2XRXA

Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
442
structure length
432
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPTFNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 141
structure length 432
sequence length 442
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xrxA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xrxA01
1NU1E 2NUKA 4EMJB 2FYNC 2BMOA 3GKQA 3GTEA 5KKZC 2JO6A 1SQVE 1SQQE 2B24A 2ZT9D 2XSOA 3VCAA 2IBZE 4QURA 3CXHE 4NBBD 1NDOA 5KLIC 2YFJA 3GCFA 4H0LD 1UUVA 3L72E 4AAYB 2DE7D 1L0NE 4NB8A 2HMJA 4AIVA 4NBBA 4HM7A 2E75D 1O7PA 2HMLA 3L73E 2QJPC 4NBDA 1NTKE 2XRXA 3L70E 2DE7A 2I7FA 3EQQA 3GZYA 3FOUA 4PV1D 2HMMA 1O7MA 1O7GA 3VMGA 2QJKC 1ULJA 1G8JB 2DE5A 3H1HE 4QDDA 4NBGD 4QDFB 2HMOA 2DE6D 1Z03A 1Z02A 4HM1A 4U3FE 4HM6A 4NBGA 5HL4A 4NBAD 2NVFA 2FYUE 4HM4A 1P84E 1O7NA 2GBWA 1KB9E 4NB9D 1PP9E 1BE3E 4NBHD 4NBAA 3L75E 4HM3A 4NBED 4QCKA 4P1BH 1JM1A 2CKFA 2YVJB 2JZAA 2YFLA 1G8KB 1VCKA 2BMQA 2E4QA 1RIEA 4NBHA 1EZVE 3H1IE 4NBEA 1UUWA 2B1XA 4HM2A 4HJLA 4HM5A 5BOKA 1NTZE 1O7HA 4NBFD 2NVEA 4PD4E 3VMID 2E4PA 3GTSA 2XR8A 3L71E 3GCEA 4OGQD 3VMHD 2QPZA 3CWBE 3BCCE 4QDCA 2DE6A 4NBFA 2Q3WA 4QUPA 3L74E 3VMIA 1SQXE 2YIUC 4HM8A 2HMKA 3VMHA 1FQTA 1ULIA 1WW9A 5AEWA 3H1KE 1NYKA 2E76D 3TGUE 5KLVE 1VF5D 1ZRTE 4QDFA 4NB9A 1PPJE 1VM9A 3GL2A 2A06E 3GB4A 1BCCE 3GOBA 4QUQA 1Q90C 2NVGA 4P1CH 4NB8D 1KYOE 2NUMA 2YFIA 4NBCD 5AEUA 1O7WA 2BCCE 3GKEA 1WQLA 1EG9A 3VCPA 3EN1A 5CXMA 4NBDD 3GL0A 1Z01A 3CX5E 3H1LE 1RFSA 2QJYC 4H13D 2NWFA 3D89A 3H1JE 4HKVA 1L0LE 3VMGD 4NBCA 2GBXA 2XSHA 1SJGA 2HMNA 2DE5D 3AZCA 3GZXA 4HM0A 1SQBE 2E74D 2ZYLA 2D2CD 3DQYA 4H44D 1SQPE 3C0DA 1NTME 2BMRA 3N0QA
chains in the Genus database with same CATH superfamily
1NU1E 2NUKA 4EMJB 2FYNC 2BMOA 3GKQA 3GTEA 5KKZC 2JO6A 1SQVE 1SQQE 2B24A 2ZT9D 2XSOA 3VCAA 2IBZE 4QURA 3CXHE 4NBBD 1NDOA 5KLIC 2YFJA 3GCFA 4H0LD 1UUVA 3L72E 4AAYB 2DE7D 1L0NE 4NB8A 2HMJA 4AIVA 4NBBA 4HM7A 2E75D 1O7PA 2HMLA 3L73E 2QJPC 4NBDA 1NTKE 2XRXA 3L70E 2DE7A 2I7FA 3EQQA 3GZYA 3FOUA 4PV1D 2HMMA 1O7MA 1O7GA 3VMGA 2QJKC 1ULJA 1G8JB 2DE5A 3H1HE 4QDDA 4NBGD 4QDFB 2HMOA 2DE6D 1Z03A 1Z02A 4HM1A 4U3FE 4HM6A 4NBGA 5HL4A 4NBAD 2NVFA 2FYUE 4HM4A 1P84E 1O7NA 2GBWA 1KB9E 4NB9D 1PP9E 1BE3E 4NBHD 4NBAA 3L75E 4HM3A 4NBED 4QCKA 4P1BH 1JM1A 2CKFA 2YVJB 2JZAA 2YFLA 1G8KB 1VCKA 2BMQA 2E4QA 1RIEA 4NBHA 1EZVE 3H1IE 4NBEA 1UUWA 2B1XA 4HM2A 4HJLA 4HM5A 5BOKA 1NTZE 1O7HA 4NBFD 2NVEA 4PD4E 3VMID 2E4PA 3GTSA 2XR8A 3L71E 3GCEA 4OGQD 3VMHD 2QPZA 3CWBE 3BCCE 4QDCA 2DE6A 4NBFA 2Q3WA 4QUPA 3L74E 3VMIA 1SQXE 2YIUC 4HM8A 2HMKA 3VMHA 1FQTA 1ULIA 1WW9A 5AEWA 3H1KE 1NYKA 2E76D 3TGUE 5KLVE 1VF5D 1ZRTE 4QDFA 4NB9A 1PPJE 1VM9A 3GL2A 2A06E 3GB4A 1BCCE 3GOBA 4QUQA 1Q90C 2NVGA 4P1CH 4NB8D 1KYOE 2NUMA 2YFIA 4NBCD 5AEUA 1O7WA 2BCCE 3GKEA 1WQLA 1EG9A 3VCPA 3EN1A 5CXMA 4NBDD 3GL0A 1Z01A 3CX5E 3H1LE 1RFSA 2QJYC 4H13D 2NWFA 3D89A 3H1JE 4HKVA 1L0LE 3VMGD 4NBCA 2GBXA 2XSHA 1SJGA 2HMNA 2DE5D 3AZCA 3GZXA 4HM0A 1SQBE 2E74D 2ZYLA 2D2CD 3DQYA 4H44D 1SQPE 3C0DA 1NTME 2BMRA 3N0QA
chains in the Genus database with same CATH topology
1NU1E 2NUKA 4EMJB 2FYNC 2BMOA 3GKQA 3GTEA 5KKZC 2JO6A 1SQVE 1SQQE 2B24A 2ZT9D 2XSOA 3VCAA 2IBZE 4QURA 3CXHE 4NBBD 1NDOA 5KLIC 2YFJA 3GCFA 4H0LD 1UUVA 3L72E 4AAYB 2DE7D 1L0NE 4NB8A 2HMJA 4AIVA 4NBBA 4HM7A 2E75D 1O7PA 2HMLA 3L73E 2QJPC 4NBDA 1NTKE 2XRXA 3L70E 2DE7A 2I7FA 3EQQA 3GZYA 3FOUA 4PV1D 2HMMA 1O7MA 1O7GA 3VMGA 2QJKC 1ULJA 1G8JB 2DE5A 3H1HE 4QDDA 4NBGD 4QDFB 2HMOA 2DE6D 1Z03A 1Z02A 4HM1A 4U3FE 4HM6A 4NBGA 5HL4A 4NBAD 2NVFA 2FYUE 4HM4A 1P84E 1O7NA 2GBWA 1KB9E 4NB9D 1PP9E 1BE3E 4NBHD 4NBAA 3L75E 4HM3A 4NBED 4QCKA 4P1BH 1JM1A 2CKFA 2YVJB 2JZAA 2YFLA 1G8KB 1VCKA 2BMQA 2E4QA 1RIEA 4NBHA 1EZVE 3H1IE 4NBEA 1UUWA 2B1XA 4HM2A 4HJLA 4HM5A 5BOKA 1NTZE 1O7HA 4NBFD 2NVEA 4PD4E 3VMID 2E4PA 3GTSA 2XR8A 3L71E 3GCEA 4OGQD 3VMHD 2QPZA 3CWBE 3BCCE 4QDCA 2DE6A 4NBFA 2Q3WA 4QUPA 3L74E 3VMIA 1SQXE 2YIUC 4HM8A 2HMKA 3VMHA 1FQTA 1ULIA 1WW9A 5AEWA 3H1KE 1NYKA 2E76D 3TGUE 5KLVE 1VF5D 1ZRTE 4QDFA 4NB9A 1PPJE 1VM9A 3GL2A 2A06E 3GB4A 1BCCE 3GOBA 4QUQA 1Q90C 2NVGA 4P1CH 4NB8D 1KYOE 2NUMA 2YFIA 4NBCD 5AEUA 1O7WA 2BCCE 3GKEA 1WQLA 1EG9A 3VCPA 3EN1A 5CXMA 4NBDD 3GL0A 1Z01A 3CX5E 3H1LE 1RFSA 2QJYC 4H13D 2NWFA 3D89A 3H1JE 4HKVA 1L0LE 3VMGD 4NBCA 2GBXA 2XSHA 1SJGA 2HMNA 2DE5D 3AZCA 3GZXA 4HM0A 1SQBE 2E74D 2ZYLA 2D2CD 3DQYA 4H44D 1SQPE 3C0DA 1NTME 2BMRA 3N0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU1 E;  2NUK A;  4EMJ B;  2FYN C;  2BMO A;  3GKQ A;  3GTE A;  5KKZ C;  2JO6 A;  1SQV E;  1SQQ E;  2B24 A;  2ZT9 D;  2XSO A;  3VCA A;  2IBZ E;  4QUR A;  3CXH E;  4NBB D;  1NDO A;  5KLI C;  2YFJ A;  3GCF A;  4H0L D;  1UUV A;  3L72 E;  4AAY B;  2DE7 D;  1L0N E;  4NB8 A;  2HMJ A;  4AIV A;  4NBB A;  4HM7 A;  2E75 D;  1O7P A;  2HML A;  3L73 E;  2QJP C;  4NBD A;  1NTK E;  2XRX A;  3L70 E;  2DE7 A;  2I7F A;  3EQQ A;  3GZY A;  3FOU A;  4PV1 D;  2HMM A;  1O7M A;  1O7G A;  3VMG A;  2QJK C;  1ULJ A;  1G8J B;  2DE5 A;  3H1H E;  4QDD A;  4NBG D;  4QDF B;  2HMO A;  2DE6 D;  1Z03 A;  1Z02 A;  4HM1 A;  4U3F E;  4HM6 A;  4NBG A;  5HL4 A;  4NBA D;  2NVF A;  2FYU E;  4HM4 A;  1P84 E;  1O7N A;  2GBW A;  1KB9 E;  4NB9 D;  1PP9 E;  1BE3 E;  4NBH D;  4NBA A;  3L75 E;  4HM3 A;  4NBE D;  4QCK A;  4P1B H;  1JM1 A;  2CKF A;  2YVJ B;  2JZA A;  2YFL A;  1G8K B;  1VCK A;  2BMQ A;  2E4Q A;  1RIE A;  4NBH A;  1EZV E;  3H1I E;  4NBE A;  1UUW A;  2B1X A;  4HM2 A;  4HJL A;  4HM5 A;  5BOK A;  1NTZ E;  1O7H A;  4NBF D;  2NVE A;  4PD4 E;  3VMI D;  2E4P A;  3GTS A;  2XR8 A;  3L71 E;  3GCE A;  4OGQ D;  3VMH D;  2QPZ A;  3CWB E;  3BCC E;  4QDC A;  2DE6 A;  4NBF A;  2Q3W A;  4QUP A;  3L74 E;  3VMI A;  1SQX E;  2YIU C;  4HM8 A;  2HMK A;  3VMH A;  1FQT A;  1ULI A;  1WW9 A;  5AEW A;  3H1K E;  1NYK A;  2E76 D;  3TGU E;  5KLV E;  1VF5 D;  1ZRT E;  4QDF A;  4NB9 A;  1PPJ E;  1VM9 A;  3GL2 A;  2A06 E;  3GB4 A;  1BCC E;  3GOB A;  4QUQ A;  1Q90 C;  2NVG A;  4P1C H;  4NB8 D;  1KYO E;  2NUM A;  2YFI A;  4NBC D;  5AEU A;  1O7W A;  2BCC E;  3GKE A;  1WQL A;  1EG9 A;  3VCP A;  3EN1 A;  5CXM A;  4NBD D;  3GL0 A;  1Z01 A;  3CX5 E;  3H1L E;  1RFS A;  2QJY C;  4H13 D;  2NWF A;  3D89 A;  3H1J E;  4HKV A;  1L0L E;  3VMG D;  4NBC A;  2GBX A;  2XSH A;  1SJG A;  2HMN A;  2DE5 D;  3AZC A;  3GZX A;  4HM0 A;  1SQB E;  2E74 D;  2ZYL A;  2D2C D;  3DQY A;  4H44 D;  1SQP E;  3C0D A;  1NTM E;  2BMR A;  3N0Q A; 
#chains in the Genus database with same CATH topology
 1NU1 E;  2NUK A;  4EMJ B;  2FYN C;  2BMO A;  3GKQ A;  3GTE A;  5KKZ C;  2JO6 A;  1SQV E;  1SQQ E;  2B24 A;  2ZT9 D;  2XSO A;  3VCA A;  2IBZ E;  4QUR A;  3CXH E;  4NBB D;  1NDO A;  5KLI C;  2YFJ A;  3GCF A;  4H0L D;  1UUV A;  3L72 E;  4AAY B;  2DE7 D;  1L0N E;  4NB8 A;  2HMJ A;  4AIV A;  4NBB A;  4HM7 A;  2E75 D;  1O7P A;  2HML A;  3L73 E;  2QJP C;  4NBD A;  1NTK E;  2XRX A;  3L70 E;  2DE7 A;  2I7F A;  3EQQ A;  3GZY A;  3FOU A;  4PV1 D;  2HMM A;  1O7M A;  1O7G A;  3VMG A;  2QJK C;  1ULJ A;  1G8J B;  2DE5 A;  3H1H E;  4QDD A;  4NBG D;  4QDF B;  2HMO A;  2DE6 D;  1Z03 A;  1Z02 A;  4HM1 A;  4U3F E;  4HM6 A;  4NBG A;  5HL4 A;  4NBA D;  2NVF A;  2FYU E;  4HM4 A;  1P84 E;  1O7N A;  2GBW A;  1KB9 E;  4NB9 D;  1PP9 E;  1BE3 E;  4NBH D;  4NBA A;  3L75 E;  4HM3 A;  4NBE D;  4QCK A;  4P1B H;  1JM1 A;  2CKF A;  2YVJ B;  2JZA A;  2YFL A;  1G8K B;  1VCK A;  2BMQ A;  2E4Q A;  1RIE A;  4NBH A;  1EZV E;  3H1I E;  4NBE A;  1UUW A;  2B1X A;  4HM2 A;  4HJL A;  4HM5 A;  5BOK A;  1NTZ E;  1O7H A;  4NBF D;  2NVE A;  4PD4 E;  3VMI D;  2E4P A;  3GTS A;  2XR8 A;  3L71 E;  3GCE A;  4OGQ D;  3VMH D;  2QPZ A;  3CWB E;  3BCC E;  4QDC A;  2DE6 A;  4NBF A;  2Q3W A;  4QUP A;  3L74 E;  3VMI A;  1SQX E;  2YIU C;  4HM8 A;  2HMK A;  3VMH A;  1FQT A;  1ULI A;  1WW9 A;  5AEW A;  3H1K E;  1NYK A;  2E76 D;  3TGU E;  5KLV E;  1VF5 D;  1ZRT E;  4QDF A;  4NB9 A;  1PPJ E;  1VM9 A;  3GL2 A;  2A06 E;  3GB4 A;  1BCC E;  3GOB A;  4QUQ A;  1Q90 C;  2NVG A;  4P1C H;  4NB8 D;  1KYO E;  2NUM A;  2YFI A;  4NBC D;  5AEU A;  1O7W A;  2BCC E;  3GKE A;  1WQL A;  1EG9 A;  3VCP A;  3EN1 A;  5CXM A;  4NBD D;  3GL0 A;  1Z01 A;  3CX5 E;  3H1L E;  1RFS A;  2QJY C;  4H13 D;  2NWF A;  3D89 A;  3H1J E;  4HKV A;  1L0L E;  3VMG D;  4NBC A;  2GBX A;  2XSH A;  1SJG A;  2HMN A;  2DE5 D;  3AZC A;  3GZX A;  4HM0 A;  1SQB E;  2E74 D;  2ZYL A;  2D2C D;  3DQY A;  4H44 D;  1SQP E;  3C0D A;  1NTM E;  2BMR A;  3N0Q A; 
#chains in the Genus database with same CATH homology
 1NU1 E;  2NUK A;  4EMJ B;  2FYN C;  2BMO A;  3GKQ A;  3GTE A;  5KKZ C;  2JO6 A;  1SQV E;  1SQQ E;  2B24 A;  2ZT9 D;  2XSO A;  3VCA A;  2IBZ E;  4QUR A;  3CXH E;  4NBB D;  1NDO A;  5KLI C;  2YFJ A;  3GCF A;  4H0L D;  1UUV A;  3L72 E;  4AAY B;  2DE7 D;  1L0N E;  4NB8 A;  2HMJ A;  4AIV A;  4NBB A;  4HM7 A;  2E75 D;  1O7P A;  2HML A;  3L73 E;  2QJP C;  4NBD A;  1NTK E;  2XRX A;  3L70 E;  2DE7 A;  2I7F A;  3EQQ A;  3GZY A;  3FOU A;  4PV1 D;  2HMM A;  1O7M A;  1O7G A;  3VMG A;  2QJK C;  1ULJ A;  1G8J B;  2DE5 A;  3H1H E;  4QDD A;  4NBG D;  4QDF B;  2HMO A;  2DE6 D;  1Z03 A;  1Z02 A;  4HM1 A;  4U3F E;  4HM6 A;  4NBG A;  5HL4 A;  4NBA D;  2NVF A;  2FYU E;  4HM4 A;  1P84 E;  1O7N A;  2GBW A;  1KB9 E;  4NB9 D;  1PP9 E;  1BE3 E;  4NBH D;  4NBA A;  3L75 E;  4HM3 A;  4NBE D;  4QCK A;  4P1B H;  1JM1 A;  2CKF A;  2YVJ B;  2JZA A;  2YFL A;  1G8K B;  1VCK A;  2BMQ A;  2E4Q A;  1RIE A;  4NBH A;  1EZV E;  3H1I E;  4NBE A;  1UUW A;  2B1X A;  4HM2 A;  4HJL A;  4HM5 A;  5BOK A;  1NTZ E;  1O7H A;  4NBF D;  2NVE A;  4PD4 E;  3VMI D;  2E4P A;  3GTS A;  2XR8 A;  3L71 E;  3GCE A;  4OGQ D;  3VMH D;  2QPZ A;  3CWB E;  3BCC E;  4QDC A;  2DE6 A;  4NBF A;  2Q3W A;  4QUP A;  3L74 E;  3VMI A;  1SQX E;  2YIU C;  4HM8 A;  2HMK A;  3VMH A;  1FQT A;  1ULI A;  1WW9 A;  5AEW A;  3H1K E;  1NYK A;  2E76 D;  3TGU E;  5KLV E;  1VF5 D;  1ZRT E;  4QDF A;  4NB9 A;  1PPJ E;  1VM9 A;  3GL2 A;  2A06 E;  3GB4 A;  1BCC E;  3GOB A;  4QUQ A;  1Q90 C;  2NVG A;  4P1C H;  4NB8 D;  1KYO E;  2NUM A;  2YFI A;  4NBC D;  5AEU A;  1O7W A;  2BCC E;  3GKE A;  1WQL A;  1EG9 A;  3VCP A;  3EN1 A;  5CXM A;  4NBD D;  3GL0 A;  1Z01 A;  3CX5 E;  3H1L E;  1RFS A;  2QJY C;  4H13 D;  2NWF A;  3D89 A;  3H1J E;  4HKV A;  1L0L E;  3VMG D;  4NBC A;  2GBX A;  2XSH A;  1SJG A;  2HMN A;  2DE5 D;  3AZC A;  3GZX A;  4HM0 A;  1SQB E;  2E74 D;  2ZYL A;  2D2C D;  3DQY A;  4H44 D;  1SQP E;  3C0D A;  1NTM E;  2BMR A;  3N0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...