3H1IE

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 45
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1iE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1iE02
1PP9E 2YVJB 1L0NE 2NUMA 2XR8A 2XSHA 4P1CH 1P84E 4QCKA 3L73E 2E74D 4QDFB 3C0DA 2E75D 3CX5E 1G8KB 2CKFA 2QJPC 2D2CD 4QDFA 2BMQA 1SQQE 1PPJE 4HM6A 1NU1E 2E4QA 2HMNA 1NYKA 4NBBD 1BCCE 2QJYC 2BCCE 3L70E 1RFSA 4HM7A 3H1IE 1KYOE 3TGUE 2HMMA 4HKVA 4U3FE 4NBDD 5AEWA 2HMJA 2YIUC 3GTSA 4NBHD 1VF5D 4QDCA 4NBED 1O7GA 5HL4A 4QUPA 2ZT9D 2XRXA 4QUQA 3L71E 1O7HA 1VCKA 2JZAA 1O7PA 2E76D 3VMID 4NBGD 4HM8A 1NDOA 3VMGD 1NTME 2HMKA 1SQPE 1G8JB 4NBCD 2FYUE 2I7FA 2GBWA 2FYNC 1FQTA 3CXHE 4H44D 3BCCE 2JO6A 3DQYA 3GL0A 4H0LD 2HMOA 1EZVE 4H13D 5KLIC 4NB8D 4QURA 2ZYLA 1ULJA 3GTEA 2NVEA 1BGYE 2DE5D 4AAYB 3GZYA 3GL2A 4QDDA 5CXMA 3D89A 3GOBA 4HM4A 1O7WA 1O7NA 2E4PA 5AEUA 2XSOA 4HM3A 2GBXA 2NUKA 1SJGA 1JM1A 1EG9A 2YFJA 3EQQA 2A06E 2BMOA 2YFLA 4AIVA 5BOKA 3FOUA 3H1JE 4PD4E 4P1BH 4OGQD 4NB9D 1UUWA 1NTKE 2DE7D 3L74E 3VMHD 1UUVA 2NVGA 2IBZE 3H1LE 4HM2A 3GCEA 2B1XA 2YFIA 4HJLA 2DE6D 3H1KE 3EN1A 3VCAA 1BE3E 4HM0A 1KB9E 4NBAD 2BMRA 1VM9A 1WQLA 4EMJB 2NWFA 4PV1D 1RIEA 3CWBE 4NBFD 1L0LE 3GB4A 4HM1A 1ZRTE 3L72E 5KKZC 2QPZA 2HMLA 1ULIA 1NTZE 4D6TE 1SQBE 5KLVE 1Q90C 3H1HE 3L75E 2QJKC 1O7MA 3GZXA 1SQVE 2Q3WA 3N0QA 1SQXE 3GKEA 2NVFA 3AZCA 3VCPA 4HM5A 2B24A
chains in the Genus database with same CATH superfamily
3HE5A 1MKMA 1OZHA 1L0LJ 1AQTA 1FS0E 3F5HA 1K73Q 1LWUC 5AVWB 1NO4A 2HMNA 1SFCC 1FZCA 1LT9C 2C9LY 2K37A 1VF5D 1NTMJ 2N1TA 1IFMA 2XNDH 2E76B 2JJLA 1QVGO 1OMIA 4HH2A 1KN7A 5AW9B 3FX0A 2G8YA 1N73C 2M5AA 1SQVD 4NB8D 4NPEA 2P1JA 1KILD 1PPJG 4HM4A 1L0LG 2H88C 3VOPA 5BOKA 3V2PA 5GTIE 3L37A 3TGUD 1UUWA 3L74E 1YHQP 1NTMG 4YXWH 1UUVA 1YIJP 3RK3E 3N7NA 2ZT9C 1KYOH 1A02F 2A45I 1RF1A 1BE3E 2OTKE 2R5BA 3RL0g 1K9MQ 2R5DA 3CCVP 1ULIA 1Q90C 4H44C 3RGUA 4GIFA 2FY8A 4U3FD 3VP9A 1N2DC 2I8DA 3CXHH 1NAYA 1EDJA 4H13C 3C9IA 2NPSB 3M0DA 4P1CH 3G9RA 3SFEC 5KJ7C 2JP3A 1LNQA 2FBWC 5KLVJ 1LP1A 3L75J 2W6JH 2BCCE 3H1IE 2N1TD 1X8YA 2POHA 3II6A 4JQ0D 4W80A 4QMAA 2PFXA 2LR2A 2PAJA 2IBZD 1IFDA 3H1KD 3CCLP 1HH0A 2WQYC 3MTUE 2FYUK 3EWKA 1QLED 1L4AC 3GG2A 4H0LB 2KLVA 4PD4D 1GL2D 2J58A 4WY4A 5GTHE 3CMAP 3U1CA 3BVHA 2IBZI 2NVEA 5TISE 3GLMA 1L4AB 1USEA 3D6YA 1NU1G 5CHXA 1DD3A 2M8RA 4HM3A 2C9NY 3EQQA 3MUDC 2ZAEB 1K04A 2MKVA 1LTAC 3SWKA 1BGYJ 5APXA 2OYIC 3HUSB 2P58A 3NMDA 3MZWB 2NVGA 1YTZT 2YFIA 1IC2A 2FYUD 1FZFA 4PV1B 4EMJB 1EZVG 1QL1A 1H0TB 1RHZB 2OYIB 4KJMA 2FKWB 3ABVC 1SQBK 1SQXE 2NVFA 2KYVA 4GT1A 2NUMA 2E74D 3L73E 3GHGC 3RL0B 1R5LA 1KQSO 3CWBJ 2W83C 2D2CD 1S2EA 4RO0A 1NTZJ 1SQQK 4IL6E 3Q5RA 3D70A 4NBDD 1JOCA 4AQRD 1URQA 2K1AA 1VCKA 1BSHA 2YKOA 3BRVB 4I2LC 5B5EH 2P2UA 5AW1B 4D6TG 1S5LE 4WY4D 1Z56A 1SQBD 3H1HD 1TU3F 3RBZA 3GTEA 3B71A 5EFWB 2L5GB 2J5UA 1KMIZ 2IFMA 1QEXA 4UB6E 2Z4EA 3RK3D 3GZYA 2ZFCA 3A0BE 1N7SC 1YBKA 2XSOA 1SQQD 2Z5IA 1EG9A 1CZQA 2KZIA 4MN4C 1LT1A 3VMHD 1AJYA 1J1EC 2OQQA 1T2KC 2B1XA 2JWDA 3JC22 1KB9E 2IDBA 1G1IA 3B5NB 3H1JJ 5KLIB 3A0HE 1X79B 2KK7A 4DT0A 1EDIA 1FOSF 2BCCD 2M3EA 3H1ID 3GKEA 2KOGA 3CCEP 2NZ2A 2OARA 1ZLLA 1P84E 2RKLA 2WPSA 3CX5E 2NPSA 2A06D 3S9OA 2BEZF 2W8ZA 3L74G 2KB7P 3I55P 1JCDA 2IYPA 1RE4A 5APTA 1SQXK 5H2FH 3CMEP 4R4MA 1BE3G 2E76D 1Q86Q 3PRJA 4JBZA 4GODA 3CCJP 3Q2YA 3CCQP 3DQYA 1FZAA 3MGNA 1AQ5A 3E1RA 3HTKB 3VMZA 2FFDB 3AEBC 2DE5D 3A7OA 3W68A 3LW5J 1FZEA 1XTCC 1IO4A 1U57A 2E4PA 1A02J 1PGQA 5KAIH 2G3AA 2L91A 2BCCG 3TNUB 3WU2E 2FYZA 1ZN5A 3V4WA 1SQXD 1WT6A 4BXLA 1PL5A 1U7JA 4EIJA 1PGOA 3L73D 3CI9A 3P8MC 3HUSA 1G2CB 1WQLA 2UWJE 2NWFA 2HG5D 1T3UA 4UB8H 1H0TA 2HLOA 2H43A 1SQVE 4C7NB 1QX8A 3AZCA 1KILE 2NPSD 3C0DA 3L4FA 1DH3A 1VPCA 3IN6A 1XTGB 4HB1A 2E4QA 3N4XA 4NBBD 1MUUA 3TGUE 1MFTA 4NBHD 2AEFA 1Q7YQ 2XZRA 1HVVA 4XE5B 3P8CE 1D7MA 4R4LA 3CC7P 2QM7A 2Y9YA 1M1JB 4H0LD 3L73G 4O9BA 5M1BA 4KHXA 3H25A 1CSBA 1L4AD 3GOBA 3L36A 1O7WA 5AEUA 1ZV8A 1KB9D 1GTWA 2GBXA 2NUKA 2O1KA 2R3SA 3L70D 4NB9D 1G1JA 4HKZH 1J1DC 2WSCJ 1LTJB 2IBZE 1P84D 3H1KE 3MIWA 1KB9I 1KILA 2FXMA 2YKQA 1N7LA 3KXDA 4PV1D 1J1DB 1HWTC 3AEDC 3B5NA 5CCHA 1JTHA 1R5SA 1O7MA 4PJ0H 5AVSB 5AVXB 3M9BA 4L74A 2XR8A 1U7MA 2E75B 2Y0DA 3RL0D 2Q5UA 1OW8A 2KLUA 4JF7A 1NYKA 4YXDC 2WSCH 3V2QA 2W6BA 5AEWA 4W7ZA 2HMMA 3HRNA 3R2PA 2QVAA 2BEQD 4QUQA 3H1LD 2YXQB 2XDJA 4GOFA 2KP8A 1YYCA 2FYUE 1GZLA 3C1LA 2ZYAA 4B86A 3CD6P 2Y9ZA 3AE2C 3G71P 5CJ0A 3S1KA 1EDLA 3HTKA 3CCRP 1LWUB 1MZ9A 2FFDA 1IK7A 4AAYB 1LTGC 5AVQB 1SFCB 2IPPA 5AVTB 3MP7B 3FWNA 5B66H 1LT9B 2JO1A 4GKGA 1HGZA 2Z5HA 1OVUA 1KYOD 3TNUA 4YTPC 1DEBA 1PGJA 2KUBA 3TYYA 2K9JB 1GL2A 3L71D 2WPQA 5APUA 1HBWA 3HD7C 4NBAD 3M06A 3CXHD 3B5ND 5CCGC 1N73B 2AXTE 5CCHD 1SQVJ 1KYOI 3M9HA 5AVUB 3CLQA 5KKZC 1SQBE 2QJKC 3H1HE 1AV1A 2AEMA 1T2KD 1ZP0C 2B24A 2N9BA 2XKMA 3P8CD 3PLNA 5APQA 3KHUA 3CXHI 2CKFA 4TLFA 1SQQE 1RY3A 1NAFA 1SP4A 1IFPA 3FXEA 2LXBA 1H89A 1RFSA 2Q1KA 2WSSH 3WUTA 2AEJA 2ZT9B 3U1AA 2WPVB 1BDDA 1NHLA 1NU1J 2GUVA 1FDIA 2FYNC 2CK3H 4H44B 5H2FE 3AEFC 4U3FJ 1SQVG 3P32A 4EI2A 1R8EA 2KXPB 2PGDA 4H13B 3RK2C 1RH5B 3VTPC 1VQ6P 1VQ7P 1M1JA 3AEGC 1LJ2A 2FYNB 1VQPP 4NPFX 2A45G 5CXMA 1YITP 3LIDA 3TGUG 4WB4A 2A06E 3VMYA 2B9BA 2PP6A 2O01J 2E43A 3KZIE 1BDCA 1HJ0A 4HJLA 1AVOA 1LTJA 2DE6D 1FDOA 2WITA 3VMXA 4U3FG 1VDFA 2I1KA 4HM1A 1NTZK 4N78D 3E1IA 2HR3A 3VCPA 2GUSA 1PP9E 2E5TA 1RE3C 2WT7B 2RN0A 1PGPA 2QA4P 1J2JB 2O01H 1Q82Q 4D6TJ 4CPGA 4WWIA 4TT3H 3USSA 3SWYA 4A7PA 2IBZG 1YJ9P 5HL4A 1UIXA 1FAVA 3H1KG 1X22A 1LTIC 4PD4H 3VMGD 5K5GB 5KTBA 1SQPK 1AFOA 3D71A 3C8VA 4LGDE 3CWBD 1YQ3C 3M91A 3GL0A 5AVYB 3FWLA 1VQOP 3GHGB 4N6JA 1JY2N 1KD1Q 4NPDA 2SPZA 1M1KQ 3LIEA 2YO3A 1EC5A 4XA4A 1LWUA 3Q3DA 4BRYB 1SFCA 1BCCD 1YI2P 4M3LA 1JCCA 5AVZB 3TDKA 1EDKA 4ZNCA 1KTMA 3QWOC 2FYUG 2Y0CA 1VF5C 3G6EP 4ASWA 5AW4B 2K9JA 1SQPD 1VQ9P 2O3JA 1SQBJ 1S3JA 5DJTB 3KPEA 1GMJA 1RF0C 2JR8A 4ZMDA 3L74J 1N73A 3L72E 1MV8A 5BU5A 2ZJSE 3JCUE 3IR9A 2YVJB 1N7SB 2IZ1A 2ZVOB 4GDOA 1BE3J 1L0NK 3PTZA 5AVRB 3OAKA 4PJ0E 2E75D 1ZR2A 2QJPC 4RKUJ 2FXPA 5KAFE 1JY3O 1GU4A 3H1JD 2QJYC 3L70E 4HM7A 2V7QJ 1J1EB 3G3ZA 3A5TA 1ZR4A 2YIUC 4N3YB 4IOIH 1HUCA 2QJPB 1X9VA 3G4SP 3EFFK 2HMKA 1G8JB 2QJYB 2GBWA 3AE1C 2BCCJ 3H1IJ 1FZBA 1SQBG 2OYOA 3H1HG 1T6AA 1ZRTD 5APVA 5E79H 3O8ZA 2OYHC 1VQ8P 1E5WA 1L0ND 3AEEC 3TSIA 1Q81Q 2NRGA 1SQQG 5KJ7A 1VQ5P 1SFCD 4OWFA 3GF7A 3VMAA 5CBNA 1T3JA 1EXJA 2V7QH 2YFLA 1FZCC 4P1BH 5B66E 1NTKE 1IZNB 1KFMA 2N1TC 1PP9D 1KV4A 3BRTB 3H1LE 2XV5A 3NFQA 4ASVA 1M7LA 2P67A 1L4AA 1SVFA 1VQKP 2CPBA 2W27A 2R3CA 3V2RA 3BCCD 3H1IG 4NBFD 1L0LE 3RBXA 4Z1MH 2HMLA 3AE6C 1KQGB 1KFNA 3AE8C 3KDPB 1GL2C 1OVVA 2ITAA 2JKVA 5AW6B 4Y99C 2WT7A 2A06G 2C0XA 5GTHH 3IFMA 2BMQA 1N8RQ 3ZDMA 1IK9A 1FJPA 3EFGA 3MUDA 5TISH 1SQXJ 2YXRB 1KYOE 3MHVA 1BSNA 3H32B 3L73J 2OYIA 2ZT9D 1JO5A 3L71E 3LW5H 2JZAA 3CCMP 2K3RA 3PH0A 2OTJP 3NTNA 1HTLC 1RF1C 3CXHE 1CI6B 1Q90D 4H44D 1GD2E 2QSIA 1PP9G 4H13D 1S9KD 1GU5A 2ZYLA 5KJ7D 2W6AA 4JYCA 3SSUA 4K3AA 1DEEG 1WRGA 3GHGA 3M0DC 1JY3N 3Q5PA 1OWAA 2R44A 1PV3A 1NKZB 2KNCB 2JEEA 2ZYDA 4IL6X 3IF4A 2XNXA 4AIVA 2D2CC 2P7JA 1SQXG 3L72D 4BRYA 1AA0A 4EOTA 1L2PA 5APSA 2WPRA 4IL6H 4EYYQ 3OJAB 2MJZA 2C0WA 1GW4A 1K05A 2E5YA 2JDIH 4AUWA 2HODB 1OVRA 1S5LX 5DJUB 1M90Q 1DD4A 5KLVE 3L75E 1FBMA 4WY4C 1Y8AA 5AVVB 1NTKK 4U7JA 1S5LH 1N7SA 1FE6A 3B8EB 3L70J 3RK3C 1IFNA 3F89A 4BWNA 1L0LK 1UIIA 3K5BA 4HKVA 2CPSA 1NVOA 2HMJA 3A0BH 3GTSA 2Q9IA 5AW7B 1O7GA 3KYQA 1QGKB 1LTBC 1VQ4P 1NTMK 1FQTA 3A2AA 2B89A 3L72G 2QRXA 3TF5A 1FDMA 3M9QA 1PIXA 1NKNA 4N78E 1NTKD 1NJIQ 4L75A 2KI7B 3JSVC 1BGYE 3A0HH 3T97B 1X0TA 3R4YA 2IFNA 3GW6A 3D89A 1PPJD 3Q1MA 2H89C 3L70G 3H6PA 4HYTB 1L0LD 3BATA 2YNYA 5B5EE 3I56P 3MD0A 3H1LJ 1JY2P 3CX5H 2IX7C 1GK4A 1URQC 1JEKA 1Y47A 1NTMD 2H7HA 2M0BA 2E76C 2DW3A 2IYOA 1RIEA 3AE3C 3CWBE 3CCSP 1URQB 1LGHB 4RJTA 1NTZE 3VN0A 1USDA 3N0QA 1JMMA 1N7SD 1FZGA 1PFIA 2XSHA 3VYIA 1HGVA 1G8KB 1YQ4C 2W90A 2VRSA 1GK6A 1NTKG 1NU1K 1G2CA 1JB0J 1BCCE 2J59M 3L71J 2R32A 5KLVK 4QDCA 3H1LG 3HD7B 4IFMA 4NBED 2YMYA 2XRXA 3WU2H 1O7PA 3H32A 4C7NA 1NDOA 1SQPE 5KKZB 1JY2O 2QJKB 1AVYA 3FXDA 3TGUJ 2HMOA 1CI6A 4DZOA 2LKMA 1RQVA 2YMKA 5E79E 1VQMP 3WMM0 2NPSC 3CC4P 2QE7H 2ZVNB 4DOJA 1NU1D 2YFJA 3FOUA 3H1JE 2KNCA 4Y28J 3L71G 5KLVD 4DJGA 3L75D 5C39A 2DE7D 2H8PD 2A45H 1RE4C 1KZUB 2Q3IA 3OA7A 1NGMB 2KZJA 4HM2A 1OIPA 2O1JA 3RK2B 1M56D 2K88A 2HODA 1ZRTE 1EZVD 4AYCA 3P7KA 4IFDK 2P10A 2YO2A 1YTZI 5KAIE 3ITKA 4H0LC 3NXSA 1S1CX 1L0NE 3O6QB 3H1KJ 3SFDC 2BASA 4QDFB 2Q7CA 3CPWO 4XFJA 4HM6A 2HFED 1EZVI 5TJHA 3L35A 2QEXP 2QG4A 4JYBA 5AW0B 4C7RA 1O7HA 3U59A 2ZXEB 1BGYD 1IFJA 4HM8A 4UB8E 2Y0EA 3AECC 3HUSC 2WVRA 2IZ0A 1KQFB 1M8OB 3UIAA 5KLVG 3L75G 3BCCE 4PD4I 4PV1C 4D6TD 3V5BA 4ZKUA 1VQNP 4QURA 4I7ZC 3PJSK 4OGQC 2FYUJ 3GL2A 5CBOA 1O7NA 4I1LA 3T97A 4WBAA 1SJGA 1JM1A 1EQ7A 3RL0C 1JNMA 2KSEA 4I7ZB 4OGQB 1Q2NA 2KIKA 1VQLP 1NYHA 1NTZD 2WTYA 4ZKPA 1JY3P 1MFZA 2RMZA 2KS1B 3HE4B 1OW7A 5L8RJ 1LT9A 2OGUA 3AE5C 3I5CA 4EDFA 1NH4A 4KT0J 1BGYG 1S9KE 1W2BO 2E42A 4QCKA 1JMBA 3PHLA 1BCCJ 2FXOA 1W5CE 2KSJA 3H1HJ 1LTTC 2Q6QA 3EQ2A 3CC2P 3AEAC 1VF5B 3L74D 1SQPJ 3WUUA 1DIPA 3AE4C 5AW3B 1DX7A 3VMID 3FGAD 1SQQJ 3HD7A 4NBGD 4L73A 1BE3D 1PZQA 3CWBG 1KILC 5CCGA 2LXCB 1NTZG 3AE7C 1VL2A 3B5NC 1NWQA 2ZYGA 5CCHC 5KLIC 2AXTH 1KILB 1ZOYC 1HJBA 3VP8A 4OH8B 4QDDA 5GTIH 1JTHB 1BCCG 2YIUB 2BMOA 1M57D 3B4SA 1K8AQ 2B87B 2HYNA 3GF3A 1KORA 1GW3A 2HPCB 1SQPG 4LC1A 3GCEA 4LLHA 1H8AA 3V4QA 2OYHB 5AW5B 3Q5SA 1URQD 1L0NJ 3HE5B 1JUNA 2Q3WA 4HM5A 2XU6A 3A3YB 1Y9BA 1OX3A 3M0AA 2FFDC 3O6QA 1FZCB 1WMKA 2Q3EA 4QDFA 3H1JG 1PPJE 3IAOA 4RESB 3KQGA 3CCUP 1SS1A 3SWFA 2N1TB 1FU1A 1PP9J 4I6MC 1CW5A 3HD7D 4QUPA 3BASA 2ZXXA 2QM8A 4DCKA 1EXIA 3TK1A 5CCGD 1S4XA 2I1JA 1YJNP 4HJGH 1NTME 3BCCJ 5APYA 4NBCD 2I7FA 3KZIH 4W7YA 3V2NA 2M5AB 1W2EA 1GL2B 3QH9A 1L0NG 2JWAA 4OVNF 1ULJA 4Y99B 1RE3A 5BU8B 1SLQA 1FOSE 2RH0A 5CJ4A 2K9YA 5CMZA 4L76A 1T8ZA 4C46A 5AW8B 1FJKA 1OFCX 2WMMA 3OW2O 1RF1B 1ZMEC 1NOHA 4K35A 3EN1A 3BCCG 5APWA 2KS1A 3RK2D 2E74C 1ZW0A 1HF9A 1YJWP 3HE4A 1LTSC 2WSFJ 3E7KA 1E79H 1M1JC 3V6IA 2E74B 2M3BA 3S4RA 1LP1B 2D2CB 2V4HA 4GOEA 3L72J 1KC8Q 1NU1E 3W67A 2AXCA 4U3FE 3AE9C 2GA1A 1N86A 1IJDB 4JPZB 3WUVA 1LTJC 2YKPA 2B88A 1OXZA 1KQLA 3GMAA 1H88A 1RF0A 4WY4B 2JO6A 2WSFH 2PRRA 2WZ7A 4YPCA 1EZVE 4UB6H 1GDTA 1QL2A 2GM4A 4IFFA 2WSEJ 2N9YB 5BVZA 3RK3B 3CX5D 2QIWA 3JCUH 2E75C 2OTLP 1RQUA 4PD4E 4OGQD 1S72P 5AW2B 3PP5A 1KB9H 1ZXGA 4WVZA 1P84I 5KAFH 2B87A 3CL3D 3CX5I 3D6ZA 2HPCA 2WWWA 3VCAA 4HM0A 2BMRA 1VM9A 1FC2C 1IFIA 1NTKJ 3GB4A 1OW6A 1P84H 2QPZA 4D6TE 2WSEH 3GZXA 2OYHA 1JM0A 1QVFO 2O01N 1SQVK
chains in the Genus database with same CATH topology
1PP9E 2YVJB 1L0NE 2NUMA 2XR8A 2XSHA 4P1CH 1P84E 4QCKA 3L73E 2E74D 4QDFB 3C0DA 2E75D 3CX5E 1G8KB 2CKFA 2QJPC 2D2CD 4QDFA 2BMQA 1SQQE 1PPJE 4HM6A 1NU1E 2E4QA 2HMNA 1NYKA 4NBBD 1BCCE 2QJYC 2BCCE 3L70E 1RFSA 4HM7A 3H1IE 1KYOE 3TGUE 2HMMA 4HKVA 4U3FE 4NBDD 5AEWA 2HMJA 2YIUC 3GTSA 4NBHD 1VF5D 4QDCA 4NBED 1O7GA 5HL4A 4QUPA 2ZT9D 2XRXA 4QUQA 3L71E 1O7HA 1VCKA 2JZAA 1O7PA 2E76D 3VMID 4NBGD 4HM8A 1NDOA 3VMGD 1NTME 2HMKA 1SQPE 1G8JB 4NBCD 2FYUE 2I7FA 2GBWA 2FYNC 1FQTA 3CXHE 4H44D 3BCCE 2JO6A 3DQYA 3GL0A 4H0LD 2HMOA 1EZVE 4H13D 5KLIC 4NB8D 4QURA 2ZYLA 1ULJA 3GTEA 2NVEA 1BGYE 2DE5D 4AAYB 3GZYA 3GL2A 4QDDA 5CXMA 3D89A 3GOBA 4HM4A 1O7WA 1O7NA 2E4PA 5AEUA 2XSOA 4HM3A 2GBXA 2NUKA 1SJGA 1JM1A 1EG9A 2YFJA 3EQQA 2A06E 2BMOA 2YFLA 4AIVA 5BOKA 3FOUA 3H1JE 4PD4E 4P1BH 4OGQD 4NB9D 1UUWA 1NTKE 2DE7D 3L74E 3VMHD 1UUVA 2NVGA 2IBZE 3H1LE 4HM2A 3GCEA 2B1XA 2YFIA 4HJLA 2DE6D 3H1KE 3EN1A 3VCAA 1BE3E 4HM0A 1KB9E 4NBAD 2BMRA 1VM9A 1WQLA 4EMJB 2NWFA 4PV1D 1RIEA 3CWBE 4NBFD 1L0LE 3GB4A 4HM1A 1ZRTE 3L72E 5KKZC 2QPZA 2HMLA 1ULIA 1NTZE 4D6TE 1SQBE 5KLVE 1Q90C 3H1HE 3L75E 2QJKC 1O7MA 3GZXA 1SQVE 2Q3WA 3N0QA 1SQXE 3GKEA 2NVFA 3AZCA 3VCPA 4HM5A 2B24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 E;  2YVJ B;  1L0N E;  2NUM A;  2XR8 A;  2XSH A;  4P1C H;  1P84 E;  4QCK A;  3L73 E;  2E74 D;  4QDF B;  3C0D A;  2E75 D;  3CX5 E;  1G8K B;  2CKF A;  2QJP C;  2D2C D;  4QDF A;  2BMQ A;  1SQQ E;  1PPJ E;  4HM6 A;  1NU1 E;  2E4Q A;  2HMN A;  1NYK A;  4NBB D;  1BCC E;  2QJY C;  2BCC E;  3L70 E;  1RFS A;  4HM7 A;  3H1I E;  1KYO E;  3TGU E;  2HMM A;  4HKV A;  4U3F E;  4NBD D;  5AEW A;  2HMJ A;  2YIU C;  3GTS A;  4NBH D;  1VF5 D;  4QDC A;  4NBE D;  1O7G A;  5HL4 A;  4QUP A;  2ZT9 D;  2XRX A;  4QUQ A;  3L71 E;  1O7H A;  1VCK A;  2JZA A;  1O7P A;  2E76 D;  3VMI D;  4NBG D;  4HM8 A;  1NDO A;  3VMG D;  1NTM E;  2HMK A;  1SQP E;  1G8J B;  4NBC D;  2FYU E;  2I7F A;  2GBW A;  2FYN C;  1FQT A;  3CXH E;  4H44 D;  3BCC E;  2JO6 A;  3DQY A;  3GL0 A;  4H0L D;  2HMO A;  1EZV E;  4H13 D;  5KLI C;  4NB8 D;  4QUR A;  2ZYL A;  1ULJ A;  3GTE A;  2NVE A;  1BGY E;  2DE5 D;  4AAY B;  3GZY A;  3GL2 A;  4QDD A;  5CXM A;  3D89 A;  3GOB A;  4HM4 A;  1O7W A;  1O7N A;  2E4P A;  5AEU A;  2XSO A;  4HM3 A;  2GBX A;  2NUK A;  1SJG A;  1JM1 A;  1EG9 A;  2YFJ A;  3EQQ A;  2A06 E;  2BMO A;  2YFL A;  4AIV A;  5BOK A;  3FOU A;  3H1J E;  4PD4 E;  4P1B H;  4OGQ D;  4NB9 D;  1UUW A;  1NTK E;  2DE7 D;  3L74 E;  3VMH D;  1UUV A;  2NVG A;  2IBZ E;  3H1L E;  4HM2 A;  3GCE A;  2B1X A;  2YFI A;  4HJL A;  2DE6 D;  3H1K E;  3EN1 A;  3VCA A;  1BE3 E;  4HM0 A;  1KB9 E;  4NBA D;  2BMR A;  1VM9 A;  1WQL A;  4EMJ B;  2NWF A;  4PV1 D;  1RIE A;  3CWB E;  4NBF D;  1L0L E;  3GB4 A;  4HM1 A;  1ZRT E;  3L72 E;  5KKZ C;  2QPZ A;  2HML A;  1ULI A;  1NTZ E;  4D6T E;  1SQB E;  5KLV E;  1Q90 C;  3H1H E;  3L75 E;  2QJK C;  1O7M A;  3GZX A;  1SQV E;  2Q3W A;  3N0Q A;  1SQX E;  3GKE A;  2NVF A;  3AZC A;  3VCP A;  4HM5 A;  2B24 A; 
#chains in the Genus database with same CATH topology
 3HE5 A;  1MKM A;  1OZH A;  1L0L J;  1AQT A;  1FS0 E;  3F5H A;  1K73 Q;  1LWU C;  5AVW B;  1NO4 A;  2HMN A;  1SFC C;  1FZC A;  1LT9 C;  2C9L Y;  2K37 A;  1VF5 D;  1NTM J;  2N1T A;  1IFM A;  2XND H;  2E76 B;  2JJL A;  1QVG O;  1OMI A;  4HH2 A;  1KN7 A;  5AW9 B;  3FX0 A;  2G8Y A;  1N73 C;  2M5A A;  1SQV D;  4NB8 D;  4NPE A;  2P1J A;  1KIL D;  1PPJ G;  4HM4 A;  1L0L G;  2H88 C;  3VOP A;  5BOK A;  3V2P A;  5GTI E;  3L37 A;  3TGU D;  1UUW A;  3L74 E;  1YHQ P;  1NTM G;  4YXW H;  1UUV A;  1YIJ P;  3RK3 E;  3N7N A;  2ZT9 C;  1KYO H;  1A02 F;  2A45 I;  1RF1 A;  1BE3 E;  2OTK E;  2R5B A;  3RL0 g;  1K9M Q;  2R5D A;  3CCV P;  1ULI A;  1Q90 C;  4H44 C;  3RGU A;  4GIF A;  2FY8 A;  4U3F D;  3VP9 A;  1N2D C;  2I8D A;  3CXH H;  1NAY A;  1EDJ A;  4H13 C;  3C9I A;  2NPS B;  3M0D A;  4P1C H;  3G9R A;  3SFE C;  5KJ7 C;  2JP3 A;  1LNQ A;  2FBW C;  5KLV J;  1LP1 A;  3L75 J;  2W6J H;  2BCC E;  3H1I E;  2N1T D;  1X8Y A;  2POH A;  3II6 A;  4JQ0 D;  4W80 A;  4QMA A;  2PFX A;  2LR2 A;  2PAJ A;  2IBZ D;  1IFD A;  3H1K D;  3CCL P;  1HH0 A;  2WQY C;  3MTU E;  2FYU K;  3EWK A;  1QLE D;  1L4A C;  3GG2 A;  4H0L B;  2KLV A;  4PD4 D;  1GL2 D;  2J58 A;  4WY4 A;  5GTH E;  3CMA P;  3U1C A;  3BVH A;  2IBZ I;  2NVE A;  5TIS E;  3GLM A;  1L4A B;  1USE A;  3D6Y A;  1NU1 G;  5CHX A;  1DD3 A;  2M8R A;  4HM3 A;  2C9N Y;  3EQQ A;  3MUD C;  2ZAE B;  1K04 A;  2MKV A;  1LTA C;  3SWK A;  1BGY J;  5APX A;  2OYI C;  3HUS B;  2P58 A;  3NMD A;  3MZW B;  2NVG A;  1YTZ T;  2YFI A;  1IC2 A;  2FYU D;  1FZF A;  4PV1 B;  4EMJ B;  1EZV G;  1QL1 A;  1H0T B;  1RHZ B;  2OYI B;  4KJM A;  2FKW B;  3ABV C;  1SQB K;  1SQX E;  2NVF A;  2KYV A;  4GT1 A;  2NUM A;  2E74 D;  3L73 E;  3GHG C;  3RL0 B;  1R5L A;  1KQS O;  3CWB J;  2W83 C;  2D2C D;  1S2E A;  4RO0 A;  1NTZ J;  1SQQ K;  4IL6 E;  3Q5R A;  3D70 A;  4NBD D;  1JOC A;  4AQR D;  1URQ A;  2K1A A;  1VCK A;  1BSH A;  2YKO A;  3BRV B;  4I2L C;  5B5E H;  2P2U A;  5AW1 B;  4D6T G;  1S5L E;  4WY4 D;  1Z56 A;  1SQB D;  3H1H D;  1TU3 F;  3RBZ A;  3GTE A;  3B71 A;  5EFW B;  2L5G B;  2J5U A;  1KMI Z;  2IFM A;  1QEX A;  4UB6 E;  2Z4E A;  3RK3 D;  3GZY A;  2ZFC A;  3A0B E;  1N7S C;  1YBK A;  2XSO A;  1SQQ D;  2Z5I A;  1EG9 A;  1CZQ A;  2KZI A;  4MN4 C;  1LT1 A;  3VMH D;  1AJY A;  1J1E C;  2OQQ A;  1T2K C;  2B1X A;  2JWD A;  3JC2 2;  1KB9 E;  2IDB A;  1G1I A;  3B5N B;  3H1J J;  5KLI B;  3A0H E;  1X79 B;  2KK7 A;  4DT0 A;  1EDI A;  1FOS F;  2BCC D;  2M3E A;  3H1I D;  3GKE A;  2KOG A;  3CCE P;  2NZ2 A;  2OAR A;  1ZLL A;  1P84 E;  2RKL A;  2WPS A;  3CX5 E;  2NPS A;  2A06 D;  3S9O A;  2BEZ F;  2W8Z A;  3L74 G;  2KB7 P;  3I55 P;  1JCD A;  2IYP A;  1RE4 A;  5APT A;  1SQX K;  5H2F H;  3CME P;  4R4M A;  1BE3 G;  2E76 D;  1Q86 Q;  3PRJ A;  4JBZ A;  4GOD A;  3CCJ P;  3Q2Y A;  3CCQ P;  3DQY A;  1FZA A;  3MGN A;  1AQ5 A;  3E1R A;  3HTK B;  3VMZ A;  2FFD B;  3AEB C;  2DE5 D;  3A7O A;  3W68 A;  3LW5 J;  1FZE A;  1XTC C;  1IO4 A;  1U57 A;  2E4P A;  1A02 J;  1PGQ A;  5KAI H;  2G3A A;  2L91 A;  2BCC G;  3TNU B;  3WU2 E;  2FYZ A;  1ZN5 A;  3V4W A;  1SQX D;  1WT6 A;  4BXL A;  1PL5 A;  1U7J A;  4EIJ A;  1PGO A;  3L73 D;  3CI9 A;  3P8M C;  3HUS A;  1G2C B;  1WQL A;  2UWJ E;  2NWF A;  2HG5 D;  1T3U A;  4UB8 H;  1H0T A;  2HLO A;  2H43 A;  1SQV E;  4C7N B;  1QX8 A;  3AZC A;  1KIL E;  2NPS D;  3C0D A;  3L4F A;  1DH3 A;  1VPC A;  3IN6 A;  1XTG B;  4HB1 A;  2E4Q A;  3N4X A;  4NBB D;  1MUU A;  3TGU E;  1MFT A;  4NBH D;  2AEF A;  1Q7Y Q;  2XZR A;  1HVV A;  4XE5 B;  3P8C E;  1D7M A;  4R4L A;  3CC7 P;  2QM7 A;  2Y9Y A;  1M1J B;  4H0L D;  3L73 G;  4O9B A;  5M1B A;  4KHX A;  3H25 A;  1CSB A;  1L4A D;  3GOB A;  3L36 A;  1O7W A;  5AEU A;  1ZV8 A;  1KB9 D;  1GTW A;  2GBX A;  2NUK A;  2O1K A;  2R3S A;  3L70 D;  4NB9 D;  1G1J A;  4HKZ H;  1J1D C;  2WSC J;  1LTJ B;  2IBZ E;  1P84 D;  3H1K E;  3MIW A;  1KB9 I;  1KIL A;  2FXM A;  2YKQ A;  1N7L A;  3KXD A;  4PV1 D;  1J1D B;  1HWT C;  3AED C;  3B5N A;  5CCH A;  1JTH A;  1R5S A;  1O7M A;  4PJ0 H;  5AVS B;  5AVX B;  3M9B A;  4L74 A;  2XR8 A;  1U7M A;  2E75 B;  2Y0D A;  3RL0 D;  2Q5U A;  1OW8 A;  2KLU A;  4JF7 A;  1NYK A;  4YXD C;  2WSC H;  3V2Q A;  2W6B A;  5AEW A;  4W7Z A;  2HMM A;  3HRN A;  3R2P A;  2QVA A;  2BEQ D;  4QUQ A;  3H1L D;  2YXQ B;  2XDJ A;  4GOF A;  2KP8 A;  1YYC A;  2FYU E;  1GZL A;  3C1L A;  2ZYA A;  4B86 A;  3CD6 P;  2Y9Z A;  3AE2 C;  3G71 P;  5CJ0 A;  3S1K A;  1EDL A;  3HTK A;  3CCR P;  1LWU B;  1MZ9 A;  2FFD A;  1IK7 A;  4AAY B;  1LTG C;  5AVQ B;  1SFC B;  2IPP A;  5AVT B;  3MP7 B;  3FWN A;  5B66 H;  1LT9 B;  2JO1 A;  4GKG A;  1HGZ A;  2Z5H A;  1OVU A;  1KYO D;  3TNU A;  4YTP C;  1DEB A;  1PGJ A;  2KUB A;  3TYY A;  2K9J B;  1GL2 A;  3L71 D;  2WPQ A;  5APU A;  1HBW A;  3HD7 C;  4NBA D;  3M06 A;  3CXH D;  3B5N D;  5CCG C;  1N73 B;  2AXT E;  5CCH D;  1SQV J;  1KYO I;  3M9H A;  5AVU B;  3CLQ A;  5KKZ C;  1SQB E;  2QJK C;  3H1H E;  1AV1 A;  2AEM A;  1T2K D;  1ZP0 C;  2B24 A;  2N9B A;  2XKM A;  3P8C D;  3PLN A;  5APQ A;  3KHU A;  3CXH I;  2CKF A;  4TLF A;  1SQQ E;  1RY3 A;  1NAF A;  1SP4 A;  1IFP A;  3FXE A;  2LXB A;  1H89 A;  1RFS A;  2Q1K A;  2WSS H;  3WUT A;  2AEJ A;  2ZT9 B;  3U1A A;  2WPV B;  1BDD A;  1NHL A;  1NU1 J;  2GUV A;  1FDI A;  2FYN C;  2CK3 H;  4H44 B;  5H2F E;  3AEF C;  4U3F J;  1SQV G;  3P32 A;  4EI2 A;  1R8E A;  2KXP B;  2PGD A;  4H13 B;  3RK2 C;  1RH5 B;  3VTP C;  1VQ6 P;  1VQ7 P;  1M1J A;  3AEG C;  1LJ2 A;  2FYN B;  1VQP P;  4NPF X;  2A45 G;  5CXM A;  1YIT P;  3LID A;  3TGU G;  4WB4 A;  2A06 E;  3VMY A;  2B9B A;  2PP6 A;  2O01 J;  2E43 A;  3KZI E;  1BDC A;  1HJ0 A;  4HJL A;  1AVO A;  1LTJ A;  2DE6 D;  1FDO A;  2WIT A;  3VMX A;  4U3F G;  1VDF A;  2I1K A;  4HM1 A;  1NTZ K;  4N78 D;  3E1I A;  2HR3 A;  3VCP A;  2GUS A;  1PP9 E;  2E5T A;  1RE3 C;  2WT7 B;  2RN0 A;  1PGP A;  2QA4 P;  1J2J B;  2O01 H;  1Q82 Q;  4D6T J;  4CPG A;  4WWI A;  4TT3 H;  3USS A;  3SWY A;  4A7P A;  2IBZ G;  1YJ9 P;  5HL4 A;  1UIX A;  1FAV A;  3H1K G;  1X22 A;  1LTI C;  4PD4 H;  3VMG D;  5K5G B;  5KTB A;  1SQP K;  1AFO A;  3D71 A;  3C8V A;  4LGD E;  3CWB D;  1YQ3 C;  3M91 A;  3GL0 A;  5AVY B;  3FWL A;  1VQO P;  3GHG B;  4N6J A;  1JY2 N;  1KD1 Q;  4NPD A;  2SPZ A;  1M1K Q;  3LIE A;  2YO3 A;  1EC5 A;  4XA4 A;  1LWU A;  3Q3D A;  4BRY B;  1SFC A;  1BCC D;  1YI2 P;  4M3L A;  1JCC A;  5AVZ B;  3TDK A;  1EDK A;  4ZNC A;  1KTM A;  3QWO C;  2FYU G;  2Y0C A;  1VF5 C;  3G6E P;  4ASW A;  5AW4 B;  2K9J A;  1SQP D;  1VQ9 P;  2O3J A;  1SQB J;  1S3J A;  5DJT B;  3KPE A;  1GMJ A;  1RF0 C;  2JR8 A;  4ZMD A;  3L74 J;  1N73 A;  3L72 E;  1MV8 A;  5BU5 A;  2ZJS E;  3JCU E;  3IR9 A;  2YVJ B;  1N7S B;  2IZ1 A;  2ZVO B;  4GDO A;  1BE3 J;  1L0N K;  3PTZ A;  5AVR B;  3OAK A;  4PJ0 E;  2E75 D;  1ZR2 A;  2QJP C;  4RKU J;  2FXP A;  5KAF E;  1JY3 O;  1GU4 A;  3H1J D;  2QJY C;  3L70 E;  4HM7 A;  2V7Q J;  1J1E B;  3G3Z A;  3A5T A;  1ZR4 A;  2YIU C;  4N3Y B;  4IOI H;  1HUC A;  2QJP B;  1X9V A;  3G4S P;  3EFF K;  2HMK A;  1G8J B;  2QJY B;  2GBW A;  3AE1 C;  2BCC J;  3H1I J;  1FZB A;  1SQB G;  2OYO A;  3H1H G;  1T6A A;  1ZRT D;  5APV A;  5E79 H;  3O8Z A;  2OYH C;  1VQ8 P;  1E5W A;  1L0N D;  3AEE C;  3TSI A;  1Q81 Q;  2NRG A;  1SQQ G;  5KJ7 A;  1VQ5 P;  1SFC D;  4OWF A;  3GF7 A;  3VMA A;  5CBN A;  1T3J A;  1EXJ A;  2V7Q H;  2YFL A;  1FZC C;  4P1B H;  5B66 E;  1NTK E;  1IZN B;  1KFM A;  2N1T C;  1PP9 D;  1KV4 A;  3BRT B;  3H1L E;  2XV5 A;  3NFQ A;  4ASV A;  1M7L A;  2P67 A;  1L4A A;  1SVF A;  1VQK P;  2CPB A;  2W27 A;  2R3C A;  3V2R A;  3BCC D;  3H1I G;  4NBF D;  1L0L E;  3RBX A;  4Z1M H;  2HML A;  3AE6 C;  1KQG B;  1KFN A;  3AE8 C;  3KDP B;  1GL2 C;  1OVV A;  2ITA A;  2JKV A;  5AW6 B;  4Y99 C;  2WT7 A;  2A06 G;  2C0X A;  5GTH H;  3IFM A;  2BMQ A;  1N8R Q;  3ZDM A;  1IK9 A;  1FJP A;  3EFG A;  3MUD A;  5TIS H;  1SQX J;  2YXR B;  1KYO E;  3MHV A;  1BSN A;  3H32 B;  3L73 J;  2OYI A;  2ZT9 D;  1JO5 A;  3L71 E;  3LW5 H;  2JZA A;  3CCM P;  2K3R A;  3PH0 A;  2OTJ P;  3NTN A;  1HTL C;  1RF1 C;  3CXH E;  1CI6 B;  1Q90 D;  4H44 D;  1GD2 E;  2QSI A;  1PP9 G;  4H13 D;  1S9K D;  1GU5 A;  2ZYL A;  5KJ7 D;  2W6A A;  4JYC A;  3SSU A;  4K3A A;  1DEE G;  1WRG A;  3GHG A;  3M0D C;  1JY3 N;  3Q5P A;  1OWA A;  2R44 A;  1PV3 A;  1NKZ B;  2KNC B;  2JEE A;  2ZYD A;  4IL6 X;  3IF4 A;  2XNX A;  4AIV A;  2D2C C;  2P7J A;  1SQX G;  3L72 D;  4BRY A;  1AA0 A;  4EOT A;  1L2P A;  5APS A;  2WPR A;  4IL6 H;  4EYY Q;  3OJA B;  2MJZ A;  2C0W A;  1GW4 A;  1K05 A;  2E5Y A;  2JDI H;  4AUW A;  2HOD B;  1OVR A;  1S5L X;  5DJU B;  1M90 Q;  1DD4 A;  5KLV E;  3L75 E;  1FBM A;  4WY4 C;  1Y8A A;  5AVV B;  1NTK K;  4U7J A;  1S5L H;  1N7S A;  1FE6 A;  3B8E B;  3L70 J;  3RK3 C;  1IFN A;  3F89 A;  4BWN A;  1L0L K;  1UII A;  3K5B A;  4HKV A;  2CPS A;  1NVO A;  2HMJ A;  3A0B H;  3GTS A;  2Q9I A;  5AW7 B;  1O7G A;  3KYQ A;  1QGK B;  1LTB C;  1VQ4 P;  1NTM K;  1FQT A;  3A2A A;  2B89 A;  3L72 G;  2QRX A;  3TF5 A;  1FDM A;  3M9Q A;  1PIX A;  1NKN A;  4N78 E;  1NTK D;  1NJI Q;  4L75 A;  2KI7 B;  3JSV C;  1BGY E;  3A0H H;  3T97 B;  1X0T A;  3R4Y A;  2IFN A;  3GW6 A;  3D89 A;  1PPJ D;  3Q1M A;  2H89 C;  3L70 G;  3H6P A;  4HYT B;  1L0L D;  3BAT A;  2YNY A;  5B5E E;  3I56 P;  3MD0 A;  3H1L J;  1JY2 P;  3CX5 H;  2IX7 C;  1GK4 A;  1URQ C;  1JEK A;  1Y47 A;  1NTM D;  2H7H A;  2M0B A;  2E76 C;  2DW3 A;  2IYO A;  1RIE A;  3AE3 C;  3CWB E;  3CCS P;  1URQ B;  1LGH B;  4RJT A;  1NTZ E;  3VN0 A;  1USD A;  3N0Q A;  1JMM A;  1N7S D;  1FZG A;  1PFI A;  2XSH A;  3VYI A;  1HGV A;  1G8K B;  1YQ4 C;  2W90 A;  2VRS A;  1GK6 A;  1NTK G;  1NU1 K;  1G2C A;  1JB0 J;  1BCC E;  2J59 M;  3L71 J;  2R32 A;  5KLV K;  4QDC A;  3H1L G;  3HD7 B;  4IFM A;  4NBE D;  2YMY A;  2XRX A;  3WU2 H;  1O7P A;  3H32 A;  4C7N A;  1NDO A;  1SQP E;  5KKZ B;  1JY2 O;  2QJK B;  1AVY A;  3FXD A;  3TGU J;  2HMO A;  1CI6 A;  4DZO A;  2LKM A;  1RQV A;  2YMK A;  5E79 E;  1VQM P;  3WMM 0;  2NPS C;  3CC4 P;  2QE7 H;  2ZVN B;  4DOJ A;  1NU1 D;  2YFJ A;  3FOU A;  3H1J E;  2KNC A;  4Y28 J;  3L71 G;  5KLV D;  4DJG A;  3L75 D;  5C39 A;  2DE7 D;  2H8P D;  2A45 H;  1RE4 C;  1KZU B;  2Q3I A;  3OA7 A;  1NGM B;  2KZJ A;  4HM2 A;  1OIP A;  2O1J A;  3RK2 B;  1M56 D;  2K88 A;  2HOD A;  1ZRT E;  1EZV D;  4AYC A;  3P7K A;  4IFD K;  2P10 A;  2YO2 A;  1YTZ I;  5KAI E;  3ITK A;  4H0L C;  3NXS A;  1S1C X;  1L0N E;  3O6Q B;  3H1K J;  3SFD C;  2BAS A;  4QDF B;  2Q7C A;  3CPW O;  4XFJ A;  4HM6 A;  2HFE D;  1EZV I;  5TJH A;  3L35 A;  2QEX P;  2QG4 A;  4JYB A;  5AW0 B;  4C7R A;  1O7H A;  3U59 A;  2ZXE B;  1BGY D;  1IFJ A;  4HM8 A;  4UB8 E;  2Y0E A;  3AEC C;  3HUS C;  2WVR A;  2IZ0 A;  1KQF B;  1M8O B;  3UIA A;  5KLV G;  3L75 G;  3BCC E;  4PD4 I;  4PV1 C;  4D6T D;  3V5B A;  4ZKU A;  1VQN P;  4QUR A;  4I7Z C;  3PJS K;  4OGQ C;  2FYU J;  3GL2 A;  5CBO A;  1O7N A;  4I1L A;  3T97 A;  4WBA A;  1SJG A;  1JM1 A;  1EQ7 A;  3RL0 C;  1JNM A;  2KSE A;  4I7Z B;  4OGQ B;  1Q2N A;  2KIK A;  1VQL P;  1NYH A;  1NTZ D;  2WTY A;  4ZKP A;  1JY3 P;  1MFZ A;  2RMZ A;  2KS1 B;  3HE4 B;  1OW7 A;  5L8R J;  1LT9 A;  2OGU A;  3AE5 C;  3I5C A;  4EDF A;  1NH4 A;  4KT0 J;  1BGY G;  1S9K E;  1W2B O;  2E42 A;  4QCK A;  1JMB A;  3PHL A;  1BCC J;  2FXO A;  1W5C E;  2KSJ A;  3H1H J;  1LTT C;  2Q6Q A;  3EQ2 A;  3CC2 P;  3AEA C;  1VF5 B;  3L74 D;  1SQP J;  3WUU A;  1DIP A;  3AE4 C;  5AW3 B;  1DX7 A;  3VMI D;  3FGA D;  1SQQ J;  3HD7 A;  4NBG D;  4L73 A;  1BE3 D;  1PZQ A;  3CWB G;  1KIL C;  5CCG A;  2LXC B;  1NTZ G;  3AE7 C;  1VL2 A;  3B5N C;  1NWQ A;  2ZYG A;  5CCH C;  5KLI C;  2AXT H;  1KIL B;  1ZOY C;  1HJB A;  3VP8 A;  4OH8 B;  4QDD A;  5GTI H;  1JTH B;  1BCC G;  2YIU B;  2BMO A;  1M57 D;  3B4S A;  1K8A Q;  2B87 B;  2HYN A;  3GF3 A;  1KOR A;  1GW3 A;  2HPC B;  1SQP G;  4LC1 A;  3GCE A;  4LLH A;  1H8A A;  3V4Q A;  2OYH B;  5AW5 B;  3Q5S A;  1URQ D;  1L0N J;  3HE5 B;  1JUN A;  2Q3W A;  4HM5 A;  2XU6 A;  3A3Y B;  1Y9B A;  1OX3 A;  3M0A A;  2FFD C;  3O6Q A;  1FZC B;  1WMK A;  2Q3E A;  4QDF A;  3H1J G;  1PPJ E;  3IAO A;  4RES B;  3KQG A;  3CCU P;  1SS1 A;  3SWF A;  2N1T B;  1FU1 A;  1PP9 J;  4I6M C;  1CW5 A;  3HD7 D;  4QUP A;  3BAS A;  2ZXX A;  2QM8 A;  4DCK A;  1EXI A;  3TK1 A;  5CCG D;  1S4X A;  2I1J A;  1YJN P;  4HJG H;  1NTM E;  3BCC J;  5APY A;  4NBC D;  2I7F A;  3KZI H;  4W7Y A;  3V2N A;  2M5A B;  1W2E A;  1GL2 B;  3QH9 A;  1L0N G;  2JWA A;  4OVN F;  1ULJ A;  4Y99 B;  1RE3 A;  5BU8 B;  1SLQ A;  1FOS E;  2RH0 A;  5CJ4 A;  2K9Y A;  5CMZ A;  4L76 A;  1T8Z A;  4C46 A;  5AW8 B;  1FJK A;  1OFC X;  2WMM A;  3OW2 O;  1RF1 B;  1ZME C;  1NOH A;  4K35 A;  3EN1 A;  3BCC G;  5APW A;  2KS1 A;  3RK2 D;  2E74 C;  1ZW0 A;  1HF9 A;  1YJW P;  3HE4 A;  1LTS C;  2WSF J;  3E7K A;  1E79 H;  1M1J C;  3V6I A;  2E74 B;  2M3B A;  3S4R A;  1LP1 B;  2D2C B;  2V4H A;  4GOE A;  3L72 J;  1KC8 Q;  1NU1 E;  3W67 A;  2AXC A;  4U3F E;  3AE9 C;  2GA1 A;  1N86 A;  1IJD B;  4JPZ B;  3WUV A;  1LTJ C;  2YKP A;  2B88 A;  1OXZ A;  1KQL A;  3GMA A;  1H88 A;  1RF0 A;  4WY4 B;  2JO6 A;  2WSF H;  2PRR A;  2WZ7 A;  4YPC A;  1EZV E;  4UB6 H;  1GDT A;  1QL2 A;  2GM4 A;  4IFF A;  2WSE J;  2N9Y B;  5BVZ A;  3RK3 B;  3CX5 D;  2QIW A;  3JCU H;  2E75 C;  2OTL P;  1RQU A;  4PD4 E;  4OGQ D;  1S72 P;  5AW2 B;  3PP5 A;  1KB9 H;  1ZXG A;  4WVZ A;  1P84 I;  5KAF H;  2B87 A;  3CL3 D;  3CX5 I;  3D6Z A;  2HPC A;  2WWW A;  3VCA A;  4HM0 A;  2BMR A;  1VM9 A;  1FC2 C;  1IFI A;  1NTK J;  3GB4 A;  1OW6 A;  1P84 H;  2QPZ A;  4D6T E;  2WSE H;  3GZX A;  2OYH A;  1JM0 A;  1QVF O;  2O01 N;  1SQV K; 
#chains in the Genus database with same CATH homology
 1PP9 E;  2YVJ B;  1L0N E;  2NUM A;  2XR8 A;  2XSH A;  4P1C H;  1P84 E;  4QCK A;  3L73 E;  2E74 D;  4QDF B;  3C0D A;  2E75 D;  3CX5 E;  1G8K B;  2CKF A;  2QJP C;  2D2C D;  4QDF A;  2BMQ A;  1SQQ E;  1PPJ E;  4HM6 A;  1NU1 E;  2E4Q A;  2HMN A;  1NYK A;  4NBB D;  1BCC E;  2QJY C;  2BCC E;  3L70 E;  1RFS A;  4HM7 A;  3H1I E;  1KYO E;  3TGU E;  2HMM A;  4HKV A;  4U3F E;  4NBD D;  5AEW A;  2HMJ A;  2YIU C;  3GTS A;  4NBH D;  1VF5 D;  4QDC A;  4NBE D;  1O7G A;  5HL4 A;  4QUP A;  2ZT9 D;  2XRX A;  4QUQ A;  3L71 E;  1O7H A;  1VCK A;  2JZA A;  1O7P A;  2E76 D;  3VMI D;  4NBG D;  4HM8 A;  1NDO A;  3VMG D;  1NTM E;  2HMK A;  1SQP E;  1G8J B;  4NBC D;  2FYU E;  2I7F A;  2GBW A;  2FYN C;  1FQT A;  3CXH E;  4H44 D;  3BCC E;  2JO6 A;  3DQY A;  3GL0 A;  4H0L D;  2HMO A;  1EZV E;  4H13 D;  5KLI C;  4NB8 D;  4QUR A;  2ZYL A;  1ULJ A;  3GTE A;  2NVE A;  1BGY E;  2DE5 D;  4AAY B;  3GZY A;  3GL2 A;  4QDD A;  5CXM A;  3D89 A;  3GOB A;  4HM4 A;  1O7W A;  1O7N A;  2E4P A;  5AEU A;  2XSO A;  4HM3 A;  2GBX A;  2NUK A;  1SJG A;  1JM1 A;  1EG9 A;  2YFJ A;  3EQQ A;  2A06 E;  2BMO A;  2YFL A;  4AIV A;  5BOK A;  3FOU A;  3H1J E;  4PD4 E;  4P1B H;  4OGQ D;  4NB9 D;  1UUW A;  1NTK E;  2DE7 D;  3L74 E;  3VMH D;  1UUV A;  2NVG A;  2IBZ E;  3H1L E;  4HM2 A;  3GCE A;  2B1X A;  2YFI A;  4HJL A;  2DE6 D;  3H1K E;  3EN1 A;  3VCA A;  1BE3 E;  4HM0 A;  1KB9 E;  4NBA D;  2BMR A;  1VM9 A;  1WQL A;  4EMJ B;  2NWF A;  4PV1 D;  1RIE A;  3CWB E;  4NBF D;  1L0L E;  3GB4 A;  4HM1 A;  1ZRT E;  3L72 E;  5KKZ C;  2QPZ A;  2HML A;  1ULI A;  1NTZ E;  4D6T E;  1SQB E;  5KLV E;  1Q90 C;  3H1H E;  3L75 E;  2QJK C;  1O7M A;  3GZX A;  1SQV E;  2Q3W A;  3N0Q A;  1SQX E;  3GKE A;  2NVF A;  3AZC A;  3VCP A;  4HM5 A;  2B24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...