A;  2K3R A;  3AE7 C;  3CXH E;  1YYC A;  2H89 C;  3M9B A;  4TT3 H;  1SFC C;  3VMI D;  1L4A A;  1LJ2 A;  1T3J A;  4JYB A;  2Y9Z A;  2QM8 A;  3HE4 A;  2ZJS E;  2WVR A;  1ZR4 A;  3HRN A;  3MUD C;  2Z5H A;  3H1H E;  1LTI C;  1HGV A;  1KQF B;  1VQO P;  2FYU J;  2V7Q H;  2WSF H;  2NUM A;  2YFI A;  1IK9 A;  4IFM A;  5GTI E;  3QWO C;  2J59 M;  5M1B A;  1EG9 A;  2QIW A;  1VF5 B;  3EFG A;  1IFI A;  1CZQ A;  2P7J A;  1LTB C;  4XFJ A;  5KLV J;  3AE9 C;  3VMA A;  3AE1 C;  3RL0 g;  3MZW B;  1AQ5 A;  1RY3 A;  2N1T D;  2O01 H;  1K04 A;  1DX7 A;  3TGU D;  3FWL A;  4GOD A;  2QSI A;  3C8V A;  1SQP J;  1IFN A;  2FYU G;  1NVO A;  1OXZ A;  2KZI A;  2NVE A;  5APW A;  1N2D C;  4HM5 A;  3NFQ A;  4BRY B;  1SQX D;  3GF3 A;  3L36 A;  1NTZ J;  3H1J D;  1VQ5 P;  1IFJ A;  3AE2 C;  1RHZ B;  2MJZ A;  3L72 J;  4ZKU A;  1BDD A;  4H44 C;  2FYU D;  3A0B H;  1RH5 B;  4H0L B;  1SJG A;  4EIJ A;  3HTK B;  1N7S D;  2YXR B;  2IBZ I;  3AE3 C;  2KSJ A;  1NJI Q;  4GIF A;  2GUV A;  3PJS K;  3FOU A;  4W80 A;  3RL0 B;  2KS1 B;  3BAT A;  1NWQ A;  5B5E H;  4XE5 B;  4NBE D;  3G3Z A;  4WVZ A;  2IBZ G;  3GHG C;  4HYT B;  4OGQ D;  1LT9 C;  2KUB A;  3HUS B;  3H32 A;  5BOK A;  3HD7 A;  3N4X A;  1QL1 A;  1OW7 A;  1LT9 B;  1NU1 K;  1O7H A;  1KZU B;  2NPS C;  2I7F A;  4AIV A;  4H0L D;  1BE3 G;  5DJT B;  3L75 G;  1UUW A;  3CPW O;  1SFC D;  1LTJ B;  4BXL A;  3FXD A;  3PLN A;  4YTP C;  1FZG A;  1URQ C;  1KTM A;  3IN6 A;  4UB8 E;  3Q5S A;  3CCS P;  1BCC E;  1S3J A;  1X22 A;  1RF0 C;  2G3A A;  3CCM P;  3HE5 A;  1OVV A;  2ZAE B;  4Y99 C;  2Q1K A;  1EDI A;  2B87 B;  5CCG C;  1X0T A;  3N0Q A;  1WT6 A;  2QPZ A;  3GTE A;  1HH0 A;  1G1I A;  1VPC A;  1HBW A;  5CMZ A;  1PIX A;  1NAF A;  2WMM A;  1OFC X;  4U7J A;  1JNM A;  2IYO A;  1OW8 A;  1LTT C;  1KIL C;  2WSC H;  3TNU B;  4QDF A;  4JBZ A;  4A7P A;  4NPD A;  2M3E A;  1L0N G;  5AVX B;  4UB8 H;  1Q90 C;  3AE4 C;  4K35 A;  2UWJ E;  3AE5 C;  4HM7 A;  2WPQ A;  1UIX A;  2N9Y B;  4NBH D;  4R4L A;  1OW6 A;  4AAY B;  2Q9I A;  3KYQ A;  3WMM 0;  1HGZ A;  4RKU J;  1AV1 A;  2LXB A;  2ZXE B;  1UUV A;  2WSS H;  1PGJ A;  1GZL A;  3GLM A;  2HMM A;  4PD4 I;  1R5S A;  1SQB E;  1JUN A;  3ZDM A;  1BCC G;  3MD0 A;  4NBD D;  1SQQ J;  1K8A Q;  4Y99 B;  1L0L E;  3CX5 H;  4DOJ A;  2H8P D;  1BSN A;  4N78 D;  1VCK A;  2JWA A;  3VP8 A;  3H25 A;  1NGM B;  1TU3 F;  3BRV B;  1SQQ K;  4PV1 D;  3SFD C;  3CCR P;  2OGU A;  3B5N A;  1BGY D;  2JZA A;  2XNX A;  3V5B A;  5APY A;  1G1J A;  1SQV E;  2O01 J;  5CCH C;  3L73 D;  1LP1 B;  4OVN F;  4NBA D;  2IDB A;  1FQT A;  2L91 A;  3I56 P;  1VQ9 P;  4LC1 A;  1DH3 A;  3WU2 H;  3P8C D;  3K5B A;  2W6A A;  5KTB A;  2AXT H;  3OW2 O;  4WY4 C;  1KYO E;  1VQ6 P;  5EFW B;  3RK2 B;  3B4S A;  4EDF A;  5KLI B;  4H0L C;  4PD4 D;  4GOE A;  2K88 A;  3HD7 D;  1WMK A;  2Y0D A;  2JEE A;  1VF5 D;  3L37 A;  1NTM E;  3UIA A;  3H1J E;  2H43 A;  2I1J A;  2KNC A;  4NB8 D;  5AW2 B;  2IFN A;  3H32 B;  2A45 H;  5GTH H;  3AEC C;  4L74 A;  2M3B A;  1BGY G;  1L0L J;  2KK7 A;  4D6T G;  5GTI H;  2YNY A;  4GDO A;  1BE3 E;  3H1L J;  2PP6 A;  2OYI B;  1CI6 A;  1H0T B;  3NMD A;  3L75 D;  2A45 G;  3S9O A;  1G2C A;  3HTK A;  1VL2 A;  1EZV G;  3GW6 A;  3HUS C;  1NH4 A;  2BCC E;  4BRY A;  2IFM A;  4C46 A;  1LWU C;  1RFS A;  2QJK C;  1BGY E;  3FGA D;  4QUR A;  3V6I A;  1N7S B;  1WRG A;  1SQV K;  1YJW P;  4U3F J;  4QMA A;  2I8D A;  1LGH B;  1KYO D;  1JM1 A;  2E4P A;  3D6Y A;  4QDC A;  4HJL A;  1EZV I;  2IX7 C;  1L0N J;  2PGD A;  2YMK A;  3L74 E;  5BVZ A;  3C0D A;  1SQV J;  4IL6 X;  1JM0 A;  1IFD A;  4GT1 A;  2PAJ A;  3H1K D;  3H1I G;  1W5C E;  3LW5 J;  1SQB D;  3NXS A;  1YQ3 C;  1M1J B;  1N73 B;  1AVY A;  4L76 A;  2B1X A;  1URQ A;  1NO4 A;  3CXH I;  2B89 A;  3L74 G;  2WSC J;  1Q82 Q;  2K9J B;  4IFD K;  1KYO H;  1P84 D;  1MFT A;  1DD3 A;  5CCH A;  2W8Z A;  1VQL P;  3VMH D;  3VCA A;  1QX8 A;  1GL2 D;  2XSH A;  3GMA A;  3VN0 A;  2NVG A;  3V2R A;  2IZ1 A;  1Q90 D;  2O01 N;  4W7Y A;  2QA4 P;  2OYH C;  4U3F G;  5CBN A;  1GK4 A;  3P32 A;  1SS1 A;  1PPJ E;  4AUW A;  2QM7 A;  3W68 A;  1EZV D;  4DCK A;  1NDO A;  3G9R A;  1NYK A;  3R4Y A;  2W90 A;  2N1T C;  4N78 E;  2C0X A;  1SQB G;  2HMN A;  2ZT9 C;  4KHX A;  4Z1M H;  3V4W A;  4U3F D;  2E74 C;  1JOC A;  3D70 A;  1S4X A;  1YJN P;  3CXH D;  3TGU G;  3KZI E;  2JKV A;  3KPE A;  2IBZ D;  2J5U A;  2HPC A;  2FY8 A;  2BEZ F;  5KKZ B;  5KJ7 D;  2AEF A;  3HUS A;  2D2C D;  1NTK E;  1SQP K;  3H6P A;  1JY2 P;  4MN4 C;  2XU6 A;  3OAK A;  1PGP A;  1VQK P;  3M9Q A;  1DEE G;  1J2J B;  2FFD B;  5CCG D;  3H1K G;  1EDJ A;  5TIS H;  1GMJ A;  1NAY A;  2WTY A;  1KB9 I;  5AVT B;  5AW3 B;  2R5D A;  3GTS A;  3CC4 P;  3W67 A;  2YMY A;  3CXH H;  1FZC C;  2ZVN B;  2QJP B;  5BU8 B;  4PD4 E;  5AVZ B;  5AVY B;  2RN0 A;  4EMJ B;  2HPC B;  2M0B A;  1M7L A;  3SSU A;  1R5L A;  1FJK A;  4I7Z C;  3PTZ A;  2JJL A;  4HM2 A;  2KLU A;  2E43 A;  2Q7C A;  2OYH B;  2IBZ E;  4GOF A;  2XRX A;  1NOH A;  3RBZ A;  4I7Z B;  4PJ0 E;  3CCL P;  3SWF A;  2BAS A;  1ZRT E;  1O7M A;  2ZFC A;  4PJ0 H;  1FS0 E;  1Y47 A;  1IC2 A;  3VP9 A;  3TK1 A;  1M57 D;  1JY2 N;  3I5C A;  2XKM A;  5KJ7 C;  2V4H A;  3L72 G;  1FU1 A;  4PV1 B;  1NTK J;  2MKV A;  3CWB G;  2WT7 A;  2XZR A;  2WIT A;  4IL6 E;  3A0H E;  2E76 D;  3O8Z A;  1YQ4 C;  2VRS A;  1RE4 C;  2OTJ P;  1QEX A;  3H1J G;  3CX5 E;  2B24 A;  2HYN A;  2IPP A;  4WB4 A;  1KIL E;  3L71 J;  3MUD A;  1CI6 B;  1YTZ I;  3JSV C;  2XV5 A;  3GZX A;  3H1K E;  1SQP E;  1OVU A;  1NTM J;  2FYU K;  1L0N E;  1E5W A;  1BDC A;  2KB7 P;  2ZYG A;  1LWU A;  1YJ9 P;  3CWB J;  1EZV E;  3CCQ P;  3GL0 A;  1H8A A;  2KLV A;  3L70 G;  1NTM K;  1UII A;  1NYH A;  4HM4 A;  1CW5 A;  3L71 E;  5C39 A;  3TGU J;  1KQS O;  1PP9 D;  2QE7 H;  3JCU E;  2KP8 A;  4R4M A;  1SQX G;  3CME P;  1OMI A;  5APT A;  3TSI A;  1S72 P;  1JTH A;  1X79 B;  1SQX J;  3LID A;  1BE3 D;  1SQQ G;  4I6M C;  3H1H D;  2D2C C;  3M9H A;  1K73 Q;  1YTZ T;  1AA0 A;  2BCC J;  3CWB E;  1Q7Y Q;  5DJU B;  2JWD A;  5CXM A;  1MFZ A;  3R2P A;  3PH0 A;  5AVU B;  2Q3E A;  3RK3 D;  3RK2 C;  2YO3 A;  2GBX A;  2JP3 A;  4OGQ C;  1S1C X;  4WY4 D;  1BCC J;  5BU5 A;  2BMQ A;  3PP5 A;  4KJM A;  1YI2 P;  4ASW A;  3A2A A;  1OZH A;  4EYY Q;  2OAR A;  1BSH A;  3GG2 A;  1L4A C;  2AEJ A;  3G4S P;  2YO2 A;  1T8Z A;  1CSB A;  3GL2 A;  3IFM A;  3AEG C;  2KSE A;  2JDI H;  1DD4 A;  1L4A D;  2YXQ B;  2W27 A;  3KQG A;  4N6J A;  2WT7 B;  1MUU A;  2CPB A;  3KXD A;  3II6 A;  1RE4 A;  4LLH A;  4C7N B;  5KLI C;  3L73 J;  1Y8A A;  1KQL A;  1FC2 C;  3RK2 D;  2I1K A;  2D2C B;  2NPS A;  4H13 C;  5KAI E;  1KIL B;  4D6T J;  2V7Q J;  2BEQ D;  1RQV A;  2KIK A;  5AVQ B;  1JMM A;  1D7M A;  4N3Y B;  3D71 A;  4QDD A;  1YIJ P;  2A06 G;  1W2E A;  2FFD C;  4LGD E;  2NWF A;  1FZE A;  4NB9 D;  2B87 A;  2C0W A;  1J1E C;  1T6A A;  4OH8 B;  1NTZ G;  2GUS A;  3QH9 A;  1SQQ D;  4RO0 A;  1FDI A;  2P1J A;  3C9I A;  3L35 A;  2FYN B;  3NTN A;  3CMA P;  1NTM G;  2XSO A;  2WWW A;  2B9B A;  1JY3 P;  3L72 E;  3M0A A;  3A0H H;  2Q5U A;  1KYO I;  3MIW A;  1RE3 C;  1M56 D;  1IFP A;  1NTZ E;  1M8O B;  1ZME C;  1XTC C;  1N8R Q;  2CPS A;  1HVV A;  2JO6 A;  3WU2 E;  1Q2N A;  2E76 B;  1ZOY C;  1VF5 C;  1SQB J;  3M06 A;  3GF7 A;  3L73 G;  1VQP P;  1Z56 A;  2W6B A;  2O3J A;  4O9B A;  2K37 A;  1HF9 A;  2Q6Q A;  1OIP A;  1ZR2 A;  1L0N D;  1HTL C;  1SVF A;  1KIL A;  1HUC A;  3VMY A;  4HB1 A;  1U57 A;  1KB9 E;  5AEU A;  5KLV D;  2N1T B;  1S5L X;  1BE3 J;  1VQ8 P;  2A45 I;  2QJK B;  3AE6 C;  4BWN A;  1NTK G;  2YFJ A;  1NU1 E;  3IR9 A;  1N86 A;  2R3S A;  4H44 B;  1AFO A;  1KD1 Q;  3H1I E;  1A02 J;  4WY4 B;  3Q1M A;  1GW4 A;  5APQ A;  5KAF E;  1SQV G;  1EQ7 A;  1YIT P;  3G71 P;  5CBO A;  1S5L E;  1NU1 G;  1FOS E;  4L73 A;  4HKZ H;  2P2U A;  1X9V A;  3E1R A;  1IO4 A;  2Z4E A;  1JY2 O;  1N7L A;  3H1H G;  3GZY A;  4JYC A;  3A0B E;  4RJT A;  5CJ4 A;  2A06 D;  2GBW A;  2G8Y A;  3OJA B;  2XR8 A;  2HMK A;  1G8K B;  2NZ2 A;  4RES B;  1M1K Q;  2NPS B;  2XND H;  5AW4 B;  4NBF D;  1ULI A;  2CKF A;  4OWF A;  1IZN B;  4HM6 A;  1T2K C;  3RK3 C;  1ULJ A;  5B5E E;  1PZQ A;  3SWK A;  3CCE P;  1S9K E;  1PPJ D;  3PHL A;  4QCK A;  4PV1 C;  3T97 B;  1NTK K;  2QJY B;  2HFE D;  2JR8 A;  4IFF A;  3D89 A;  2W83 C;  3H1K J;  1NTZ K;  2H7H A;  4TLF A;  2OYO A;  1LT1 A;  1JEK A;  4QDF B;  1YBK A;  1BGY J;  5HL4 A;  1PGO A;  2FXO A;  4OGQ B;  1T2K D;  1KC8 Q;  1P84 E;  2C9L Y;  2DW3 A;  1J1D B;  1GL2 A;  4HJG H;  4AQR D;  1PL5 A;  2HMJ A;  3VMG D;  1OWA A;  2HG5 D;  3ITK A;  1N7S A;  1LNQ A;  1S5L H;  3L74 D;  3BCC G;  3WUT A;  2DE5 D;  1ZN5 A;  1FZC B;  3L72 D;  1URQ B;  2N9B A;  3L70 J;  2R44 A;  2R5B A;  2KS1 A;  2K9Y A;  5E79 H;  1EDK A;  1AJY A;  3RGU A;  5APX A;  1S2E A;  3RK3 E;  2OTK E;  3CL3 D;  1Q81 Q;  1PP9 J;  2QJY C;  1QLE D;  2RH0 A;  2BCC D;  1ZV8 A;  1QGK B;  5KAI H;  3Q3D A;  3CC7 P;  3H1H J;  1USD A;  4YPC A;  1USE A;  1OVR A;  1O7G A;  2OTL P;  4HKV A;  4I1L A;  3KDP B;  3BAS A;  3VTP C;  3L70 D;  3M0D C;  2WPV B;  3Q2Y A;  1NTM D;  2ZYA A;  3KHU A;  2NPS D;  2QRX A;  2KXP B;  5CCG A;  2O1J A;  1SQX K;  1KIL D;  3VMX A;  2NUK A;  3PRJ A;  1QL2 A;  1GW3 A;  1SLQ A;  3CWB D;  2YIU C;  2KNC B;  1R8E A;  4C7R A;  1JMB A;  3FX0 A;  1L4A B;  2POH A;  5L8R J;  2IYP A;  3B5N B;  1J1D C;  3HE4 B;  3BCC E;  3A7O A;  2E75 D;  4WWI A;  5CHX A;  2ZYD A;  2R3C A;  3MP7 B;  2FXM A;  1DIP A;  1OX3 A;  2HMO A;  1PP9 G;  1SQV D;  5KJ7 A;  3BVH A;  5AW7 B;  5KLV G;  1N7S C;  4WY4 A;  2HOD B;  1HJ0 A;  4HM3 A;  3HD7 C;  3WUU A;  2KOG A;  3H1L G;  4EOT A;  2OYH A;  1DEB A;  2DE6 D;  1HJB A;  1S9K D;  1GTW A;  3MTU E;  1FE6 A;  1H88 A;  1U7M A;  1YHQ P;  3B5N C;  2R32 A;  1G8J B;  3P8C E;  1VQ7 P;  1L2P A;  2E75 C;  5H2F H;  3SWY A;  4P1C H;  3V2Q A;  1KN7 A;  2Y0C A;  1NU1 D;  2WSF J;  3L75 J;  1JCC A;  1NHL A;  3O6Q A;  2Q3W A;  3VMZ A;  1Y9B A;  3AEF C;  1K9M Q;  3H1L D;  1FDM A;  5KLV E;  1O7P A;  1QVF O;  2XDJ A;  1KB9 H;  2H88 C;  3O6Q B;  4IL6 H;  1FAV A;  3CD6 P;  5KLV K;  5AW5 B;  2YKO A;  3AZC A;  2Q3I A;  4HM8 A;  3P8M C;  4Y28 J;  3M91 A;  3AEE C;  3VYI A;  1P84 H;  1FDO A;  1FZA A;  3L74 J;  2E75 B;  3LW5 H;  1J1E B;  3GCE A;  2K1A A;  2J58 A;  2DE7 D;  3AED C;  1NU1 J;  3RK3 B;  1PPJ G;  3SFE C;  1VDF A;  3L73 E;  2YVJ B;  2WSE H;  3B5N D;  2ZT9 B;  3VOP A;  4DJG A;  1FOS F;  2A06 E;  4L75 A;  3H1J J;  1NTZ D;  1BCC D;  1KB9 D;  5APU A;  3HD7 B;  3MGN A;  5AVR B;  2LXC B;  2WPS A;  1ZLL A;  5E79 E;  1FZB A;  2PRR A;  3V4Q A;  2C9N Y;  1GK6 A;  1GDT A;  2NVF A;  5CJ0 A;  5CCH D;  1XTG B;  4ZMD A;  3B71 A;  3V2P A;  2ZYL A;  2ZVO B;  3L75 E;  1LT9 A;  4UB6 E;  5AVV B;  4P1B H;  5TIS E;  3RL0 D;  3USS A;  3L70 E;  3EWK A;  1GL2 C;  3CCU P;  3AE8 C;  1X8Y A;  3BCC D;  5B66 H;  1L0L K;  2HOD A;  4H13 B;  2ZXX A;  2O1K A;  4IOI H;  1RF1 B;  3BCC J;  4GKG A;  1URQ D;  5TJH A;  2E76 C;  1NKN A;  1PP9 E;  1PFI A;  5AW9 B;  1GD2 E;  4D6T E;  5AW8 B;  2AEM A;  4WBA A;  5AW6 B;  1KMI Z;  5AW1 B;  4JQ0 D;  2BCC G;  1RE3 A;  1LTS C;  1PGQ A;  3ABV C;  3A3Y B;  1IJD B;  1SP4 A;  2K9J A;  2E74 B;  1FZC A;  2BMR A;  5B66 E;  3GHG B;  1L0L G;  3BRT B;  3MHV A;  3U1A A;  3G6E P;  3CX5 D;  1M1J A;  1W2B O;  1N73 A;  3B8E B;  3CC2 P;  3I55 P;  4UB6 H;  3L71 G;  3CCV P;  2N1T A;  3JC2 2;  4H13 D;  1G2C B;  3C1L A;  5K5G B;  1VQ4 P;  1GL2 B;  4QUP A;  2FKW B;  1LTJ C;  4B86 A;  4ASV A;  4HM1 A;  2YKP A;  4ZNC A;  1VQN P;  1JB0 J;  4H44 D;  2HML A;  1GU4 A;  4NBC D;  2P10 A;  1KFM A;  3CI9 A;  2ITA A;  2LKM A;  2L5G B;  2JO1 A;  2RMZ A;  5KAF H;  4K3A A;  4PD4 H;  2QVA A;  3H1I J;  5APV A;  1VQM P;  1JTH B;  2Y9Y A;  3OA7 A;  3CLQ A;  1H0T A;  4AYC A;  2IZ0 A;  3CX5 I;  1E79 H;  4W7Z A;  1O7W A;  1ZXG A;  1MZ9 A;  4HH2 A;  4NBB D;  1A02 F;  3RBX A;  4D6T D;  3V2N A;  1K05 A;  1SQX E;  3IF4 A;  1FJP A;  2HLO A;  2NRG A;  1T3U A;  2WZ7 A;  2GA1 A;  1NKZ B;  5AVW B;  1ZW0 A;  1SQP G;  3S4R A;  1RF0 A;  3Q5R A;  1EC5 A;  1LP1 A;  3TGU E;  1IFM A;  1O7N A;  2WQY C;  1JCD A;  3EQQ A;  2E74 D;  2FFD A;  1AVO A;  1RQU A;  3T97 A;  3N7N A;  3P7K A;  3F89 A;  2Z5I A;  2WPR A;  4KT0 J;  2QEX P;  4YXW H;  4JF7 A;  2OYI C;  4XA4 A;  3GOB A;  1ZRT D;  2P67 A;  3L71 D;  1RIE A;  3M0D A;  4U3F E;  3HE5 B;  4QUQ A;  1KFN A;  1PV3 A;  1GU5 A;  3F5H A;  3WUV A;  1EDL A;  1EXJ A;  3FWN A;  3TDK A;  1LWU B;  2E5T A;  1JO5 A;  1NTK D;  2AXT E;  2WSE J;  1KOR A;  4DT0 A;  3RL0 C;  2HR3 A;  3GB4 A;  1HWT C;  2W6J H;  2KZJ A;  2RKL A;  3CCJ P;  5AEW A;  3EQ2 A;  5AVS B;  3FXE A;  2QJP C;  4CPG A;  3DQY A;  2M5A B;  3A5T A;  1QVG O;  2FXP A;  1LTJ A;  4ZKP A;  1AQT A;  3AEB C;  4JPZ B;  1RF1 A;  1SFC B;  2AXC A;  1Q86 Q;  2PFX A;  4I2L C;  1FBM A;  3JCU H;  3U59 A;  3H1I D;  5H2F E;  1SFC A;  3GKE A;  1SQP D;  3EN1 A;  3AEA C;  1ZP0 C;  3GHG A;  2GM4 A;  1U7J A;  1MV8 A;  2FBW C;  1SQB K;  3L4F A;  3IAO A;  3H1L E;  2ZT9 D;  2E5Y A;  3U1C A;  3TNU A;  2SPZ A;  1M90 Q;  4NPE A;  3TF5 A;  2FYN C;  4YXD C;  5GTH E;  4HM0 A;  3Q5P A; 
#chains in the Genus database with same CATH homology
 1NTK E;  4HM6 A;  1EG9 A;  1NTZ E;  1ULJ A;  3CX5 E;  3GOB A;  2B24 A;  1G8J B;  2QJY C;  1RIE A;  4OGQ D;  4U3F E;  2ZYL A;  2JO6 A;  4QUQ A;  3L75 E;  1KYO E;  2B1X A;  4QUP A;  5BOK A;  1WQL A;  3GZX A;  4QDF A;  3H1K E;  4P1B H;  4P1C H;  1SQP E;  4QCK A;  3L70 E;  4HM1 A;  2Q3W A;  3GL2 A;  1L0N E;  4H44 D;  3D89 A;  1O7H A;  2HML A;  5KLV E;  1O7P A;  4NBG D;  1Q90 C;  1VF5 D;  4NBC D;  3GTS A;  2I7F A;  1O7G A;  4HKV A;  1NTM E;  3H1J E;  4AIV A;  4HM7 A;  1VM9 A;  4H0L D;  3GB4 A;  3VMH D;  3VCA A;  1EZV E;  4NBH D;  4PD4 E;  2XSH A;  4AAY B;  5AEW A;  1UUW A;  4QDF B;  3AZC A;  2NVG A;  3GL0 A;  4NB8 D;  1KB9 E;  4EMJ B;  5HL4 A;  1PP9 E;  2NVE A;  4HM8 A;  5AEU A;  2NUK A;  4HM4 A;  4HM5 A;  5KLI C;  1UUV A;  2QJP C;  5KKZ C;  3L71 E;  4D6T E;  2HMM A;  1SQQ E;  2YFJ A;  3DQY A;  1NU1 E;  1SQB E;  2FYU E;  1BE3 E;  1P84 E;  1PPJ E;  3GCE A;  4NBD D;  2DE7 D;  1BCC E;  2YIU C;  4HM2 A;  3VCP A;  1L0L E;  3H1I E;  1NDO A;  1O7W A;  2IBZ E;  3L73 E;  2XRX A;  2YVJ B;  2BMO A;  2HMJ A;  3VMG D;  1NYK A;  2E4Q A;  2YFL A;  2BCC E;  4QDD A;  1SJG A;  1VCK A;  4NBB D;  3CXH E;  2A06 E;  3BCC E;  1RFS A;  1SQX E;  1ZRT E;  2NWF A;  2QJK C;  1O7M A;  1BGY E;  3VMI D;  2E75 D;  4QUR A;  2BMR A;  2HMN A;  3GKE A;  4NB9 D;  3EN1 A;  3CWB E;  4PV1 D;  2DE5 D;  2HMO A;  2E4P A;  1JM1 A;  2JZA A;  3N0Q A;  5CXM A;  3GZY A;  3FOU A;  4QDC A;  4HJL A;  2QPZ A;  1SQV E;  3GTE A;  3TGU E;  2GBW A;  3H1H E;  2XR8 A;  2HMK A;  4HM3 A;  1G8K B;  3H1L E;  2GBX A;  2ZT9 D;  3L74 E;  2XSO A;  1O7N A;  3C0D A;  3EQQ A;  2E74 D;  3L72 E;  4H13 D;  2NUM A;  2YFI A;  4NBE D;  4NBA D;  1FQT A;  2BMQ A;  2DE6 D;  2FYN C;  2E76 D;  4NBF D;  1ULI A;  2CKF A;  2D2C D;  2NVF A;  4HM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...