5CXMA

Crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
b'TVNVGTMADLKAKGELKGNTPKGPVTVVPNGNSGQISAVNPTCTHNGCQVNWKKANGKFVCPCHGAEFAATGKVLKGPAIRDLPTYATQVSGNNILVKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6/f complex iron-sulfur subunit
publication title Structural and functional characterisation of the cyanobacterial PetC3 Rieske protein family.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Metal binding protein
total genus 17
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5cxmA00
1Q90C 2YVJB 2NVGA 3GZXA 4QUQA 2HMLA 4NBBD 2YFLA 4NBED 3GZYA 2B24A 1ULJA 2E4PA 2HMOA 1KYOE 4NB8D 2NUKA 1O7MA 3H1IE 4NBAD 3GTSA 2QPZA 1UUVA 3CXHE 1NTZE 2NUMA 1O7GA 3N0QA 2NWFA 2YFJA 4QDFA 3C0DA 3EQQA 2HMJA 2YIUC 3D89A 2QJKC 4QDDA 1WQLA 3AZCA 2JZAA 3H1JE 1VM9A 1NU1E 4EMJB 1SQVE 1RFSA 2XSHA 1SQBE 4NB9D 4NBFD 4HM4A 1KB9E 3L74E 4QUPA 1SQQE 2XR8A 3H1LE 4QDFB 4P1CH 4QDCA 5HL4A 1P84E 5AEUA 1EG9A 4HJLA 3VCAA 3H1KE 2QJYC 2ZYLA 3FOUA 2D2CD 2FYUE 1NYKA 4QURA 3L75E 1ULIA 1NTKE 2BMOA 3L70E 4HKVA 3CWBE 3H1HE 2DE5D 4HM0A 5KKZC 4QCKA 1VCKA 1O7HA 2CKFA 1L0NE 1L0LE 4HM7A 1G8KB 2BMQA 3VMID 2IBZE 4HM3A 2A06E 2NVFA 2NVEA 4NBGD 2GBWA 2DE7D 4PD4E 2E4QA 2HMNA 1BCCE 5KLIC 2GBXA 2E76D 2YFIA 1BE3E 1G8JB 3GKEA 1UUWA 2ZT9D 5BOKA 4HM6A 2XSOA 4OGQD 1O7NA 3VMHD 3BCCE 2E74D 4NBCD 4AAYB 5AEWA 3L73E 2FYNC 1SQPE 2BCCE 3VMGD 4HM2A 2JO6A 1PP9E 3TGUE 2HMMA 1ZRTE 1PPJE 5CXMA 2B1XA 1EZVE 4PV1D 3EN1A 2DE6D 3GOBA 4P1BH 4AIVA 1NDOA 4NBDD 4HM8A 2XRXA 4HM1A 1O7WA 2E75D 3CX5E 3GTEA 5KLVE 1JM1A 1SJGA 3DQYA 3GL0A 4HM5A 4NBHD 2Q3WA 3GB4A 1VF5D 1O7PA 3GL2A 3L72E 2BMRA 3VCPA 1NTME 2HMKA 3L71E 1SQXE 4H0LD 1RIEA 3GCEA 4H44D 1FQTA 2QJPC 4H13D 4U3FE 2I7FA
chains in the Genus database with same CATH superfamily
1Q90C 2YVJB 2NVGA 3GZXA 4QUQA 2HMLA 4NBBD 2YFLA 4NBED 3GZYA 2B24A 1ULJA 2E4PA 2HMOA 1KYOE 4NB8D 2NUKA 1O7MA 3H1IE 4NBAD 3GTSA 2QPZA 1UUVA 3CXHE 1NTZE 2NUMA 1O7GA 3N0QA 2NWFA 2YFJA 4QDFA 3C0DA 3EQQA 2HMJA 2YIUC 3D89A 2QJKC 4QDDA 1WQLA 3AZCA 2JZAA 3H1JE 1VM9A 1NU1E 4EMJB 1SQVE 1RFSA 2XSHA 1SQBE 4NB9D 4NBFD 4HM4A 1KB9E 3L74E 4QUPA 1SQQE 2XR8A 3H1LE 4QDFB 4P1CH 4QDCA 5HL4A 1P84E 5AEUA 1EG9A 4HJLA 3VCAA 3H1KE 2QJYC 2ZYLA 3FOUA 2D2CD 2FYUE 1NYKA 4QURA 3L75E 1ULIA 1NTKE 2BMOA 3L70E 4HKVA 3CWBE 3H1HE 2DE5D 4HM0A 5KKZC 4QCKA 1VCKA 1O7HA 2CKFA 1L0NE 1L0LE 4HM7A 1G8KB 2BMQA 3VMID 2IBZE 4HM3A 2A06E 2NVFA 2NVEA 4NBGD 2GBWA 2DE7D 4PD4E 2E4QA 2HMNA 1BCCE 5KLIC 2GBXA 2E76D 2YFIA 1BE3E 1G8JB 3GKEA 1UUWA 2ZT9D 5BOKA 4HM6A 2XSOA 4OGQD 1O7NA 3VMHD 3BCCE 2E74D 4NBCD 4AAYB 5AEWA 3L73E 2FYNC 1SQPE 2BCCE 3VMGD 4HM2A 2JO6A 1PP9E 3TGUE 2HMMA 1ZRTE 1PPJE 5CXMA 2B1XA 1EZVE 4PV1D 3EN1A 2DE6D 3GOBA 4P1BH 4AIVA 1NDOA 4NBDD 4HM8A 2XRXA 4HM1A 1O7WA 2E75D 3CX5E 3GTEA 5KLVE 1JM1A 1SJGA 3DQYA 3GL0A 4HM5A 4NBHD 2Q3WA 3GB4A 1VF5D 1O7PA 3GL2A 3L72E 2BMRA 3VCPA 1NTME 2HMKA 3L71E 1SQXE 4H0LD 1RIEA 3GCEA 4H44D 1FQTA 2QJPC 4H13D 4U3FE 2I7FA
chains in the Genus database with same CATH topology
1Q90C 2YVJB 2NVGA 3GZXA 4QUQA 2HMLA 4NBBD 2YFLA 4NBED 3GZYA 2B24A 1ULJA 2E4PA 2HMOA 1KYOE 4NB8D 2NUKA 1O7MA 3H1IE 4NBAD 3GTSA 2QPZA 1UUVA 3CXHE 1NTZE 2NUMA 1O7GA 3N0QA 2NWFA 2YFJA 4QDFA 3C0DA 3EQQA 2HMJA 2YIUC 3D89A 2QJKC 4QDDA 1WQLA 3AZCA 2JZAA 3H1JE 1VM9A 1NU1E 4EMJB 1SQVE 1RFSA 2XSHA 1SQBE 4NB9D 4NBFD 4HM4A 1KB9E 3L74E 4QUPA 1SQQE 2XR8A 3H1LE 4QDFB 4P1CH 4QDCA 5HL4A 1P84E 5AEUA 1EG9A 4HJLA 3VCAA 3H1KE 2QJYC 2ZYLA 3FOUA 2D2CD 2FYUE 1NYKA 4QURA 3L75E 1ULIA 1NTKE 2BMOA 3L70E 4HKVA 3CWBE 3H1HE 2DE5D 4HM0A 5KKZC 4QCKA 1VCKA 1O7HA 2CKFA 1L0NE 1L0LE 4HM7A 1G8KB 2BMQA 3VMID 2IBZE 4HM3A 2A06E 2NVFA 2NVEA 4NBGD 2GBWA 2DE7D 4PD4E 2E4QA 2HMNA 1BCCE 5KLIC 2GBXA 2E76D 2YFIA 1BE3E 1G8JB 3GKEA 1UUWA 2ZT9D 5BOKA 4HM6A 2XSOA 4OGQD 1O7NA 3VMHD 3BCCE 2E74D 4NBCD 4AAYB 5AEWA 3L73E 2FYNC 1SQPE 2BCCE 3VMGD 4HM2A 2JO6A 1PP9E 3TGUE 2HMMA 1ZRTE 1PPJE 5CXMA 2B1XA 1EZVE 4PV1D 3EN1A 2DE6D 3GOBA 4P1BH 4AIVA 1NDOA 4NBDD 4HM8A 2XRXA 4HM1A 1O7WA 2E75D 3CX5E 3GTEA 5KLVE 1JM1A 1SJGA 3DQYA 3GL0A 4HM5A 4NBHD 2Q3WA 3GB4A 1VF5D 1O7PA 3GL2A 3L72E 2BMRA 3VCPA 1NTME 2HMKA 3L71E 1SQXE 4H0LD 1RIEA 3GCEA 4H44D 1FQTA 2QJPC 4H13D 4U3FE 2I7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 C;  2YVJ B;  2NVG A;  3GZX A;  4QUQ A;  2HML A;  4NBB D;  2YFL A;  4NBE D;  3GZY A;  2B24 A;  1ULJ A;  2E4P A;  2HMO A;  1KYO E;  4NB8 D;  2NUK A;  1O7M A;  3H1I E;  4NBA D;  3GTS A;  2QPZ A;  1UUV A;  3CXH E;  1NTZ E;  2NUM A;  1O7G A;  3N0Q A;  2NWF A;  2YFJ A;  4QDF A;  3C0D A;  3EQQ A;  2HMJ A;  2YIU C;  3D89 A;  2QJK C;  4QDD A;  1WQL A;  3AZC A;  2JZA A;  3H1J E;  1VM9 A;  1NU1 E;  4EMJ B;  1SQV E;  1RFS A;  2XSH A;  1SQB E;  4NB9 D;  4NBF D;  4HM4 A;  1KB9 E;  3L74 E;  4QUP A;  1SQQ E;  2XR8 A;  3H1L E;  4QDF B;  4P1C H;  4QDC A;  5HL4 A;  1P84 E;  5AEU A;  1EG9 A;  4HJL A;  3VCA A;  3H1K E;  2QJY C;  2ZYL A;  3FOU A;  2D2C D;  2FYU E;  1NYK A;  4QUR A;  3L75 E;  1ULI A;  1NTK E;  2BMO A;  3L70 E;  4HKV A;  3CWB E;  3H1H E;  2DE5 D;  4HM0 A;  5KKZ C;  4QCK A;  1VCK A;  1O7H A;  2CKF A;  1L0N E;  1L0L E;  4HM7 A;  1G8K B;  2BMQ A;  3VMI D;  2IBZ E;  4HM3 A;  2A06 E;  2NVF A;  2NVE A;  4NBG D;  2GBW A;  2DE7 D;  4PD4 E;  2E4Q A;  2HMN A;  1BCC E;  5KLI C;  2GBX A;  2E76 D;  2YFI A;  1BE3 E;  1G8J B;  3GKE A;  1UUW A;  2ZT9 D;  5BOK A;  4HM6 A;  2XSO A;  4OGQ D;  1O7N A;  3VMH D;  3BCC E;  2E74 D;  4NBC D;  4AAY B;  5AEW A;  3L73 E;  2FYN C;  1SQP E;  2BCC E;  3VMG D;  4HM2 A;  2JO6 A;  1PP9 E;  3TGU E;  2HMM A;  1ZRT E;  1PPJ E;  5CXM A;  2B1X A;  1EZV E;  4PV1 D;  3EN1 A;  2DE6 D;  3GOB A;  4P1B H;  4AIV A;  1NDO A;  4NBD D;  4HM8 A;  2XRX A;  4HM1 A;  1O7W A;  2E75 D;  3CX5 E;  3GTE A;  5KLV E;  1JM1 A;  1SJG A;  3DQY A;  3GL0 A;  4HM5 A;  4NBH D;  2Q3W A;  3GB4 A;  1VF5 D;  1O7P A;  3GL2 A;  3L72 E;  2BMR A;  3VCP A;  1NTM E;  2HMK A;  3L71 E;  1SQX E;  4H0L D;  1RIE A;  3GCE A;  4H44 D;  1FQT A;  2QJP C;  4H13 D;  4U3F E;  2I7F A; 
#chains in the Genus database with same CATH topology
 1Q90 C;  2YVJ B;  2NVG A;  3GZX A;  4QUQ A;  2HML A;  4NBB D;  2YFL A;  4NBE D;  3GZY A;  2B24 A;  1ULJ A;  2E4P A;  2HMO A;  1KYO E;  4NB8 D;  2NUK A;  1O7M A;  3H1I E;  4NBA D;  3GTS A;  2QPZ A;  1UUV A;  3CXH E;  1NTZ E;  2NUM A;  1O7G A;  3N0Q A;  2NWF A;  2YFJ A;  4QDF A;  3C0D A;  3EQQ A;  2HMJ A;  2YIU C;  3D89 A;  2QJK C;  4QDD A;  1WQL A;  3AZC A;  2JZA A;  3H1J E;  1VM9 A;  1NU1 E;  4EMJ B;  1SQV E;  1RFS A;  2XSH A;  1SQB E;  4NB9 D;  4NBF D;  4HM4 A;  1KB9 E;  3L74 E;  4QUP A;  1SQQ E;  2XR8 A;  3H1L E;  4QDF B;  4P1C H;  4QDC A;  5HL4 A;  1P84 E;  5AEU A;  1EG9 A;  4HJL A;  3VCA A;  3H1K E;  2QJY C;  2ZYL A;  3FOU A;  2D2C D;  2FYU E;  1NYK A;  4QUR A;  3L75 E;  1ULI A;  1NTK E;  2BMO A;  3L70 E;  4HKV A;  3CWB E;  3H1H E;  2DE5 D;  4HM0 A;  5KKZ C;  4QCK A;  1VCK A;  1O7H A;  2CKF A;  1L0N E;  1L0L E;  4HM7 A;  1G8K B;  2BMQ A;  3VMI D;  2IBZ E;  4HM3 A;  2A06 E;  2NVF A;  2NVE A;  4NBG D;  2GBW A;  2DE7 D;  4PD4 E;  2E4Q A;  2HMN A;  1BCC E;  5KLI C;  2GBX A;  2E76 D;  2YFI A;  1BE3 E;  1G8J B;  3GKE A;  1UUW A;  2ZT9 D;  5BOK A;  4HM6 A;  2XSO A;  4OGQ D;  1O7N A;  3VMH D;  3BCC E;  2E74 D;  4NBC D;  4AAY B;  5AEW A;  3L73 E;  2FYN C;  1SQP E;  2BCC E;  3VMG D;  4HM2 A;  2JO6 A;  1PP9 E;  3TGU E;  2HMM A;  1ZRT E;  1PPJ E;  5CXM A;  2B1X A;  1EZV E;  4PV1 D;  3EN1 A;  2DE6 D;  3GOB A;  4P1B H;  4AIV A;  1NDO A;  4NBD D;  4HM8 A;  2XRX A;  4HM1 A;  1O7W A;  2E75 D;  3CX5 E;  3GTE A;  5KLV E;  1JM1 A;  1SJG A;  3DQY A;  3GL0 A;  4HM5 A;  4NBH D;  2Q3W A;  3GB4 A;  1VF5 D;  1O7P A;  3GL2 A;  3L72 E;  2BMR A;  3VCP A;  1NTM E;  2HMK A;  3L71 E;  1SQX E;  4H0L D;  1RIE A;  3GCE A;  4H44 D;  1FQT A;  2QJP C;  4H13 D;  4U3F E;  2I7F A; 
#chains in the Genus database with same CATH homology
 1Q90 C;  2YVJ B;  2NVG A;  3GZX A;  4QUQ A;  2HML A;  4NBB D;  2YFL A;  4NBE D;  3GZY A;  2B24 A;  1ULJ A;  2E4P A;  2HMO A;  1KYO E;  4NB8 D;  2NUK A;  1O7M A;  3H1I E;  4NBA D;  3GTS A;  2QPZ A;  1UUV A;  3CXH E;  1NTZ E;  2NUM A;  1O7G A;  3N0Q A;  2NWF A;  2YFJ A;  4QDF A;  3C0D A;  3EQQ A;  2HMJ A;  2YIU C;  3D89 A;  2QJK C;  4QDD A;  1WQL A;  3AZC A;  2JZA A;  3H1J E;  1VM9 A;  1NU1 E;  4EMJ B;  1SQV E;  1RFS A;  2XSH A;  1SQB E;  4NB9 D;  4NBF D;  4HM4 A;  1KB9 E;  3L74 E;  4QUP A;  1SQQ E;  2XR8 A;  3H1L E;  4QDF B;  4P1C H;  4QDC A;  5HL4 A;  1P84 E;  5AEU A;  1EG9 A;  4HJL A;  3VCA A;  3H1K E;  2QJY C;  2ZYL A;  3FOU A;  2D2C D;  2FYU E;  1NYK A;  4QUR A;  3L75 E;  1ULI A;  1NTK E;  2BMO A;  3L70 E;  4HKV A;  3CWB E;  3H1H E;  2DE5 D;  4HM0 A;  5KKZ C;  4QCK A;  1VCK A;  1O7H A;  2CKF A;  1L0N E;  1L0L E;  4HM7 A;  1G8K B;  2BMQ A;  3VMI D;  2IBZ E;  4HM3 A;  2A06 E;  2NVF A;  2NVE A;  4NBG D;  2GBW A;  2DE7 D;  4PD4 E;  2E4Q A;  2HMN A;  1BCC E;  5KLI C;  2GBX A;  2E76 D;  2YFI A;  1BE3 E;  1G8J B;  3GKE A;  1UUW A;  2ZT9 D;  5BOK A;  4HM6 A;  2XSO A;  4OGQ D;  1O7N A;  3VMH D;  3BCC E;  2E74 D;  4NBC D;  4AAY B;  5AEW A;  3L73 E;  2FYN C;  1SQP E;  2BCC E;  3VMG D;  4HM2 A;  2JO6 A;  1PP9 E;  3TGU E;  2HMM A;  1ZRT E;  1PPJ E;  5CXM A;  2B1X A;  1EZV E;  4PV1 D;  3EN1 A;  2DE6 D;  3GOB A;  4P1B H;  4AIV A;  1NDO A;  4NBD D;  4HM8 A;  2XRX A;  4HM1 A;  1O7W A;  2E75 D;  3CX5 E;  3GTE A;  5KLV E;  1JM1 A;  1SJG A;  3DQY A;  3GL0 A;  4HM5 A;  4NBH D;  2Q3W A;  3GB4 A;  1VF5 D;  1O7P A;  3GL2 A;  3L72 E;  2BMR A;  3VCP A;  1NTM E;  2HMK A;  3L71 E;  1SQX E;  4H0L D;  1RIE A;  3GCE A;  4H44 D;  1FQT A;  2QJP C;  4H13 D;  4U3F E;  2I7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...