2XRXA

Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
442
structure length
432
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPTFNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
total genus 141
structure length 432
sequence length 442
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xrxA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xrxA01
3GZYA 1VM9A 2DE5A 4HM4A 1NTZE 1RFSA 1O7MA 1VF5D 4NBED 1SQPE 4P1CH 2IBZE 3CWBE 4NB8A 1BCCE 3VMIA 3H1IE 2QJKC 2NVFA 4HKVA 2BCCE 1P84E 3VMID 2GBXA 1UUVA 4QDCA 2DE6A 4QDFB 4HM8A 3GTSA 3GZXA 3L74E 4NBEA 3GL0A 4HM2A 1Z02A 4QURA 1SJGA 4P1BH 4QDDA 2NWFA 1G8JB 1O7HA 3GTEA 3GL2A 3GKEA 1WW9A 4NBCD 2NVGA 3L71E 2I7FA 4NBHA 4QUPA 3C0DA 1SQQE 2NUMA 2BMRA 2DE7D 2YVJB 1NTME 5AEUA 1PP9E 2B24A 2E75D 1Z03A 2ZYLA 3VMGA 2XRXA 1SQVE 1PPJE 2YFLA 2NUKA 2E4PA 2ZT9D 3FOUA 3L70E 4NBGD 1NDOA 4QDFA 4NBCA 1O7PA 3VCAA 4H44D 3VMGD 2B1XA 4NBHD 4NBDD 3BCCE 4OGQD 2XSOA 2XR8A 2DE7A 2HMJA 2YFJA 2FYUE 2CKFA 2XSHA 4NBAA 5KKZC 1NU1E 3N0QA 3EQQA 4QCKA 4HM5A 2HMLA 5CXMA 4NBFD 3VMHA 2QJPC 2A06E 2E76D 2YIUC 4HM1A 3VMHD 2QPZA 4AAYB 2GBWA 2E4QA 3H1LE 3EN1A 2FYNC 3GCEA 3D89A 5KLIC 2E74D 4PD4E 1ULIA 4NBFA 1SQXE 1L0LE 1NYKA 3L75E 1UUWA 1ZRTE 3H1HE 2HMNA 4NBAD 2HMOA 1VCKA 4HM7A 1EG9A 1NTKE 3GCFA 1KYOE 3L72E 4NB8D 3VCPA 4HM0A 3GB4A 1G8KB 1EZVE 3H1JE 1FQTA 1RIEA 4PV1D 4AIVA 4QUQA 5AEWA 4NB9A 3CXHE 3H1KE 1O7WA 4HJLA 1Q90C 1WQLA 4NB9D 4NBGA 1O7GA 2QJYC 1L0NE 4NBBD 2DE5D 1O7NA 3L73E 4H13D 2HMKA 5HL4A 2NVEA 1KB9E 4NBDA 1JM1A 2BMQA 4HM6A 1BE3E 2YFIA 1SQBE 3CX5E 4EMJB 5BOKA 4H0LD 2JO6A 1Z01A 2D2CD 3GOBA 2Q3WA 1ULJA 4U3FE 2BMOA 2JZAA 4NBBA 5KLVE 2HMMA 3DQYA 4HM3A 3GKQA 3AZCA 3TGUE 2DE6D
chains in the Genus database with same CATH superfamily
3GZYA 1VM9A 2DE5A 4HM4A 1NTZE 1RFSA 1O7MA 1VF5D 4NBED 1SQPE 4P1CH 2IBZE 3CWBE 4NB8A 1BCCE 3VMIA 3H1IE 2QJKC 2NVFA 4HKVA 2BCCE 1P84E 3VMID 2GBXA 1UUVA 4QDCA 2DE6A 4QDFB 4HM8A 3GTSA 3GZXA 3L74E 4NBEA 3GL0A 4HM2A 1Z02A 4QURA 1SJGA 4P1BH 4QDDA 2NWFA 1G8JB 1O7HA 3GTEA 3GL2A 3GKEA 1WW9A 4NBCD 2NVGA 3L71E 2I7FA 4NBHA 4QUPA 3C0DA 1SQQE 2NUMA 2BMRA 2DE7D 2YVJB 1NTME 5AEUA 1PP9E 2B24A 2E75D 1Z03A 2ZYLA 3VMGA 2XRXA 1SQVE 1PPJE 2YFLA 2NUKA 2E4PA 2ZT9D 3FOUA 3L70E 4NBGD 1NDOA 4QDFA 4NBCA 1O7PA 3VCAA 4H44D 3VMGD 2B1XA 4NBHD 4NBDD 3BCCE 4OGQD 2XSOA 2XR8A 2DE7A 2HMJA 2YFJA 2FYUE 2CKFA 2XSHA 4NBAA 5KKZC 1NU1E 3N0QA 3EQQA 4QCKA 4HM5A 2HMLA 5CXMA 4NBFD 3VMHA 2QJPC 2A06E 2E76D 2YIUC 4HM1A 3VMHD 2QPZA 4AAYB 2GBWA 2E4QA 3H1LE 3EN1A 2FYNC 3GCEA 3D89A 5KLIC 2E74D 4PD4E 1ULIA 4NBFA 1SQXE 1L0LE 1NYKA 3L75E 1UUWA 1ZRTE 3H1HE 2HMNA 4NBAD 2HMOA 1VCKA 4HM7A 1EG9A 1NTKE 3GCFA 1KYOE 3L72E 4NB8D 3VCPA 4HM0A 3GB4A 1G8KB 1EZVE 3H1JE 1FQTA 1RIEA 4PV1D 4AIVA 4QUQA 5AEWA 4NB9A 3CXHE 3H1KE 1O7WA 4HJLA 1Q90C 1WQLA 4NB9D 4NBGA 1O7GA 2QJYC 1L0NE 4NBBD 2DE5D 1O7NA 3L73E 4H13D 2HMKA 5HL4A 2NVEA 1KB9E 4NBDA 1JM1A 2BMQA 4HM6A 1BE3E 2YFIA 1SQBE 3CX5E 4EMJB 5BOKA 4H0LD 2JO6A 1Z01A 2D2CD 3GOBA 2Q3WA 1ULJA 4U3FE 2BMOA 2JZAA 4NBBA 5KLVE 2HMMA 3DQYA 4HM3A 3GKQA 3AZCA 3TGUE 2DE6D
chains in the Genus database with same CATH topology
3GZYA 1VM9A 2DE5A 4HM4A 1NTZE 1RFSA 1O7MA 1VF5D 4NBED 1SQPE 4P1CH 2IBZE 3CWBE 4NB8A 1BCCE 3VMIA 3H1IE 2QJKC 2NVFA 4HKVA 2BCCE 1P84E 3VMID 2GBXA 1UUVA 4QDCA 2DE6A 4QDFB 4HM8A 3GTSA 3GZXA 3L74E 4NBEA 3GL0A 4HM2A 1Z02A 4QURA 1SJGA 4P1BH 4QDDA 2NWFA 1G8JB 1O7HA 3GTEA 3GL2A 3GKEA 1WW9A 4NBCD 2NVGA 3L71E 2I7FA 4NBHA 4QUPA 3C0DA 1SQQE 2NUMA 2BMRA 2DE7D 2YVJB 1NTME 5AEUA 1PP9E 2B24A 2E75D 1Z03A 2ZYLA 3VMGA 2XRXA 1SQVE 1PPJE 2YFLA 2NUKA 2E4PA 2ZT9D 3FOUA 3L70E 4NBGD 1NDOA 4QDFA 4NBCA 1O7PA 3VCAA 4H44D 3VMGD 2B1XA 4NBHD 4NBDD 3BCCE 4OGQD 2XSOA 2XR8A 2DE7A 2HMJA 2YFJA 2FYUE 2CKFA 2XSHA 4NBAA 5KKZC 1NU1E 3N0QA 3EQQA 4QCKA 4HM5A 2HMLA 5CXMA 4NBFD 3VMHA 2QJPC 2A06E 2E76D 2YIUC 4HM1A 3VMHD 2QPZA 4AAYB 2GBWA 2E4QA 3H1LE 3EN1A 2FYNC 3GCEA 3D89A 5KLIC 2E74D 4PD4E 1ULIA 4NBFA 1SQXE 1L0LE 1NYKA 3L75E 1UUWA 1ZRTE 3H1HE 2HMNA 4NBAD 2HMOA 1VCKA 4HM7A 1EG9A 1NTKE 3GCFA 1KYOE 3L72E 4NB8D 3VCPA 4HM0A 3GB4A 1G8KB 1EZVE 3H1JE 1FQTA 1RIEA 4PV1D 4AIVA 4QUQA 5AEWA 4NB9A 3CXHE 3H1KE 1O7WA 4HJLA 1Q90C 1WQLA 4NB9D 4NBGA 1O7GA 2QJYC 1L0NE 4NBBD 2DE5D 1O7NA 3L73E 4H13D 2HMKA 5HL4A 2NVEA 1KB9E 4NBDA 1JM1A 2BMQA 4HM6A 1BE3E 2YFIA 1SQBE 3CX5E 4EMJB 5BOKA 4H0LD 2JO6A 1Z01A 2D2CD 3GOBA 2Q3WA 1ULJA 4U3FE 2BMOA 2JZAA 4NBBA 5KLVE 2HMMA 3DQYA 4HM3A 3GKQA 3AZCA 3TGUE 2DE6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZY A;  1VM9 A;  2DE5 A;  4HM4 A;  1NTZ E;  1RFS A;  1O7M A;  1VF5 D;  4NBE D;  1SQP E;  4P1C H;  2IBZ E;  3CWB E;  4NB8 A;  1BCC E;  3VMI A;  3H1I E;  2QJK C;  2NVF A;  4HKV A;  2BCC E;  1P84 E;  3VMI D;  2GBX A;  1UUV A;  4QDC A;  2DE6 A;  4QDF B;  4HM8 A;  3GTS A;  3GZX A;  3L74 E;  4NBE A;  3GL0 A;  4HM2 A;  1Z02 A;  4QUR A;  1SJG A;  4P1B H;  4QDD A;  2NWF A;  1G8J B;  1O7H A;  3GTE A;  3GL2 A;  3GKE A;  1WW9 A;  4NBC D;  2NVG A;  3L71 E;  2I7F A;  4NBH A;  4QUP A;  3C0D A;  1SQQ E;  2NUM A;  2BMR A;  2DE7 D;  2YVJ B;  1NTM E;  5AEU A;  1PP9 E;  2B24 A;  2E75 D;  1Z03 A;  2ZYL A;  3VMG A;  2XRX A;  1SQV E;  1PPJ E;  2YFL A;  2NUK A;  2E4P A;  2ZT9 D;  3FOU A;  3L70 E;  4NBG D;  1NDO A;  4QDF A;  4NBC A;  1O7P A;  3VCA A;  4H44 D;  3VMG D;  2B1X A;  4NBH D;  4NBD D;  3BCC E;  4OGQ D;  2XSO A;  2XR8 A;  2DE7 A;  2HMJ A;  2YFJ A;  2FYU E;  2CKF A;  2XSH A;  4NBA A;  5KKZ C;  1NU1 E;  3N0Q A;  3EQQ A;  4QCK A;  4HM5 A;  2HML A;  5CXM A;  4NBF D;  3VMH A;  2QJP C;  2A06 E;  2E76 D;  2YIU C;  4HM1 A;  3VMH D;  2QPZ A;  4AAY B;  2GBW A;  2E4Q A;  3H1L E;  3EN1 A;  2FYN C;  3GCE A;  3D89 A;  5KLI C;  2E74 D;  4PD4 E;  1ULI A;  4NBF A;  1SQX E;  1L0L E;  1NYK A;  3L75 E;  1UUW A;  1ZRT E;  3H1H E;  2HMN A;  4NBA D;  2HMO A;  1VCK A;  4HM7 A;  1EG9 A;  1NTK E;  3GCF A;  1KYO E;  3L72 E;  4NB8 D;  3VCP A;  4HM0 A;  3GB4 A;  1G8K B;  1EZV E;  3H1J E;  1FQT A;  1RIE A;  4PV1 D;  4AIV A;  4QUQ A;  5AEW A;  4NB9 A;  3CXH E;  3H1K E;  1O7W A;  4HJL A;  1Q90 C;  1WQL A;  4NB9 D;  4NBG A;  1O7G A;  2QJY C;  1L0N E;  4NBB D;  2DE5 D;  1O7N A;  3L73 E;  4H13 D;  2HMK A;  5HL4 A;  2NVE A;  1KB9 E;  4NBD A;  1JM1 A;  2BMQ A;  4HM6 A;  1BE3 E;  2YFI A;  1SQB E;  3CX5 E;  4EMJ B;  5BOK A;  4H0L D;  2JO6 A;  1Z01 A;  2D2C D;  3GOB A;  2Q3W A;  1ULJ A;  4U3F E;  2BMO A;  2JZA A;  4NBB A;  5KLV E;  2HMM A;  3DQY A;  4HM3 A;  3GKQ A;  3AZC A;  3TGU E;  2DE6 D; 
#chains in the Genus database with same CATH topology
 3GZY A;  1VM9 A;  2DE5 A;  4HM4 A;  1NTZ E;  1RFS A;  1O7M A;  1VF5 D;  4NBE D;  1SQP E;  4P1C H;  2IBZ E;  3CWB E;  4NB8 A;  1BCC E;  3VMI A;  3H1I E;  2QJK C;  2NVF A;  4HKV A;  2BCC E;  1P84 E;  3VMI D;  2GBX A;  1UUV A;  4QDC A;  2DE6 A;  4QDF B;  4HM8 A;  3GTS A;  3GZX A;  3L74 E;  4NBE A;  3GL0 A;  4HM2 A;  1Z02 A;  4QUR A;  1SJG A;  4P1B H;  4QDD A;  2NWF A;  1G8J B;  1O7H A;  3GTE A;  3GL2 A;  3GKE A;  1WW9 A;  4NBC D;  2NVG A;  3L71 E;  2I7F A;  4NBH A;  4QUP A;  3C0D A;  1SQQ E;  2NUM A;  2BMR A;  2DE7 D;  2YVJ B;  1NTM E;  5AEU A;  1PP9 E;  2B24 A;  2E75 D;  1Z03 A;  2ZYL A;  3VMG A;  2XRX A;  1SQV E;  1PPJ E;  2YFL A;  2NUK A;  2E4P A;  2ZT9 D;  3FOU A;  3L70 E;  4NBG D;  1NDO A;  4QDF A;  4NBC A;  1O7P A;  3VCA A;  4H44 D;  3VMG D;  2B1X A;  4NBH D;  4NBD D;  3BCC E;  4OGQ D;  2XSO A;  2XR8 A;  2DE7 A;  2HMJ A;  2YFJ A;  2FYU E;  2CKF A;  2XSH A;  4NBA A;  5KKZ C;  1NU1 E;  3N0Q A;  3EQQ A;  4QCK A;  4HM5 A;  2HML A;  5CXM A;  4NBF D;  3VMH A;  2QJP C;  2A06 E;  2E76 D;  2YIU C;  4HM1 A;  3VMH D;  2QPZ A;  4AAY B;  2GBW A;  2E4Q A;  3H1L E;  3EN1 A;  2FYN C;  3GCE A;  3D89 A;  5KLI C;  2E74 D;  4PD4 E;  1ULI A;  4NBF A;  1SQX E;  1L0L E;  1NYK A;  3L75 E;  1UUW A;  1ZRT E;  3H1H E;  2HMN A;  4NBA D;  2HMO A;  1VCK A;  4HM7 A;  1EG9 A;  1NTK E;  3GCF A;  1KYO E;  3L72 E;  4NB8 D;  3VCP A;  4HM0 A;  3GB4 A;  1G8K B;  1EZV E;  3H1J E;  1FQT A;  1RIE A;  4PV1 D;  4AIV A;  4QUQ A;  5AEW A;  4NB9 A;  3CXH E;  3H1K E;  1O7W A;  4HJL A;  1Q90 C;  1WQL A;  4NB9 D;  4NBG A;  1O7G A;  2QJY C;  1L0N E;  4NBB D;  2DE5 D;  1O7N A;  3L73 E;  4H13 D;  2HMK A;  5HL4 A;  2NVE A;  1KB9 E;  4NBD A;  1JM1 A;  2BMQ A;  4HM6 A;  1BE3 E;  2YFI A;  1SQB E;  3CX5 E;  4EMJ B;  5BOK A;  4H0L D;  2JO6 A;  1Z01 A;  2D2C D;  3GOB A;  2Q3W A;  1ULJ A;  4U3F E;  2BMO A;  2JZA A;  4NBB A;  5KLV E;  2HMM A;  3DQY A;  4HM3 A;  3GKQ A;  3AZC A;  3TGU E;  2DE6 D; 
#chains in the Genus database with same CATH homology
 3GZY A;  1VM9 A;  2DE5 A;  4HM4 A;  1NTZ E;  1RFS A;  1O7M A;  1VF5 D;  4NBE D;  1SQP E;  4P1C H;  2IBZ E;  3CWB E;  4NB8 A;  1BCC E;  3VMI A;  3H1I E;  2QJK C;  2NVF A;  4HKV A;  2BCC E;  1P84 E;  3VMI D;  2GBX A;  1UUV A;  4QDC A;  2DE6 A;  4QDF B;  4HM8 A;  3GTS A;  3GZX A;  3L74 E;  4NBE A;  3GL0 A;  4HM2 A;  1Z02 A;  4QUR A;  1SJG A;  4P1B H;  4QDD A;  2NWF A;  1G8J B;  1O7H A;  3GTE A;  3GL2 A;  3GKE A;  1WW9 A;  4NBC D;  2NVG A;  3L71 E;  2I7F A;  4NBH A;  4QUP A;  3C0D A;  1SQQ E;  2NUM A;  2BMR A;  2DE7 D;  2YVJ B;  1NTM E;  5AEU A;  1PP9 E;  2B24 A;  2E75 D;  1Z03 A;  2ZYL A;  3VMG A;  2XRX A;  1SQV E;  1PPJ E;  2YFL A;  2NUK A;  2E4P A;  2ZT9 D;  3FOU A;  3L70 E;  4NBG D;  1NDO A;  4QDF A;  4NBC A;  1O7P A;  3VCA A;  4H44 D;  3VMG D;  2B1X A;  4NBH D;  4NBD D;  3BCC E;  4OGQ D;  2XSO A;  2XR8 A;  2DE7 A;  2HMJ A;  2YFJ A;  2FYU E;  2CKF A;  2XSH A;  4NBA A;  5KKZ C;  1NU1 E;  3N0Q A;  3EQQ A;  4QCK A;  4HM5 A;  2HML A;  5CXM A;  4NBF D;  3VMH A;  2QJP C;  2A06 E;  2E76 D;  2YIU C;  4HM1 A;  3VMH D;  2QPZ A;  4AAY B;  2GBW A;  2E4Q A;  3H1L E;  3EN1 A;  2FYN C;  3GCE A;  3D89 A;  5KLI C;  2E74 D;  4PD4 E;  1ULI A;  4NBF A;  1SQX E;  1L0L E;  1NYK A;  3L75 E;  1UUW A;  1ZRT E;  3H1H E;  2HMN A;  4NBA D;  2HMO A;  1VCK A;  4HM7 A;  1EG9 A;  1NTK E;  3GCF A;  1KYO E;  3L72 E;  4NB8 D;  3VCP A;  4HM0 A;  3GB4 A;  1G8K B;  1EZV E;  3H1J E;  1FQT A;  1RIE A;  4PV1 D;  4AIV A;  4QUQ A;  5AEW A;  4NB9 A;  3CXH E;  3H1K E;  1O7W A;  4HJL A;  1Q90 C;  1WQL A;  4NB9 D;  4NBG A;  1O7G A;  2QJY C;  1L0N E;  4NBB D;  2DE5 D;  1O7N A;  3L73 E;  4H13 D;  2HMK A;  5HL4 A;  2NVE A;  1KB9 E;  4NBD A;  1JM1 A;  2BMQ A;  4HM6 A;  1BE3 E;  2YFI A;  1SQB E;  3CX5 E;  4EMJ B;  5BOK A;  4H0L D;  2JO6 A;  1Z01 A;  2D2C D;  3GOB A;  2Q3W A;  1ULJ A;  4U3F E;  2BMO A;  2JZA A;  4NBB A;  5KLV E;  2HMM A;  3DQY A;  4HM3 A;  3GKQ A;  3AZC A;  3TGU E;  2DE6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...