3H1IE

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 45
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1iE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1iE02
4HM4A 4QURA 4U3FE 4NBGD 5BOKA 5HL4A 1G8KB 2QJPC 1SQVE 1SQBE 3TGUE 4QDFB 3H1LE 2QPZA 4D6TE 1O7MA 1G8JB 5AEUA 1SQQE 4NBDD 5CXMA 1L0NE 3L72E 3GL2A 4QUQA 2B1XA 3VMGD 1P84E 4NB9D 1L0LE 1VM9A 2NUKA 2BMRA 1VF5D 1UUVA 2XRXA 3CX5E 1FQTA 1O7HA 4NBBD 5KKZC 2I7FA 1PPJE 2HMJA 2A06E 4HKVA 1O7PA 1BCCE 4HM1A 3L74E 1WQLA 4PV1D 2GBXA 3L75E 3H1IE 1RIEA 1NTZE 2DE6D 2NWFA 4HM3A 4HM6A 1EG9A 3DQYA 3D89A 3GTSA 1BE3E 3L71E 1SQXE 2QJYC 2ZT9D 4NBCD 3VMID 2E74D 1SJGA 1BGYE 4HM8A 1NTKE 3AZCA 3GL0A 2HMOA 3H1KE 2FYNC 4HJLA 1O7GA 4H0LD 2HMKA 4H13D 4HM0A 1EZVE 1KB9E 2NVFA 3EQQA 2HMNA 3BCCE 2HMMA 1O7NA 2YIUC 2YVJB 4P1CH 2ZYLA 4HM5A 2Q3WA 4AAYB 3GCEA 2NVEA 1NU1E 4EMJB 4QDFA 3GTEA 5KLVE 1NDOA 4NB8D 3GZYA 4QCKA 4NBFD 2D2CD 2DE5D 3VMHD 3GKEA 2XSOA 1KYOE 4QDDA 3H1HE 2CKFA 1O7WA 2XR8A 3L70E 2YFLA 2E4PA 3EN1A 4P1BH 3C0DA 1UUWA 2BMOA 2E76D 3VCAA 2HMLA 3FOUA 4H44D 1NYKA 3CXHE 2JO6A 2YFIA 4HM7A 4QDCA 5AEWA 3N0QA 2E75D 2B24A 2NVGA 5KLIC 1ZRTE 2DE7D 4PD4E 1RFSA 3VCPA 1ULJA 3GOBA 1SQPE 3GZXA 4QUPA 3H1JE 4NBAD 1VCKA 2NUMA 2E4QA 4NBED 1PP9E 1NTME 3CWBE 1JM1A 2GBWA 2JZAA 4OGQD 2FYUE 2BMQA 2BCCE 4NBHD 1Q90C 2QJKC 2YFJA 1ULIA 2IBZE 3L73E 3GB4A 4HM2A 4AIVA 2XSHA
chains in the Genus database with same CATH superfamily
1YTZI 1N7SC 3M06A 3OAKA 3S4RA 1J1EB 1G8JB 3H32A 5BU5A 2Z5HA 1JTHB 1KC8Q 1MFTA 3FX0A 1VQ7P 2ZT9C 1O7HA 4O9BA 3M0DA 5APUA 1N73B 3HE4A 3I55P 3H1KJ 2ZJSE 3GF3A 3A0BH 2B87A 3SFDC 1GL2B 4NBCD 1NTZG 5E79H 1HF9A 1SJGA 3ZDMA 2NPSC 3PJSK 2YO2A 1S4XA 1S5LH 2JO1A 4I6MC 3D6YA 2FYNB 2Q3IA 1NU1E 1Y47A 1BDDA 3WU2E 1HWTC 1E79H 4PD4D 1ZR2A 3NMDA 5APTA 3A0HE 2JO6A 2FYUJ 2YFIA 1M8OB 2IZ0A 1RFSA 2JP3A 4L73A 3TK1A 1N2DC 3L73D 5APQA 2JZAA 1JUNA 1LWUA 3H1JG 3S1KA 2KNCA 4D6TJ 1KILD 3CWBG 1FZGA 3CC2P 2JDIH 2OARA 1M1JC 2QJKB 1QLED 1SQBE 1MV8A 3KPEA 3TNUA 4GOEA 1JNMA 3CXHI 5TJHA 3L72E 2YXQB 3W67A 3IAOA 1BE3G 3CXHH 1JMBA 1FDOA 2N1TD 1T3JA 3CX5E 3IFMA 1NTZK 1Z56A 3RK3E 2HODA 2KOGA 3SWYA 1YBKA 1H88A 2Y0DA 4A7PA 2OYIC 4PJ0H 1KILA 1DD3A 5M1BA 4H0LB 3HRNA 3ABVC 1NTKE 3BCCD 1KMIZ 3EQ2A 4HJLA 4DZOA 4H13D 1CSBA 1EZVE 4I1LA 2JKVA 1O7NA 2YIUC 3H25A 4AAYB 4KJMA 1LTSC 3RBXA 1G2CB 3GKEA 3IF4A 3T97A 2N1TA 2CKFA 2ITAA 3RL0g 3I5CA 1PP9J 3H1HG 2HMLA 4GIFA 4EIJA 2PP6A 2R32A 4WY4B 2DE7D 5APVA 1FZCA 4NBAD 2ZYDA 1Q7YQ 1KV4A 3FXDA 1R5SA 5KAIE 4NBGD 4AQRD 1G1IA 4BRYA 4L76A 3AEBC 3MUDA 3OJAB 1AV1A 3C8VA 2WWWA 1RF1A 2QRXA 2B1XA 4B86A 1AQTA 1HTLC 2K88A 2BMRA 1VQPP 1YJWP 1L0LG 5KKZC 3IR9A 1FAVA 3AE5C 1PL5A 2P7JA 1KYOH 1ZP0C 1RQVA 3L4FA 2LR2A 1S1CX 1AVYA 4DT0A 5AVQB 1LTJA 1FU1A 3A5TA 5AW9B 3L70G 1NU1D 5AVVB 4PV1B 1OWAA 4EYYQ 4LLHA 1SFCD 2A45G 3NTNA 3BCCG 2XU6A 4H0LC 1BGYD 5L8RJ 4R4LA 3CCRP 2I1KA 2PAJA 4GOFA 2KK7A 2KZIA 1NYKA 3HUSC 3N0QA 2K9JB 3CD6P 2KSJA 1PIXA 2IDBA 1ZR4A 1VCKA 5KJ7D 4U3FJ 1EQ7A 1K9MQ 3CLQA 1JM1A 1LT9C 3H1IJ 2BCCE 3Q2YA 1PGOA 3HD7A 3L71J 1ZW0A 1SFCA 4UB6E 4WVZA 4M3LA 4WB4A 2IBZG 2W6JH 5HL4A 3VP8A 1SQQE 3R4YA 4Y28J 2ZVNB 2E5TA 3CX5D 2OTKE 1P84E 1J2JB 2G3AA 3RK3D 2KSEA 1OVVA 4IL6E 4PD4H 2OYHC 3CMEP 1LTBC 2Q1KA 3G9RA 1FS0E 2QEXP 1AJYA 5KJ7A 1O7PA 4MN4C 1N7LA 3W68A 3PP5A 1DD4A 2GBXA 3A3YB 1NTKD 1EG9A 3DQYA 1BE3E 2KLVA 3MHVA 5AW8B 1KQLA 1HVVA 3BATA 1WMKA 4Y99B 2HMKA 1K05A 2CK3H 4P1CH 3GZYA 4WY4D 5B5EE 1VQNP 3NFQA 2DE5D 2P67A 4EDFA 3EFGA 2K3RA 5CCGD 2WPQA 3N4XA 4UB8H 4GKGA 4N6JA 2SPZA 5KLIC 4IFMA 3B5NC 2A45I 4NBED 3AE7C 1OW6A 2GBWA 2O1JA 2Q3EA 2FFDA 1N8RQ 2E75B 2IZ1A 3PHLA 2QA4P 3L36A 3AE4C 1NWQA 1G8KB 1NKNA 3RK2D 2LXCB 4U7JA 2YMYA 1N7SB 1SQBG 1LWUB 5CCGA 2AEFA 5GTHE 1EDLA 4LC1A 2KZJA 2Y9ZA 1Q81Q 1HH0A 3L72G 3OW2O 1L4AA 1FQTA 2Y0CA 2E74C 1T2KD 2J5UA 2WMMA 1A02F 2ZT9B 4HM1A 2IBZI 1RF0A 4PV1D 2O3JA 2Y0EA 5TISH 3D89A 1YTZT 2PGDA 3CMAP 3V4WA 1LGHB 3GL0A 1M7LA 1OMIA 1NU1K 1USEA 1NTKG 4GT1A 3L73J 1EZVG 5AW0B 1LP1A 1LTAC 3V2QA 3SWFA 3M0DC 2XNXA 4QDDA 2KB7P 1HJBA 3L70E 1RE4A 2FBWC 4RKUJ 5CCHC 2CPSA 4H44D 2V4HA 3G6EP 3VMYA 2P58A 2HPCA 2NUMA 1VQMP 1S72P 2R3SA 1RQUA 2HR3A 3H6PA 2P1JA 1URQB 2JWDA 1USDA 1ULIA 3LW5H 3V2RA 1SQBK 1ZRTD 2E43A 3BRVB 5CMZA 3GLMA 2C0WA 3CWBD 3WU2H 3KZIE 1P84D 3H1LE 3CCQP 1MZ9A 1KQFB 1BCCG 1KQGB 3II6A 1M1JB 3O8ZA 3GW6A 3A0HH 1SQXG 1EC5A 3P8CE 2Q5UA 1L2PA 1BE3D 2OYOA 4WBAA 1LWUC 1W5CE 1EDJA 1NTKK 2NWFA 4OH8B 1QL2A 2IYPA 1FOSF 5KLVG 1H0TA 5AVYB 4HM8A 2OYIB 1U7JA 3BRTB 3H1KE 1X8YA 1HUCA 2NVFA 1IFNA 1OW7A 1GU4A 4HM5A 1IFMA 5AVRB 1GZLA 2IFMA 1JY3P 3CX5I 1GMJA 2YIUB 4I7ZC 3AE1C 1YJNP 4XA4A 2E76B 1LTJB 2ZXEB 3CX5H 2WSSH 1OVRA 4IL6X 4HM7A 1KILC 2E75D 4YTPC 2YKQA 3JCUH 5H2FE 5AW1B 2BASA 2J59M 1EZVI 1Q90D 3AE8C 3H1HD 1E5WA 3QWOC 4OGQD 2FYUE 1L0NG 2BMQA 1BSHA 1N7SD 1OVUA 2L5GB 2BCCG 1FOSE 3E1RA 4AIVA 3KHUA 3GHGA 5BOKA 1DX7A 4D6TE 4CPGA 1O7MA 1URQC 1Y9BA 2YKOA 3QH9A 3LW5J 1NO4A 1BSNA 1NU1J 1SQQG 3L75J 1OZHA 1NOHA 2QJYB 1FZCC 1VF5D 1BGYJ 4ZKUA 3L74E 5KKZB 2NPSD 2N9YB 2DE6D 3VMAA 1L0LD 1EXIA 3GTSA 2R3CA 2XZRA 4LGDE 1OIPA 3UIAA 5KAIH 2ZAEB 2WSEH 3MUDC 4ZNCA 1LTTC 1DH3A 1OW8A 1RF1C 4IFDK 2K37A 3L70D 5APWA 1YJ9P 1JY3O 1H89A 5GTIH 3V2NA 2CPBA 3P32A 3FWLA 1NTMJ 5E79E 2KS1B 3B4SA 1X0TA 2I1JA 2NPSA 3GF7A 1S5LE 5APSA 2WT7B 2E76C 1LTJC 1SQPE 3HUSB 5APYA 1PP9E 1JOCA 2KP8A 1SQVJ 3TGUJ 4C46A 2H88C 5CBOA 2YFJA 1OX3A 4C7NB 1LT9B 3MP7B 3A7OA 3V6IA 1SQQK 4QDFB 3HE5A 1PGQA 3P8CD 4R4MA 1RE3A 2IBZD 3HTKA 4QUQA 1K04A 3Q1MA 2QM8A 1VPCA 2M5AB 2J58A 1FBMA 3U1AA 4ZKPA 5KAFH 1BCCE 2OYHB 3AEGC 2KIKA 3HD7C 3H1KD 1SFCC 1SQXE 2QJYC 2NRGA 4UB6H 3VMID 1FJPA 4YXDC 1IK9A 1GL2D 1PV3A 1FDIA 1KD1Q 1P84I 3RL0C 1W2EA 1QL1A 1J1DC 1LTIC 1P84H 5KLVE 2W8ZA 4QCKA 2WITA 4IL6H 3B71A 2WSEJ 3G3ZA 1JTHA 1O7WA 1IFDA 2XR8A 1PGJA 5KJ7C 1VQ9P 2MJZA 3USSA 1XTCC 1N73A 5AEWA 2B24A 2NVGA 2FYUD 2JEEA 1EXJA 1Q2NA 5KLIB 1FC2C 4KT0J 1GL2A 3B5NB 3O6QB 2WPVB 3RBZA 4NPDA 1IFIA 4IOIH 3MTUE 4DOJA 1T6AA 4U3FE 1Q86Q 3CC7P 2QPZA 2WSFH 4JQ0D 4NBDD 3LIDA 3CCUP 1L0NE 5CJ0A 2QIWA 3H1LG 1IC2A 1LT1A 1NTZJ 3L74D 3P8MC 4W80A 1SQBD 3V4QA 4NBBD 2L91A 1UIXA 1PPJE 2Q9IA 2E5YA 4NPFX 1VDFA 3L72D 3Q5RA 2E74B 2FY8A 1JY2P 1L0LK 4BWNA 1ZMEC 2GA1A 3L35A 2YMKA 1O7GA 4H0LD 2WZ7A 1KB9E 1HBWA 3H1KG 3EQQA 2WTYA 2HMMA 2D2CB 5CCGC 3VTPC 2IPPA 3GCEA 2JR8A 3H32B 1GD2E 5B66E 3NXSA 1L4AC 1VQ8P 2H43A 3AEDC 3N7NA 2XNDH 4L75A 1KYOE 3AEFC 1EZVD 3H1JJ 1GK4A 1UUWA 1ZN5A 1YITP 1SS1A 3CWBJ 1SQPD 3HE4B 5AVXB 2XDJA 2B87B 4L74A 2AXCA 1IO4A 3VMXA 1CI6A 3CI9A 3G71P 3OA7A 2O1KA 5CBNA 1BE3J 2RN0A 2FYUG 4HM4A 1FZBA 1T2KC 1RE4C 4YPCA 4D6TG 3GL2A 1R8EA 1G2CA 5EFWB 2A45H 1MFZA 1RH5B 3M0AA 3JSVC 1VM9A 4QMAA 1BCCD 2M3BA 2WSFJ 2V7QH 1NKZB 1SQXD 1X79B 1QGKB 1X22A 4WY4A 2Y9YA 1GDTA 3FWNA 4GODA 1YHQP 1PZQA 3L74G 1T8ZA 1JY2O 2M8RA 2KNCB 5BU8B 2HMOA 3KZIH 5KLVD 1OFCX 3H1HJ 2HMNA 2WQYC 1KZUB 2OTJP 2YKPA 3D71A 1AVOA 3TNUB 4H44C 4NB8D 1M56D 1LJ2A 2AXTH 5DJTB 3M9HA 4IFFA 1Q82Q 3AECC 2O01H 4BXLA 2D2CC 4I7ZB 5AVWB 2H7HA 3B5ND 2K1AA 1KILE 1CW5A 2HODB 3CPWO 1VQOP 1KQSO 3VCPA 5C39A 2FYUK 2M3EA 1SP4A 1KILB 1SQPG 3BVHA 1PP9G 4U3FD 2FXOA 1VQKP 4HM2A 1K8AQ 2XSHA 5AW6B 1PFIA 1L0LJ 1L0ND 2QJPC 2ZYAA 4N78E 3AEEC 1G1JA 1FZAA 2BCCD 3T97B 2Q6QA 2N1TB 1U7MA 4HYTB 1QVFO 2HFED 5H2FH 1JEKA 1WRGA 3GG2A 4HB1A 3L70J 4OVNF 1SQQD 1FZCB 2K9JA 1CZQA 4W7YA 4HM3A 3BCCJ 3E1IA 1JY3N 4W7ZA 3C1LA 2GUSA 1KB9D 3GHGC 2V7QJ 1QVGO 3KDPB 2PRRA 3Q3DA 1SVFA 3PH0A 2MKVA 2B9BA 3F89A 5AW3B 3VOPA 4BRYB 1NAYA 2NVEA 1ZOYC 2KXPB 1AQ5A 5CCHD 1RF1B 1NH4A 1VQLP 1PGPA 2YFLA 2Z4EA 5AW7B 3VCAA 1IK7A 2JJLA 1SQPK 3VP9A 1D7MA 2K9YA 3IN6A 3CL3D 3B8EB 5AVUB 3GZXA 1GU5A 1KORA 2O01J 1W2BO 3V5BA 2WSCH 4RO0A 2M0BA 3GB4A 3KYQA 5CCHA 5KTBA 5K5GB 1VF5C 2ZXXA 3PRJA 4HKZH 4U3FG 1KFMA 5AEUA 5AW2B 5CHXA 1YI2P 3H1IG 1JO5A 3L71G 3A2AA 2NZ2A 2QSIA 1UUVA 4OWFA 5AW5B 5AW4B 2I7FA 2C0XA 2LKMA 3M91A 2A06E 4HKVA 1SQXK 3MGNA 2KLUA 3TYYA 3PTZA 2W6BA 3L75E 2N1TC 1PPJG 4DCKA 2XV5A 2RH0A 2ZT9D 3ITKA 1BGYE 3HD7B 3KXDA 1SFCB 1JB0J 1AA0A 5KLVK 1RE3C 2IFNA 4TT3H 1UIIA 1IFPA 4GDOA 2YO3A 4H13C 2QG4A 1JM0A 3RL0B 1N7SA 3CCEP 3P7KA 1J1DB 3TSIA 1AFOA 3MZWB 4P1BH 1FZEA 5APXA 3R2PA 3FOUA 1WT6A 5AVTB 1GTWA 3L37A 4QDCA 2AEMA 3TF5A 3CCSP 1ULJA 2KUBA 3GOBA 1NTME 3L74J 1SQBJ 3A0BE 2Z5IA 4NBHD 3LIEA 1NYHA 1YYCA 1J1EC 4N78D 3L72J 1FZFA 1URQD 1L0NK 3WUUA 2ZVOB 1SQVE 3TGUE 3Q5SA 1YQ4C 1S9KE 1CI6B 2WVRA 3JCUE 3RK3B 5CXMA 2WSCJ 3EFFK 1VQ6P 4NB9D 1N73C 2XKMA 3I56P 3JC22 4DJGA 1FJKA 4K3AA 3H1LD 4NPEA 2GUVA 1NTKJ 1GL2C 1WQLA 2DW3A 4JPZB 1MKMA 1NJIQ 2HG5D 1YQ3C 1IFJA 1SQPJ 2FFDB 1URQA 1KN7A 2C9LY 2FYNC 4HM0A 2YXRB 2YNYA 4I2LC 2W90A 4EMJB 1RHZB 1SLQA 5AVZB 1M1JA 3VMHD 2W83C 2QVAA 4HH2A 1JCDA 1L4AB 1R5LA 3MD0A 1YIJP 2E76D 1NVOA 1IJDB 2AEJA 3CXHE 3L73G 3VN0A 3FGAD 1HJ0A 1KB9I 1BCCJ 1ZV8A 1KB9H 3SSUA 3MIWA 1KFNA 1M57D 2I8DA 2QJKC 4PJ0E 3S9OA 1H8AA 2OYIA 5GTIE 1SQXJ 2LXBA 4C7RA 3RK2B 3RGUA 1KYOI 5B66H 3WMM0 1LP1B 3AE9C 3CC4P 3KQGA 2H8PD 3AE3C 4AUWA 3VMGD 1JY2N 4JYCA 5KLVJ 1U57A 5BVZA 2A06D 4RJTA 3L75D 3HD7D 4EI2A 4D6TD 2Q7CA 1QEXA 2HMJA 3RK3C 5B5EH 2R5BA 4XFJA 2WPRA 1IZNB 5CJ4A 3H1IE 2HPCB 1NTZE 4HM6A 3L71E 3U59A 3RL0D 3AZCA 2HLOA 3PLNA 2KYVA 4K35A 3G4SP 3GTEA 4NBFD 2FFDC 5DJUB 5KAFE 2N9BA 4H44B 3M9BA 4ZMDA 3Q5PA 3EN1A 1L0NJ 3C0DA 4WY4C 2BMOA 2BCCJ 1ZLLA 1NTMD 1ZRTE 3AE6C 1KTMA 1VQ4P 5GTHH 3H1JE 2W27A 3M9QA 1H0TB 3CWBE 1HGVA 4PD4I 1NAFA 1S2EA 1MUUA 1SQQJ 1FDMA 1SQVD 3TGUD 1RF0C 1S9KD 4EOTA 3AEAC 1PP9D 2B89A 2PFXA 4Z1MH 2QJPB 2E42A 3TDKA 3RK2C 3WUVA 1DIPA 4YXWH 2VRSA 1ZXGA 2XRXA 2KS1A 1LNQA 2WT7A 2A06G 3HUSA 1OXZA 1NU1G 3AE2C 3E7KA 4WWIA 4JF7A 3L75G 4RESB 4PV1C 3K5BA 2BEZF 1VQ5P 2OQQA 1NGMB 3CCJP 3FXEA 4ASVA 1BGYG 1GW3A 4C7NA 4JBZA 1LT9A 3GHGB 3WUTA 1L4AD 2YVJB 2G8YA 2ZYLA 3D70A 2Q3WA 1N86A 4QDFA 1S5LX 4AYCA 1NDOA 4XE5B 2QM7A 1BDCA 3H1HE 3CXHD 2FYZA 2FKWB 2UWJE 2M5AA 1QX8A 2IX7C 4PD4E 1M1KQ 1TU3F 4OGQB 2OYHA 2WPSA 2FXMA 4QUPA 2IYOA 2P2UA 1S3JA 1JCCA 4KHXA 1NTMG 1NHLA 1GK6A 3L73E 1X9VA 2HYNA 4QURA 1T3UA 3CCVP 2R44A 1VL2A 3BASA 1SQVG 3TGUG 2GM4A 2QE7H 1VF5B 1DEBA 2BEQD 2ZFCA 1L0LE 4HJGH 3SFEC 2NUKA 2C9NY 1JMMA 2OTLP 3C9IA 3H1ID 1NTZD 2NPSB 2O01N 2POHA 4JYBA 2P10A 1DEEG 4ASWA 1M90Q 3L71D 1HGZA 4UB8E 1RIEA 1FE6A 3CCLP 4Y99C 2E74D 2RMZA 3SWKA 1Y8AA 4N3YB 3B5NA 2JWAA 3O6QA 1PPJD 4TLFA 1LTGC 2OGUA 3BCCE 3HE5B 3GMAA 2D2CD 1EDIA 3HTKB 3CCMP 2H89C 2XSOA 4H13B 3VMZA 3F5HA 2E4PA 1A02J 2ZYGA 3H1JD 1NTMK 1EDKA 2B88A 3V2PA 3EWKA 1XTGB 1KYOD 2E4QA 1GW4A 3D6ZA 2E75C 1RY3A 2R5DA 2FXPA 2W6AA 3H1LJ 2AXTE 1Q90C 5TISE 3VYIA 1SQVK 2IBZE 2KI7B 1K73Q 3U1CA 2RKLA 4OGQC 5AVSB
chains in the Genus database with same CATH topology
4HM4A 4QURA 4U3FE 4NBGD 5BOKA 5HL4A 1G8KB 2QJPC 1SQVE 1SQBE 3TGUE 4QDFB 3H1LE 2QPZA 4D6TE 1O7MA 1G8JB 5AEUA 1SQQE 4NBDD 5CXMA 1L0NE 3L72E 3GL2A 4QUQA 2B1XA 3VMGD 1P84E 4NB9D 1L0LE 1VM9A 2NUKA 2BMRA 1VF5D 1UUVA 2XRXA 3CX5E 1FQTA 1O7HA 4NBBD 5KKZC 2I7FA 1PPJE 2HMJA 2A06E 4HKVA 1O7PA 1BCCE 4HM1A 3L74E 1WQLA 4PV1D 2GBXA 3L75E 3H1IE 1RIEA 1NTZE 2DE6D 2NWFA 4HM3A 4HM6A 1EG9A 3DQYA 3D89A 3GTSA 1BE3E 3L71E 1SQXE 2QJYC 2ZT9D 4NBCD 3VMID 2E74D 1SJGA 1BGYE 4HM8A 1NTKE 3AZCA 3GL0A 2HMOA 3H1KE 2FYNC 4HJLA 1O7GA 4H0LD 2HMKA 4H13D 4HM0A 1EZVE 1KB9E 2NVFA 3EQQA 2HMNA 3BCCE 2HMMA 1O7NA 2YIUC 2YVJB 4P1CH 2ZYLA 4HM5A 2Q3WA 4AAYB 3GCEA 2NVEA 1NU1E 4EMJB 4QDFA 3GTEA 5KLVE 1NDOA 4NB8D 3GZYA 4QCKA 4NBFD 2D2CD 2DE5D 3VMHD 3GKEA 2XSOA 1KYOE 4QDDA 3H1HE 2CKFA 1O7WA 2XR8A 3L70E 2YFLA 2E4PA 3EN1A 4P1BH 3C0DA 1UUWA 2BMOA 2E76D 3VCAA 2HMLA 3FOUA 4H44D 1NYKA 3CXHE 2JO6A 2YFIA 4HM7A 4QDCA 5AEWA 3N0QA 2E75D 2B24A 2NVGA 5KLIC 1ZRTE 2DE7D 4PD4E 1RFSA 3VCPA 1ULJA 3GOBA 1SQPE 3GZXA 4QUPA 3H1JE 4NBAD 1VCKA 2NUMA 2E4QA 4NBED 1PP9E 1NTME 3CWBE 1JM1A 2GBWA 2JZAA 4OGQD 2FYUE 2BMQA 2BCCE 4NBHD 1Q90C 2QJKC 2YFJA 1ULIA 2IBZE 3L73E 3GB4A 4HM2A 4AIVA 2XSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM4 A;  4QUR A;  4U3F E;  4NBG D;  5BOK A;  5HL4 A;  1G8K B;  2QJP C;  1SQV E;  1SQB E;  3TGU E;  4QDF B;  3H1L E;  2QPZ A;  4D6T E;  1O7M A;  1G8J B;  5AEU A;  1SQQ E;  4NBD D;  5CXM A;  1L0N E;  3L72 E;  3GL2 A;  4QUQ A;  2B1X A;  3VMG D;  1P84 E;  4NB9 D;  1L0L E;  1VM9 A;  2NUK A;  2BMR A;  1VF5 D;  1UUV A;  2XRX A;  3CX5 E;  1FQT A;  1O7H A;  4NBB D;  5KKZ C;  2I7F A;  1PPJ E;  2HMJ A;  2A06 E;  4HKV A;  1O7P A;  1BCC E;  4HM1 A;  3L74 E;  1WQL A;  4PV1 D;  2GBX A;  3L75 E;  3H1I E;  1RIE A;  1NTZ E;  2DE6 D;  2NWF A;  4HM3 A;  4HM6 A;  1EG9 A;  3DQY A;  3D89 A;  3GTS A;  1BE3 E;  3L71 E;  1SQX E;  2QJY C;  2ZT9 D;  4NBC D;  3VMI D;  2E74 D;  1SJG A;  1BGY E;  4HM8 A;  1NTK E;  3AZC A;  3GL0 A;  2HMO A;  3H1K E;  2FYN C;  4HJL A;  1O7G A;  4H0L D;  2HMK A;  4H13 D;  4HM0 A;  1EZV E;  1KB9 E;  2NVF A;  3EQQ A;  2HMN A;  3BCC E;  2HMM A;  1O7N A;  2YIU C;  2YVJ B;  4P1C H;  2ZYL A;  4HM5 A;  2Q3W A;  4AAY B;  3GCE A;  2NVE A;  1NU1 E;  4EMJ B;  4QDF A;  3GTE A;  5KLV E;  1NDO A;  4NB8 D;  3GZY A;  4QCK A;  4NBF D;  2D2C D;  2DE5 D;  3VMH D;  3GKE A;  2XSO A;  1KYO E;  4QDD A;  3H1H E;  2CKF A;  1O7W A;  2XR8 A;  3L70 E;  2YFL A;  2E4P A;  3EN1 A;  4P1B H;  3C0D A;  1UUW A;  2BMO A;  2E76 D;  3VCA A;  2HML A;  3FOU A;  4H44 D;  1NYK A;  3CXH E;  2JO6 A;  2YFI A;  4HM7 A;  4QDC A;  5AEW A;  3N0Q A;  2E75 D;  2B24 A;  2NVG A;  5KLI C;  1ZRT E;  2DE7 D;  4PD4 E;  1RFS A;  3VCP A;  1ULJ A;  3GOB A;  1SQP E;  3GZX A;  4QUP A;  3H1J E;  4NBA D;  1VCK A;  2NUM A;  2E4Q A;  4NBE D;  1PP9 E;  1NTM E;  3CWB E;  1JM1 A;  2GBW A;  2JZA A;  4OGQ D;  2FYU E;  2BMQ A;  2BCC E;  4NBH D;  1Q90 C;  2QJK C;  2YFJ A;  1ULI A;  2IBZ E;  3L73 E;  3GB4 A;  4HM2 A;  4AIV A;  2XSH A; 
#chains in the Genus database with same CATH topology
 1YTZ I;  1N7S C;  3M06 A;  3OAK A;  3S4R A;  1J1E B;  1G8J B;  3H32 A;  5BU5 A;  2Z5H A;  1JTH B;  1KC8 Q;  1MFT A;  3FX0 A;  1VQ7 P;  2ZT9 C;  1O7H A;  4O9B A;  3M0D A;  5APU A;  1N73 B;  3HE4 A;  3I55 P;  3H1K J;  2ZJS E;  3GF3 A;  3A0B H;  2B87 A;  3SFD C;  1GL2 B;  4NBC D;  1NTZ G;  5E79 H;  1HF9 A;  1SJG A;  3ZDM A;  2NPS C;  3PJS K;  2YO2 A;  1S4X A;  1S5L H;  2JO1 A;  4I6M C;  3D6Y A;  2FYN B;  2Q3I A;  1NU1 E;  1Y47 A;  1BDD A;  3WU2 E;  1HWT C;  1E79 H;  4PD4 D;  1ZR2 A;  3NMD A;  5APT A;  3A0H E;  2JO6 A;  2FYU J;  2YFI A;  1M8O B;  2IZ0 A;  1RFS A;  2JP3 A;  4L73 A;  3TK1 A;  1N2D C;  3L73 D;  5APQ A;  2JZA A;  1JUN A;  1LWU A;  3H1J G;  3S1K A;  2KNC A;  4D6T J;  1KIL D;  3CWB G;  1FZG A;  3CC2 P;  2JDI H;  2OAR A;  1M1J C;  2QJK B;  1QLE D;  1SQB E;  1MV8 A;  3KPE A;  3TNU A;  4GOE A;  1JNM A;  3CXH I;  5TJH A;  3L72 E;  2YXQ B;  3W67 A;  3IAO A;  1BE3 G;  3CXH H;  1JMB A;  1FDO A;  2N1T D;  1T3J A;  3CX5 E;  3IFM A;  1NTZ K;  1Z56 A;  3RK3 E;  2HOD A;  2KOG A;  3SWY A;  1YBK A;  1H88 A;  2Y0D A;  4A7P A;  2OYI C;  4PJ0 H;  1KIL A;  1DD3 A;  5M1B A;  4H0L B;  3HRN A;  3ABV C;  1NTK E;  3BCC D;  1KMI Z;  3EQ2 A;  4HJL A;  4DZO A;  4H13 D;  1CSB A;  1EZV E;  4I1L A;  2JKV A;  1O7N A;  2YIU C;  3H25 A;  4AAY B;  4KJM A;  1LTS C;  3RBX A;  1G2C B;  3GKE A;  3IF4 A;  3T97 A;  2N1T A;  2CKF A;  2ITA A;  3RL0 g;  3I5C A;  1PP9 J;  3H1H G;  2HML A;  4GIF A;  4EIJ A;  2PP6 A;  2R32 A;  4WY4 B;  2DE7 D;  5APV A;  1FZC A;  4NBA D;  2ZYD A;  1Q7Y Q;  1KV4 A;  3FXD A;  1R5S A;  5KAI E;  4NBG D;  4AQR D;  1G1I A;  4BRY A;  4L76 A;  3AEB C;  3MUD A;  3OJA B;  1AV1 A;  3C8V A;  2WWW A;  1RF1 A;  2QRX A;  2B1X A;  4B86 A;  1AQT A;  1HTL C;  2K88 A;  2BMR A;  1VQP P;  1YJW P;  1L0L G;  5KKZ C;  3IR9 A;  1FAV A;  3AE5 C;  1PL5 A;  2P7J A;  1KYO H;  1ZP0 C;  1RQV A;  3L4F A;  2LR2 A;  1S1C X;  1AVY A;  4DT0 A;  5AVQ B;  1LTJ A;  1FU1 A;  3A5T A;  5AW9 B;  3L70 G;  1NU1 D;  5AVV B;  4PV1 B;  1OWA A;  4EYY Q;  4LLH A;  1SFC D;  2A45 G;  3NTN A;  3BCC G;  2XU6 A;  4H0L C;  1BGY D;  5L8R J;  4R4L A;  3CCR P;  2I1K A;  2PAJ A;  4GOF A;  2KK7 A;  2KZI A;  1NYK A;  3HUS C;  3N0Q A;  2K9J B;  3CD6 P;  2KSJ A;  1PIX A;  2IDB A;  1ZR4 A;  1VCK A;  5KJ7 D;  4U3F J;  1EQ7 A;  1K9M Q;  3CLQ A;  1JM1 A;  1LT9 C;  3H1I J;  2BCC E;  3Q2Y A;  1PGO A;  3HD7 A;  3L71 J;  1ZW0 A;  1SFC A;  4UB6 E;  4WVZ A;  4M3L A;  4WB4 A;  2IBZ G;  2W6J H;  5HL4 A;  3VP8 A;  1SQQ E;  3R4Y A;  4Y28 J;  2ZVN B;  2E5T A;  3CX5 D;  2OTK E;  1P84 E;  1J2J B;  2G3A A;  3RK3 D;  2KSE A;  1OVV A;  4IL6 E;  4PD4 H;  2OYH C;  3CME P;  1LTB C;  2Q1K A;  3G9R A;  1FS0 E;  2QEX P;  1AJY A;  5KJ7 A;  1O7P A;  4MN4 C;  1N7L A;  3W68 A;  3PP5 A;  1DD4 A;  2GBX A;  3A3Y B;  1NTK D;  1EG9 A;  3DQY A;  1BE3 E;  2KLV A;  3MHV A;  5AW8 B;  1KQL A;  1HVV A;  3BAT A;  1WMK A;  4Y99 B;  2HMK A;  1K05 A;  2CK3 H;  4P1C H;  3GZY A;  4WY4 D;  5B5E E;  1VQN P;  3NFQ A;  2DE5 D;  2P67 A;  4EDF A;  3EFG A;  2K3R A;  5CCG D;  2WPQ A;  3N4X A;  4UB8 H;  4GKG A;  4N6J A;  2SPZ A;  5KLI C;  4IFM A;  3B5N C;  2A45 I;  4NBE D;  3AE7 C;  1OW6 A;  2GBW A;  2O1J A;  2Q3E A;  2FFD A;  1N8R Q;  2E75 B;  2IZ1 A;  3PHL A;  2QA4 P;  3L36 A;  3AE4 C;  1NWQ A;  1G8K B;  1NKN A;  3RK2 D;  2LXC B;  4U7J A;  2YMY A;  1N7S B;  1SQB G;  1LWU B;  5CCG A;  2AEF A;  5GTH E;  1EDL A;  4LC1 A;  2KZJ A;  2Y9Z A;  1Q81 Q;  1HH0 A;  3L72 G;  3OW2 O;  1L4A A;  1FQT A;  2Y0C A;  2E74 C;  1T2K D;  2J5U A;  2WMM A;  1A02 F;  2ZT9 B;  4HM1 A;  2IBZ I;  1RF0 A;  4PV1 D;  2O3J A;  2Y0E A;  5TIS H;  3D89 A;  1YTZ T;  2PGD A;  3CMA P;  3V4W A;  1LGH B;  3GL0 A;  1M7L A;  1OMI A;  1NU1 K;  1USE A;  1NTK G;  4GT1 A;  3L73 J;  1EZV G;  5AW0 B;  1LP1 A;  1LTA C;  3V2Q A;  3SWF A;  3M0D C;  2XNX A;  4QDD A;  2KB7 P;  1HJB A;  3L70 E;  1RE4 A;  2FBW C;  4RKU J;  5CCH C;  2CPS A;  4H44 D;  2V4H A;  3G6E P;  3VMY A;  2P58 A;  2HPC A;  2NUM A;  1VQM P;  1S72 P;  2R3S A;  1RQU A;  2HR3 A;  3H6P A;  2P1J A;  1URQ B;  2JWD A;  1USD A;  1ULI A;  3LW5 H;  3V2R A;  1SQB K;  1ZRT D;  2E43 A;  3BRV B;  5CMZ A;  3GLM A;  2C0W A;  3CWB D;  3WU2 H;  3KZI E;  1P84 D;  3H1L E;  3CCQ P;  1MZ9 A;  1KQF B;  1BCC G;  1KQG B;  3II6 A;  1M1J B;  3O8Z A;  3GW6 A;  3A0H H;  1SQX G;  1EC5 A;  3P8C E;  2Q5U A;  1L2P A;  1BE3 D;  2OYO A;  4WBA A;  1LWU C;  1W5C E;  1EDJ A;  1NTK K;  2NWF A;  4OH8 B;  1QL2 A;  2IYP A;  1FOS F;  5KLV G;  1H0T A;  5AVY B;  4HM8 A;  2OYI B;  1U7J A;  3BRT B;  3H1K E;  1X8Y A;  1HUC A;  2NVF A;  1IFN A;  1OW7 A;  1GU4 A;  4HM5 A;  1IFM A;  5AVR B;  1GZL A;  2IFM A;  1JY3 P;  3CX5 I;  1GMJ A;  2YIU B;  4I7Z C;  3AE1 C;  1YJN P;  4XA4 A;  2E76 B;  1LTJ B;  2ZXE B;  3CX5 H;  2WSS H;  1OVR A;  4IL6 X;  4HM7 A;  1KIL C;  2E75 D;  4YTP C;  2YKQ A;  3JCU H;  5H2F E;  5AW1 B;  2BAS A;  2J59 M;  1EZV I;  1Q90 D;  3AE8 C;  3H1H D;  1E5W A;  3QWO C;  4OGQ D;  2FYU E;  1L0N G;  2BMQ A;  1BSH A;  1N7S D;  1OVU A;  2L5G B;  2BCC G;  1FOS E;  3E1R A;  4AIV A;  3KHU A;  3GHG A;  5BOK A;  1DX7 A;  4D6T E;  4CPG A;  1O7M A;  1URQ C;  1Y9B A;  2YKO A;  3QH9 A;  3LW5 J;  1NO4 A;  1BSN A;  1NU1 J;  1SQQ G;  3L75 J;  1OZH A;  1NOH A;  2QJY B;  1FZC C;  1VF5 D;  1BGY J;  4ZKU A;  3L74 E;  5KKZ B;  2NPS D;  2N9Y B;  2DE6 D;  3VMA A;  1L0L D;  1EXI A;  3GTS A;  2R3C A;  2XZR A;  4LGD E;  1OIP A;  3UIA A;  5KAI H;  2ZAE B;  2WSE H;  3MUD C;  4ZNC A;  1LTT C;  1DH3 A;  1OW8 A;  1RF1 C;  4IFD K;  2K37 A;  3L70 D;  5APW A;  1YJ9 P;  1JY3 O;  1H89 A;  5GTI H;  3V2N A;  2CPB A;  3P32 A;  3FWL A;  1NTM J;  5E79 E;  2KS1 B;  3B4S A;  1X0T A;  2I1J A;  2NPS A;  3GF7 A;  1S5L E;  5APS A;  2WT7 B;  2E76 C;  1LTJ C;  1SQP E;  3HUS B;  5APY A;  1PP9 E;  1JOC A;  2KP8 A;  1SQV J;  3TGU J;  4C46 A;  2H88 C;  5CBO A;  2YFJ A;  1OX3 A;  4C7N B;  1LT9 B;  3MP7 B;  3A7O A;  3V6I A;  1SQQ K;  4QDF B;  3HE5 A;  1PGQ A;  3P8C D;  4R4M A;  1RE3 A;  2IBZ D;  3HTK A;  4QUQ A;  1K04 A;  3Q1M A;  2QM8 A;  1VPC A;  2M5A B;  2J58 A;  1FBM A;  3U1A A;  4ZKP A;  5KAF H;  1BCC E;  2OYH B;  3AEG C;  2KIK A;  3HD7 C;  3H1K D;  1SFC C;  1SQX E;  2QJY C;  2NRG A;  4UB6 H;  3VMI D;  1FJP A;  4YXD C;  1IK9 A;  1GL2 D;  1PV3 A;  1FDI A;  1KD1 Q;  1P84 I;  3RL0 C;  1W2E A;  1QL1 A;  1J1D C;  1LTI C;  1P84 H;  5KLV E;  2W8Z A;  4QCK A;  2WIT A;  4IL6 H;  3B71 A;  2WSE J;  3G3Z A;  1JTH A;  1O7W A;  1IFD A;  2XR8 A;  1PGJ A;  5KJ7 C;  1VQ9 P;  2MJZ A;  3USS A;  1XTC C;  1N73 A;  5AEW A;  2B24 A;  2NVG A;  2FYU D;  2JEE A;  1EXJ A;  1Q2N A;  5KLI B;  1FC2 C;  4KT0 J;  1GL2 A;  3B5N B;  3O6Q B;  2WPV B;  3RBZ A;  4NPD A;  1IFI A;  4IOI H;  3MTU E;  4DOJ A;  1T6A A;  4U3F E;  1Q86 Q;  3CC7 P;  2QPZ A;  2WSF H;  4JQ0 D;  4NBD D;  3LID A;  3CCU P;  1L0N E;  5CJ0 A;  2QIW A;  3H1L G;  1IC2 A;  1LT1 A;  1NTZ J;  3L74 D;  3P8M C;  4W80 A;  1SQB D;  3V4Q A;  4NBB D;  2L91 A;  1UIX A;  1PPJ E;  2Q9I A;  2E5Y A;  4NPF X;  1VDF A;  3L72 D;  3Q5R A;  2E74 B;  2FY8 A;  1JY2 P;  1L0L K;  4BWN A;  1ZME C;  2GA1 A;  3L35 A;  2YMK A;  1O7G A;  4H0L D;  2WZ7 A;  1KB9 E;  1HBW A;  3H1K G;  3EQQ A;  2WTY A;  2HMM A;  2D2C B;  5CCG C;  3VTP C;  2IPP A;  3GCE A;  2JR8 A;  3H32 B;  1GD2 E;  5B66 E;  3NXS A;  1L4A C;  1VQ8 P;  2H43 A;  3AED C;  3N7N A;  2XND H;  4L75 A;  1KYO E;  3AEF C;  1EZV D;  3H1J J;  1GK4 A;  1UUW A;  1ZN5 A;  1YIT P;  1SS1 A;  3CWB J;  1SQP D;  3HE4 B;  5AVX B;  2XDJ A;  2B87 B;  4L74 A;  2AXC A;  1IO4 A;  3VMX A;  1CI6 A;  3CI9 A;  3G71 P;  3OA7 A;  2O1K A;  5CBN A;  1BE3 J;  2RN0 A;  2FYU G;  4HM4 A;  1FZB A;  1T2K C;  1RE4 C;  4YPC A;  4D6T G;  3GL2 A;  1R8E A;  1G2C A;  5EFW B;  2A45 H;  1MFZ A;  1RH5 B;  3M0A A;  3JSV C;  1VM9 A;  4QMA A;  1BCC D;  2M3B A;  2WSF J;  2V7Q H;  1NKZ B;  1SQX D;  1X79 B;  1QGK B;  1X22 A;  4WY4 A;  2Y9Y A;  1GDT A;  3FWN A;  4GOD A;  1YHQ P;  1PZQ A;  3L74 G;  1T8Z A;  1JY2 O;  2M8R A;  2KNC B;  5BU8 B;  2HMO A;  3KZI H;  5KLV D;  1OFC X;  3H1H J;  2HMN A;  2WQY C;  1KZU B;  2OTJ P;  2YKP A;  3D71 A;  1AVO A;  3TNU B;  4H44 C;  4NB8 D;  1M56 D;  1LJ2 A;  2AXT H;  5DJT B;  3M9H A;  4IFF A;  1Q82 Q;  3AEC C;  2O01 H;  4BXL A;  2D2C C;  4I7Z B;  5AVW B;  2H7H A;  3B5N D;  2K1A A;  1KIL E;  1CW5 A;  2HOD B;  3CPW O;  1VQO P;  1KQS O;  3VCP A;  5C39 A;  2FYU K;  2M3E A;  1SP4 A;  1KIL B;  1SQP G;  3BVH A;  1PP9 G;  4U3F D;  2FXO A;  1VQK P;  4HM2 A;  1K8A Q;  2XSH A;  5AW6 B;  1PFI A;  1L0L J;  1L0N D;  2QJP C;  2ZYA A;  4N78 E;  3AEE C;  1G1J A;  1FZA A;  2BCC D;  3T97 B;  2Q6Q A;  2N1T B;  1U7M A;  4HYT B;  1QVF O;  2HFE D;  5H2F H;  1JEK A;  1WRG A;  3GG2 A;  4HB1 A;  3L70 J;  4OVN F;  1SQQ D;  1FZC B;  2K9J A;  1CZQ A;  4W7Y A;  4HM3 A;  3BCC J;  3E1I A;  1JY3 N;  4W7Z A;  3C1L A;  2GUS A;  1KB9 D;  3GHG C;  2V7Q J;  1QVG O;  3KDP B;  2PRR A;  3Q3D A;  1SVF A;  3PH0 A;  2MKV A;  2B9B A;  3F89 A;  5AW3 B;  3VOP A;  4BRY B;  1NAY A;  2NVE A;  1ZOY C;  2KXP B;  1AQ5 A;  5CCH D;  1RF1 B;  1NH4 A;  1VQL P;  1PGP A;  2YFL A;  2Z4E A;  5AW7 B;  3VCA A;  1IK7 A;  2JJL A;  1SQP K;  3VP9 A;  1D7M A;  2K9Y A;  3IN6 A;  3CL3 D;  3B8E B;  5AVU B;  3GZX A;  1GU5 A;  1KOR A;  2O01 J;  1W2B O;  3V5B A;  2WSC H;  4RO0 A;  2M0B A;  3GB4 A;  3KYQ A;  5CCH A;  5KTB A;  5K5G B;  1VF5 C;  2ZXX A;  3PRJ A;  4HKZ H;  4U3F G;  1KFM A;  5AEU A;  5AW2 B;  5CHX A;  1YI2 P;  3H1I G;  1JO5 A;  3L71 G;  3A2A A;  2NZ2 A;  2QSI A;  1UUV A;  4OWF A;  5AW5 B;  5AW4 B;  2I7F A;  2C0X A;  2LKM A;  3M91 A;  2A06 E;  4HKV A;  1SQX K;  3MGN A;  2KLU A;  3TYY A;  3PTZ A;  2W6B A;  3L75 E;  2N1T C;  1PPJ G;  4DCK A;  2XV5 A;  2RH0 A;  2ZT9 D;  3ITK A;  1BGY E;  3HD7 B;  3KXD A;  1SFC B;  1JB0 J;  1AA0 A;  5KLV K;  1RE3 C;  2IFN A;  4TT3 H;  1UII A;  1IFP A;  4GDO A;  2YO3 A;  4H13 C;  2QG4 A;  1JM0 A;  3RL0 B;  1N7S A;  3CCE P;  3P7K A;  1J1D B;  3TSI A;  1AFO A;  3MZW B;  4P1B H;  1FZE A;  5APX A;  3R2P A;  3FOU A;  1WT6 A;  5AVT B;  1GTW A;  3L37 A;  4QDC A;  2AEM A;  3TF5 A;  3CCS P;  1ULJ A;  2KUB A;  3GOB A;  1NTM E;  3L74 J;  1SQB J;  3A0B E;  2Z5I A;  4NBH D;  3LIE A;  1NYH A;  1YYC A;  1J1E C;  4N78 D;  3L72 J;  1FZF A;  1URQ D;  1L0N K;  3WUU A;  2ZVO B;  1SQV E;  3TGU E;  3Q5S A;  1YQ4 C;  1S9K E;  1CI6 B;  2WVR A;  3JCU E;  3RK3 B;  5CXM A;  2WSC J;  3EFF K;  1VQ6 P;  4NB9 D;  1N73 C;  2XKM A;  3I56 P;  3JC2 2;  4DJG A;  1FJK A;  4K3A A;  3H1L D;  4NPE A;  2GUV A;  1NTK J;  1GL2 C;  1WQL A;  2DW3 A;  4JPZ B;  1MKM A;  1NJI Q;  2HG5 D;  1YQ3 C;  1IFJ A;  1SQP J;  2FFD B;  1URQ A;  1KN7 A;  2C9L Y;  2FYN C;  4HM0 A;  2YXR B;  2YNY A;  4I2L C;  2W90 A;  4EMJ B;  1RHZ B;  1SLQ A;  5AVZ B;  1M1J A;  3VMH D;  2W83 C;  2QVA A;  4HH2 A;  1JCD A;  1L4A B;  1R5L A;  3MD0 A;  1YIJ P;  2E76 D;  1NVO A;  1IJD B;  2AEJ A;  3CXH E;  3L73 G;  3VN0 A;  3FGA D;  1HJ0 A;  1KB9 I;  1BCC J;  1ZV8 A;  1KB9 H;  3SSU A;  3MIW A;  1KFN A;  1M57 D;  2I8D A;  2QJK C;  4PJ0 E;  3S9O A;  1H8A A;  2OYI A;  5GTI E;  1SQX J;  2LXB A;  4C7R A;  3RK2 B;  3RGU A;  1KYO I;  5B66 H;  3WMM 0;  1LP1 B;  3AE9 C;  3CC4 P;  3KQG A;  2H8P D;  3AE3 C;  4AUW A;  3VMG D;  1JY2 N;  4JYC A;  5KLV J;  1U57 A;  5BVZ A;  2A06 D;  4RJT A;  3L75 D;  3HD7 D;  4EI2 A;  4D6T D;  2Q7C A;  1QEX A;  2HMJ A;  3RK3 C;  5B5E H;  2R5B A;  4XFJ A;  2WPR A;  1IZN B;  5CJ4 A;  3H1I E;  2HPC B;  1NTZ E;  4HM6 A;  3L71 E;  3U59 A;  3RL0 D;  3AZC A;  2HLO A;  3PLN A;  2KYV A;  4K35 A;  3G4S P;  3GTE A;  4NBF D;  2FFD C;  5DJU B;  5KAF E;  2N9B A;  4H44 B;  3M9B A;  4ZMD A;  3Q5P A;  3EN1 A;  1L0N J;  3C0D A;  4WY4 C;  2BMO A;  2BCC J;  1ZLL A;  1NTM D;  1ZRT E;  3AE6 C;  1KTM A;  1VQ4 P;  5GTH H;  3H1J E;  2W27 A;  3M9Q A;  1H0T B;  3CWB E;  1HGV A;  4PD4 I;  1NAF A;  1S2E A;  1MUU A;  1SQQ J;  1FDM A;  1SQV D;  3TGU D;  1RF0 C;  1S9K D;  4EOT A;  3AEA C;  1PP9 D;  2B89 A;  2PFX A;  4Z1M H;  2QJP B;  2E42 A;  3TDK A;  3RK2 C;  3WUV A;  1DIP A;  4YXW H;  2VRS A;  1ZXG A;  2XRX A;  2KS1 A;  1LNQ A;  2WT7 A;  2A06 G;  3HUS A;  1OXZ A;  1NU1 G;  3AE2 C;  3E7K A;  4WWI A;  4JF7 A;  3L75 G;  4RES B;  4PV1 C;  3K5B A;  2BEZ F;  1VQ5 P;  2OQQ A;  1NGM B;  3CCJ P;  3FXE A;  4ASV A;  1BGY G;  1GW3 A;  4C7N A;  4JBZ A;  1LT9 A;  3GHG B;  3WUT A;  1L4A D;  2YVJ B;  2G8Y A;  2ZYL A;  3D70 A;  2Q3W A;  1N86 A;  4QDF A;  1S5L X;  4AYC A;  1NDO A;  4XE5 B;  2QM7 A;  1BDC A;  3H1H E;  3CXH D;  2FYZ A;  2FKW B;  2UWJ E;  2M5A A;  1QX8 A;  2IX7 C;  4PD4 E;  1M1K Q;  1TU3 F;  4OGQ B;  2OYH A;  2WPS A;  2FXM A;  4QUP A;  2IYO A;  2P2U A;  1S3J A;  1JCC A;  4KHX A;  1NTM G;  1NHL A;  1GK6 A;  3L73 E;  1X9V A;  2HYN A;  4QUR A;  1T3U A;  3CCV P;  2R44 A;  1VL2 A;  3BAS A;  1SQV G;  3TGU G;  2GM4 A;  2QE7 H;  1VF5 B;  1DEB A;  2BEQ D;  2ZFC A;  1L0L E;  4HJG H;  3SFE C;  2NUK A;  2C9N Y;  1JMM A;  2OTL P;  3C9I A;  3H1I D;  1NTZ D;  2NPS B;  2O01 N;  2POH A;  4JYB A;  2P10 A;  1DEE G;  4ASW A;  1M90 Q;  3L71 D;  1HGZ A;  4UB8 E;  1RIE A;  1FE6 A;  3CCL P;  4Y99 C;  2E74 D;  2RMZ A;  3SWK A;  1Y8A A;  4N3Y B;  3B5N A;  2JWA A;  3O6Q A;  1PPJ D;  4TLF A;  1LTG C;  2OGU A;  3BCC E;  3HE5 B;  3GMA A;  2D2C D;  1EDI A;  3HTK B;  3CCM P;  2H89 C;  2XSO A;  4H13 B;  3VMZ A;  3F5H A;  2E4P A;  1A02 J;  2ZYG A;  3H1J D;  1NTM K;  1EDK A;  2B88 A;  3V2P A;  3EWK A;  1XTG B;  1KYO D;  2E4Q A;  1GW4 A;  3D6Z A;  2E75 C;  1RY3 A;  2R5D A;  2FXP A;  2W6A A;  3H1L J;  2AXT E;  1Q90 C;  5TIS E;  3VYI A;  1SQV K;  2IBZ E;  2KI7 B;  1K73 Q;  3U1C A;  2RKL A;  4OGQ C;  5AVS B; 
#chains in the Genus database with same CATH homology
 4HM4 A;  4QUR A;  4U3F E;  4NBG D;  5BOK A;  5HL4 A;  1G8K B;  2QJP C;  1SQV E;  1SQB E;  3TGU E;  4QDF B;  3H1L E;  2QPZ A;  4D6T E;  1O7M A;  1G8J B;  5AEU A;  1SQQ E;  4NBD D;  5CXM A;  1L0N E;  3L72 E;  3GL2 A;  4QUQ A;  2B1X A;  3VMG D;  1P84 E;  4NB9 D;  1L0L E;  1VM9 A;  2NUK A;  2BMR A;  1VF5 D;  1UUV A;  2XRX A;  3CX5 E;  1FQT A;  1O7H A;  4NBB D;  5KKZ C;  2I7F A;  1PPJ E;  2HMJ A;  2A06 E;  4HKV A;  1O7P A;  1BCC E;  4HM1 A;  3L74 E;  1WQL A;  4PV1 D;  2GBX A;  3L75 E;  3H1I E;  1RIE A;  1NTZ E;  2DE6 D;  2NWF A;  4HM3 A;  4HM6 A;  1EG9 A;  3DQY A;  3D89 A;  3GTS A;  1BE3 E;  3L71 E;  1SQX E;  2QJY C;  2ZT9 D;  4NBC D;  3VMI D;  2E74 D;  1SJG A;  1BGY E;  4HM8 A;  1NTK E;  3AZC A;  3GL0 A;  2HMO A;  3H1K E;  2FYN C;  4HJL A;  1O7G A;  4H0L D;  2HMK A;  4H13 D;  4HM0 A;  1EZV E;  1KB9 E;  2NVF A;  3EQQ A;  2HMN A;  3BCC E;  2HMM A;  1O7N A;  2YIU C;  2YVJ B;  4P1C H;  2ZYL A;  4HM5 A;  2Q3W A;  4AAY B;  3GCE A;  2NVE A;  1NU1 E;  4EMJ B;  4QDF A;  3GTE A;  5KLV E;  1NDO A;  4NB8 D;  3GZY A;  4QCK A;  4NBF D;  2D2C D;  2DE5 D;  3VMH D;  3GKE A;  2XSO A;  1KYO E;  4QDD A;  3H1H E;  2CKF A;  1O7W A;  2XR8 A;  3L70 E;  2YFL A;  2E4P A;  3EN1 A;  4P1B H;  3C0D A;  1UUW A;  2BMO A;  2E76 D;  3VCA A;  2HML A;  3FOU A;  4H44 D;  1NYK A;  3CXH E;  2JO6 A;  2YFI A;  4HM7 A;  4QDC A;  5AEW A;  3N0Q A;  2E75 D;  2B24 A;  2NVG A;  5KLI C;  1ZRT E;  2DE7 D;  4PD4 E;  1RFS A;  3VCP A;  1ULJ A;  3GOB A;  1SQP E;  3GZX A;  4QUP A;  3H1J E;  4NBA D;  1VCK A;  2NUM A;  2E4Q A;  4NBE D;  1PP9 E;  1NTM E;  3CWB E;  1JM1 A;  2GBW A;  2JZA A;  4OGQ D;  2FYU E;  2BMQ A;  2BCC E;  4NBH D;  1Q90 C;  2QJK C;  2YFJ A;  1ULI A;  2IBZ E;  3L73 E;  3GB4 A;  4HM2 A;  4AIV A;  2XSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...