5CXMA

Crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
TVNVGTMADLKAKGELKGNTPKGPVTVVPNGNSGQISAVNPTCTHNGCQVNWKKANGKFVCPCHGAEFAATGKVLKGPAIRDLPTYATQVSGNNILVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6/f complex iron-sulfur subunit
publication title Structural and functional characterisation of the cyanobacterial PetC3 Rieske protein family.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Metal binding protein
total genus 17
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5cxmA00
2YFLA 3CWBE 1RFSA 2DE5D 3FOUA 4QDFA 2YVJB 2GBXA 1NYKA 4HM3A 1SQVE 4HM7A 3H1IE 1EG9A 1KYOE 2DE6D 1RIEA 5HL4A 2I7FA 3AZCA 4NBAD 3L71E 3L70E 2E75D 3EN1A 4NBED 1SQQE 3C0DA 3VMHD 1NTKE 2YIUC 3GZXA 2DE7D 3VCAA 2XRXA 3GB4A 4PD4E 1NU1E 1KB9E 1O7PA 4HM8A 5KLIC 2FYUE 2BMQA 2E4PA 4HM5A 2QJYC 4HM4A 4QDCA 4HM0A 1JM1A 1Q90C 2B24A 2E4QA 1PP9E 4OGQD 1PPJE 1UUWA 2NVFA 3CXHE 2BMRA 4NBFD 1P84E 4QUQA 1O7MA 4EMJB 5BOKA 2HMMA 4HKVA 1FQTA 2HMKA 4NBDD 2CKFA 4QDFB 5AEUA 4NBCD 3GL0A 1G8KB 2XR8A 3GOBA 4H13D 1NTME 3D89A 2BCCE 2YFJA 2BMOA 2HMOA 3N0QA 2Q3WA 2JO6A 5KKZC 2QJPC 1G8JB 1NTZE 1ULIA 2FYNC 3CX5E 4PV1D 3EQQA 2B1XA 1ZRTE 4H0LD 1VF5D 1UUVA 3GTEA 3H1KE 1EZVE 3GCEA 3H1JE 3DQYA 1SQBE 2HMNA 4NBGD 4QUPA 2NUMA 2ZT9D 3GKEA 1SQPE 2HMJA 1NDOA 3BCCE 4NBHD 1O7HA 3L73E 3TGUE 1VCKA 2ZYLA 4NB9D 4QCKA 3GTSA 2NVEA 3L72E 2JZAA 4H44D 1VM9A 3L74E 3L75E 4HJLA 4U3FE 4AAYB 4HM2A 2HMLA 4P1CH 5CXMA 2IBZE 2NVGA 4HM6A 1BCCE 4NB8D 4P1BH 2E76D 1O7NA 3VMID 2XSHA 3VCPA 1O7WA 1BE3E 2E74D 5AEWA 5KLVE 4HM1A 4QDDA 1SJGA 2GBWA 1O7GA 4NBBD 2NWFA 4AIVA 3GZYA 1L0NE 2YFIA 2QJKC 4QURA 2A06E 3VMGD 1ULJA 1WQLA 2NUKA 3H1HE 3GL2A 1SQXE 2D2CD 2XSOA 3H1LE 1L0LE 2QPZA
chains in the Genus database with same CATH superfamily
2YFLA 3CWBE 1RFSA 2DE5D 3FOUA 4QDFA 2YVJB 2GBXA 1NYKA 4HM3A 1SQVE 4HM7A 3H1IE 1EG9A 1KYOE 2DE6D 1RIEA 5HL4A 2I7FA 3AZCA 4NBAD 3L71E 3L70E 2E75D 3EN1A 4NBED 1SQQE 3C0DA 3VMHD 1NTKE 2YIUC 3GZXA 2DE7D 3VCAA 2XRXA 3GB4A 4PD4E 1NU1E 1KB9E 1O7PA 4HM8A 5KLIC 2FYUE 2BMQA 2E4PA 4HM5A 2QJYC 4HM4A 4QDCA 4HM0A 1JM1A 1Q90C 2B24A 2E4QA 1PP9E 4OGQD 1PPJE 1UUWA 2NVFA 3CXHE 2BMRA 4NBFD 1P84E 4QUQA 1O7MA 4EMJB 5BOKA 2HMMA 4HKVA 1FQTA 2HMKA 4NBDD 2CKFA 4QDFB 5AEUA 4NBCD 3GL0A 1G8KB 2XR8A 3GOBA 4H13D 1NTME 3D89A 2BCCE 2YFJA 2BMOA 2HMOA 3N0QA 2Q3WA 2JO6A 5KKZC 2QJPC 1G8JB 1NTZE 1ULIA 2FYNC 3CX5E 4PV1D 3EQQA 2B1XA 1ZRTE 4H0LD 1VF5D 1UUVA 3GTEA 3H1KE 1EZVE 3GCEA 3H1JE 3DQYA 1SQBE 2HMNA 4NBGD 4QUPA 2NUMA 2ZT9D 3GKEA 1SQPE 2HMJA 1NDOA 3BCCE 4NBHD 1O7HA 3L73E 3TGUE 1VCKA 2ZYLA 4NB9D 4QCKA 3GTSA 2NVEA 3L72E 2JZAA 4H44D 1VM9A 3L74E 3L75E 4HJLA 4U3FE 4AAYB 4HM2A 2HMLA 4P1CH 5CXMA 2IBZE 2NVGA 4HM6A 1BCCE 4NB8D 4P1BH 2E76D 1O7NA 3VMID 2XSHA 3VCPA 1O7WA 1BE3E 2E74D 5AEWA 5KLVE 4HM1A 4QDDA 1SJGA 2GBWA 1O7GA 4NBBD 2NWFA 4AIVA 3GZYA 1L0NE 2YFIA 2QJKC 4QURA 2A06E 3VMGD 1ULJA 1WQLA 2NUKA 3H1HE 3GL2A 1SQXE 2D2CD 2XSOA 3H1LE 1L0LE 2QPZA
chains in the Genus database with same CATH topology
2YFLA 3CWBE 1RFSA 2DE5D 3FOUA 4QDFA 2YVJB 2GBXA 1NYKA 4HM3A 1SQVE 4HM7A 3H1IE 1EG9A 1KYOE 2DE6D 1RIEA 5HL4A 2I7FA 3AZCA 4NBAD 3L71E 3L70E 2E75D 3EN1A 4NBED 1SQQE 3C0DA 3VMHD 1NTKE 2YIUC 3GZXA 2DE7D 3VCAA 2XRXA 3GB4A 4PD4E 1NU1E 1KB9E 1O7PA 4HM8A 5KLIC 2FYUE 2BMQA 2E4PA 4HM5A 2QJYC 4HM4A 4QDCA 4HM0A 1JM1A 1Q90C 2B24A 2E4QA 1PP9E 4OGQD 1PPJE 1UUWA 2NVFA 3CXHE 2BMRA 4NBFD 1P84E 4QUQA 1O7MA 4EMJB 5BOKA 2HMMA 4HKVA 1FQTA 2HMKA 4NBDD 2CKFA 4QDFB 5AEUA 4NBCD 3GL0A 1G8KB 2XR8A 3GOBA 4H13D 1NTME 3D89A 2BCCE 2YFJA 2BMOA 2HMOA 3N0QA 2Q3WA 2JO6A 5KKZC 2QJPC 1G8JB 1NTZE 1ULIA 2FYNC 3CX5E 4PV1D 3EQQA 2B1XA 1ZRTE 4H0LD 1VF5D 1UUVA 3GTEA 3H1KE 1EZVE 3GCEA 3H1JE 3DQYA 1SQBE 2HMNA 4NBGD 4QUPA 2NUMA 2ZT9D 3GKEA 1SQPE 2HMJA 1NDOA 3BCCE 4NBHD 1O7HA 3L73E 3TGUE 1VCKA 2ZYLA 4NB9D 4QCKA 3GTSA 2NVEA 3L72E 2JZAA 4H44D 1VM9A 3L74E 3L75E 4HJLA 4U3FE 4AAYB 4HM2A 2HMLA 4P1CH 5CXMA 2IBZE 2NVGA 4HM6A 1BCCE 4NB8D 4P1BH 2E76D 1O7NA 3VMID 2XSHA 3VCPA 1O7WA 1BE3E 2E74D 5AEWA 5KLVE 4HM1A 4QDDA 1SJGA 2GBWA 1O7GA 4NBBD 2NWFA 4AIVA 3GZYA 1L0NE 2YFIA 2QJKC 4QURA 2A06E 3VMGD 1ULJA 1WQLA 2NUKA 3H1HE 3GL2A 1SQXE 2D2CD 2XSOA 3H1LE 1L0LE 2QPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFL A;  3CWB E;  1RFS A;  2DE5 D;  3FOU A;  4QDF A;  2YVJ B;  2GBX A;  1NYK A;  4HM3 A;  1SQV E;  4HM7 A;  3H1I E;  1EG9 A;  1KYO E;  2DE6 D;  1RIE A;  5HL4 A;  2I7F A;  3AZC A;  4NBA D;  3L71 E;  3L70 E;  2E75 D;  3EN1 A;  4NBE D;  1SQQ E;  3C0D A;  3VMH D;  1NTK E;  2YIU C;  3GZX A;  2DE7 D;  3VCA A;  2XRX A;  3GB4 A;  4PD4 E;  1NU1 E;  1KB9 E;  1O7P A;  4HM8 A;  5KLI C;  2FYU E;  2BMQ A;  2E4P A;  4HM5 A;  2QJY C;  4HM4 A;  4QDC A;  4HM0 A;  1JM1 A;  1Q90 C;  2B24 A;  2E4Q A;  1PP9 E;  4OGQ D;  1PPJ E;  1UUW A;  2NVF A;  3CXH E;  2BMR A;  4NBF D;  1P84 E;  4QUQ A;  1O7M A;  4EMJ B;  5BOK A;  2HMM A;  4HKV A;  1FQT A;  2HMK A;  4NBD D;  2CKF A;  4QDF B;  5AEU A;  4NBC D;  3GL0 A;  1G8K B;  2XR8 A;  3GOB A;  4H13 D;  1NTM E;  3D89 A;  2BCC E;  2YFJ A;  2BMO A;  2HMO A;  3N0Q A;  2Q3W A;  2JO6 A;  5KKZ C;  2QJP C;  1G8J B;  1NTZ E;  1ULI A;  2FYN C;  3CX5 E;  4PV1 D;  3EQQ A;  2B1X A;  1ZRT E;  4H0L D;  1VF5 D;  1UUV A;  3GTE A;  3H1K E;  1EZV E;  3GCE A;  3H1J E;  3DQY A;  1SQB E;  2HMN A;  4NBG D;  4QUP A;  2NUM A;  2ZT9 D;  3GKE A;  1SQP E;  2HMJ A;  1NDO A;  3BCC E;  4NBH D;  1O7H A;  3L73 E;  3TGU E;  1VCK A;  2ZYL A;  4NB9 D;  4QCK A;  3GTS A;  2NVE A;  3L72 E;  2JZA A;  4H44 D;  1VM9 A;  3L74 E;  3L75 E;  4HJL A;  4U3F E;  4AAY B;  4HM2 A;  2HML A;  4P1C H;  5CXM A;  2IBZ E;  2NVG A;  4HM6 A;  1BCC E;  4NB8 D;  4P1B H;  2E76 D;  1O7N A;  3VMI D;  2XSH A;  3VCP A;  1O7W A;  1BE3 E;  2E74 D;  5AEW A;  5KLV E;  4HM1 A;  4QDD A;  1SJG A;  2GBW A;  1O7G A;  4NBB D;  2NWF A;  4AIV A;  3GZY A;  1L0N E;  2YFI A;  2QJK C;  4QUR A;  2A06 E;  3VMG D;  1ULJ A;  1WQL A;  2NUK A;  3H1H E;  3GL2 A;  1SQX E;  2D2C D;  2XSO A;  3H1L E;  1L0L E;  2QPZ A; 
#chains in the Genus database with same CATH topology
 2YFL A;  3CWB E;  1RFS A;  2DE5 D;  3FOU A;  4QDF A;  2YVJ B;  2GBX A;  1NYK A;  4HM3 A;  1SQV E;  4HM7 A;  3H1I E;  1EG9 A;  1KYO E;  2DE6 D;  1RIE A;  5HL4 A;  2I7F A;  3AZC A;  4NBA D;  3L71 E;  3L70 E;  2E75 D;  3EN1 A;  4NBE D;  1SQQ E;  3C0D A;  3VMH D;  1NTK E;  2YIU C;  3GZX A;  2DE7 D;  3VCA A;  2XRX A;  3GB4 A;  4PD4 E;  1NU1 E;  1KB9 E;  1O7P A;  4HM8 A;  5KLI C;  2FYU E;  2BMQ A;  2E4P A;  4HM5 A;  2QJY C;  4HM4 A;  4QDC A;  4HM0 A;  1JM1 A;  1Q90 C;  2B24 A;  2E4Q A;  1PP9 E;  4OGQ D;  1PPJ E;  1UUW A;  2NVF A;  3CXH E;  2BMR A;  4NBF D;  1P84 E;  4QUQ A;  1O7M A;  4EMJ B;  5BOK A;  2HMM A;  4HKV A;  1FQT A;  2HMK A;  4NBD D;  2CKF A;  4QDF B;  5AEU A;  4NBC D;  3GL0 A;  1G8K B;  2XR8 A;  3GOB A;  4H13 D;  1NTM E;  3D89 A;  2BCC E;  2YFJ A;  2BMO A;  2HMO A;  3N0Q A;  2Q3W A;  2JO6 A;  5KKZ C;  2QJP C;  1G8J B;  1NTZ E;  1ULI A;  2FYN C;  3CX5 E;  4PV1 D;  3EQQ A;  2B1X A;  1ZRT E;  4H0L D;  1VF5 D;  1UUV A;  3GTE A;  3H1K E;  1EZV E;  3GCE A;  3H1J E;  3DQY A;  1SQB E;  2HMN A;  4NBG D;  4QUP A;  2NUM A;  2ZT9 D;  3GKE A;  1SQP E;  2HMJ A;  1NDO A;  3BCC E;  4NBH D;  1O7H A;  3L73 E;  3TGU E;  1VCK A;  2ZYL A;  4NB9 D;  4QCK A;  3GTS A;  2NVE A;  3L72 E;  2JZA A;  4H44 D;  1VM9 A;  3L74 E;  3L75 E;  4HJL A;  4U3F E;  4AAY B;  4HM2 A;  2HML A;  4P1C H;  5CXM A;  2IBZ E;  2NVG A;  4HM6 A;  1BCC E;  4NB8 D;  4P1B H;  2E76 D;  1O7N A;  3VMI D;  2XSH A;  3VCP A;  1O7W A;  1BE3 E;  2E74 D;  5AEW A;  5KLV E;  4HM1 A;  4QDD A;  1SJG A;  2GBW A;  1O7G A;  4NBB D;  2NWF A;  4AIV A;  3GZY A;  1L0N E;  2YFI A;  2QJK C;  4QUR A;  2A06 E;  3VMG D;  1ULJ A;  1WQL A;  2NUK A;  3H1H E;  3GL2 A;  1SQX E;  2D2C D;  2XSO A;  3H1L E;  1L0L E;  2QPZ A; 
#chains in the Genus database with same CATH homology
 2YFL A;  3CWB E;  1RFS A;  2DE5 D;  3FOU A;  4QDF A;  2YVJ B;  2GBX A;  1NYK A;  4HM3 A;  1SQV E;  4HM7 A;  3H1I E;  1EG9 A;  1KYO E;  2DE6 D;  1RIE A;  5HL4 A;  2I7F A;  3AZC A;  4NBA D;  3L71 E;  3L70 E;  2E75 D;  3EN1 A;  4NBE D;  1SQQ E;  3C0D A;  3VMH D;  1NTK E;  2YIU C;  3GZX A;  2DE7 D;  3VCA A;  2XRX A;  3GB4 A;  4PD4 E;  1NU1 E;  1KB9 E;  1O7P A;  4HM8 A;  5KLI C;  2FYU E;  2BMQ A;  2E4P A;  4HM5 A;  2QJY C;  4HM4 A;  4QDC A;  4HM0 A;  1JM1 A;  1Q90 C;  2B24 A;  2E4Q A;  1PP9 E;  4OGQ D;  1PPJ E;  1UUW A;  2NVF A;  3CXH E;  2BMR A;  4NBF D;  1P84 E;  4QUQ A;  1O7M A;  4EMJ B;  5BOK A;  2HMM A;  4HKV A;  1FQT A;  2HMK A;  4NBD D;  2CKF A;  4QDF B;  5AEU A;  4NBC D;  3GL0 A;  1G8K B;  2XR8 A;  3GOB A;  4H13 D;  1NTM E;  3D89 A;  2BCC E;  2YFJ A;  2BMO A;  2HMO A;  3N0Q A;  2Q3W A;  2JO6 A;  5KKZ C;  2QJP C;  1G8J B;  1NTZ E;  1ULI A;  2FYN C;  3CX5 E;  4PV1 D;  3EQQ A;  2B1X A;  1ZRT E;  4H0L D;  1VF5 D;  1UUV A;  3GTE A;  3H1K E;  1EZV E;  3GCE A;  3H1J E;  3DQY A;  1SQB E;  2HMN A;  4NBG D;  4QUP A;  2NUM A;  2ZT9 D;  3GKE A;  1SQP E;  2HMJ A;  1NDO A;  3BCC E;  4NBH D;  1O7H A;  3L73 E;  3TGU E;  1VCK A;  2ZYL A;  4NB9 D;  4QCK A;  3GTS A;  2NVE A;  3L72 E;  2JZA A;  4H44 D;  1VM9 A;  3L74 E;  3L75 E;  4HJL A;  4U3F E;  4AAY B;  4HM2 A;  2HML A;  4P1C H;  5CXM A;  2IBZ E;  2NVG A;  4HM6 A;  1BCC E;  4NB8 D;  4P1B H;  2E76 D;  1O7N A;  3VMI D;  2XSH A;  3VCP A;  1O7W A;  1BE3 E;  2E74 D;  5AEW A;  5KLV E;  4HM1 A;  4QDD A;  1SJG A;  2GBW A;  1O7G A;  4NBB D;  2NWF A;  4AIV A;  3GZY A;  1L0N E;  2YFI A;  2QJK C;  4QUR A;  2A06 E;  3VMG D;  1ULJ A;  1WQL A;  2NUK A;  3H1H E;  3GL2 A;  1SQX E;  2D2C D;  2XSO A;  3H1L E;  1L0L E;  2QPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...