2XRXA

Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
442
structure length
432
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPTFNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
total genus 141
structure length 432
sequence length 442
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xrxA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xrxA01
4HM8A 5HL4A 3H1KE 2DE7A 2DE5A 2DE7D 2DE5D 4HJLA 4HM0A 4QURA 1Q90C 3H1JE 3L71E 1Z01A 1RFSA 3VCAA 5KKZC 4HM2A 1KYOE 2BMQA 3GZYA 2XSHA 1KB9E 1EZVE 5AEUA 1NDOA 1SQVE 1ZRTE 1RIEA 4PV1D 3H1HE 3N0QA 1BCCE 1O7GA 3GTSA 2NWFA 3DQYA 2Q3WA 1WQLA 4NB8A 4NB8D 2B24A 3GL2A 2XRXA 4OGQD 3VMGA 1Z03A 2XR8A 3VMGD 3C0DA 1O7HA 2QJKC 1PPJE 2NVGA 4QDDA 2NUMA 3L73E 2DE6A 2NVFA 2DE6D 3VCPA 3CX5E 3EN1A 3GOBA 4NBHA 4NBHD 5KLVE 1VCKA 3AZCA 4PD4E 4QDFB 3L70E 4HKVA 4P1BH 2HMJA 2BCCE 4HM5A 2E75D 3H1LE 4H44D 1UUWA 2HMOA 3D89A 3H1IE 4HM3A 5BOKA 1SQXE 1ULJA 2FYUE 2YFLA 1VM9A 4HM4A 1NU1E 4QUPA 3EQQA 1FQTA 2YFIA 2HMKA 3GZXA 1L0NE 1SQBE 2E74D 4QDFA 3VMHA 2YVJB 1BE3E 3VMHD 4H13D 2YIUC 2B1XA 4NB9A 2BMOA 4AAYB 3GB4A 1ULIA 4NB9D 2NVEA 1G8KB 5KLIC 2JZAA 2JO6A 3VMIA 1L0LE 2GBXA 1NYKA 3VMID 1Z02A 3GCEA 5AEWA 2IBZE 4HM6A 1NTME 3FOUA 4QDCA 3GTEA 2I7FA 4HM7A 2QJPC 1PP9E 5CXMA 2ZT9D 4U3FE 3L75E 4AIVA 3CWBE 4HM1A 3GL0A 2GBWA 2HMNA 3GKEA 4NBGA 2HMMA 4NBGD 4NBBA 3TGUE 1JM1A 2D2CD 4NBBD 4QCKA 2ZYLA 3L74E 2XSOA 2A06E 4NBCA 2CKFA 3GKQA 4EMJB 4NBCD 1O7WA 2E4QA 2HMLA 4H0LD 1SQQE 1O7NA 2NUKA 1NTZE 1O7MA 1WW9A 2QJYC 3CXHE 1NTKE 4NBAA 4P1CH 1SJGA 4NBAD 2E76D 1SQPE 1O7PA 2FYNC 4NBFA 1UUVA 3BCCE 2YFJA 4NBFD 1VF5D 4NBDA 4NBDD 4QUQA 1EG9A 1P84E 3GCFA 4NBEA 1G8JB 3L72E 4NBED 2E4PA 2QPZA 2BMRA
chains in the Genus database with same CATH superfamily
4HM8A 5HL4A 3H1KE 2DE7A 2DE5A 2DE7D 2DE5D 4HJLA 4HM0A 4QURA 1Q90C 3H1JE 3L71E 1Z01A 1RFSA 3VCAA 5KKZC 4HM2A 1KYOE 2BMQA 3GZYA 2XSHA 1KB9E 1EZVE 5AEUA 1NDOA 1SQVE 1ZRTE 1RIEA 4PV1D 3H1HE 3N0QA 1BCCE 1O7GA 3GTSA 2NWFA 3DQYA 2Q3WA 1WQLA 4NB8A 4NB8D 2B24A 3GL2A 2XRXA 4OGQD 3VMGA 1Z03A 2XR8A 3VMGD 3C0DA 1O7HA 2QJKC 1PPJE 2NVGA 4QDDA 2NUMA 3L73E 2DE6A 2NVFA 2DE6D 3VCPA 3CX5E 3EN1A 3GOBA 4NBHA 4NBHD 5KLVE 1VCKA 3AZCA 4PD4E 4QDFB 3L70E 4HKVA 4P1BH 2HMJA 2BCCE 4HM5A 2E75D 3H1LE 4H44D 1UUWA 2HMOA 3D89A 3H1IE 4HM3A 5BOKA 1SQXE 1ULJA 2FYUE 2YFLA 1VM9A 4HM4A 1NU1E 4QUPA 3EQQA 1FQTA 2YFIA 2HMKA 3GZXA 1L0NE 1SQBE 2E74D 4QDFA 3VMHA 2YVJB 1BE3E 3VMHD 4H13D 2YIUC 2B1XA 4NB9A 2BMOA 4AAYB 3GB4A 1ULIA 4NB9D 2NVEA 1G8KB 5KLIC 2JZAA 2JO6A 3VMIA 1L0LE 2GBXA 1NYKA 3VMID 1Z02A 3GCEA 5AEWA 2IBZE 4HM6A 1NTME 3FOUA 4QDCA 3GTEA 2I7FA 4HM7A 2QJPC 1PP9E 5CXMA 2ZT9D 4U3FE 3L75E 4AIVA 3CWBE 4HM1A 3GL0A 2GBWA 2HMNA 3GKEA 4NBGA 2HMMA 4NBGD 4NBBA 3TGUE 1JM1A 2D2CD 4NBBD 4QCKA 2ZYLA 3L74E 2XSOA 2A06E 4NBCA 2CKFA 3GKQA 4EMJB 4NBCD 1O7WA 2E4QA 2HMLA 4H0LD 1SQQE 1O7NA 2NUKA 1NTZE 1O7MA 1WW9A 2QJYC 3CXHE 1NTKE 4NBAA 4P1CH 1SJGA 4NBAD 2E76D 1SQPE 1O7PA 2FYNC 4NBFA 1UUVA 3BCCE 2YFJA 4NBFD 1VF5D 4NBDA 4NBDD 4QUQA 1EG9A 1P84E 3GCFA 4NBEA 1G8JB 3L72E 4NBED 2E4PA 2QPZA 2BMRA
chains in the Genus database with same CATH topology
4HM8A 5HL4A 3H1KE 2DE7A 2DE5A 2DE7D 2DE5D 4HJLA 4HM0A 4QURA 1Q90C 3H1JE 3L71E 1Z01A 1RFSA 3VCAA 5KKZC 4HM2A 1KYOE 2BMQA 3GZYA 2XSHA 1KB9E 1EZVE 5AEUA 1NDOA 1SQVE 1ZRTE 1RIEA 4PV1D 3H1HE 3N0QA 1BCCE 1O7GA 3GTSA 2NWFA 3DQYA 2Q3WA 1WQLA 4NB8A 4NB8D 2B24A 3GL2A 2XRXA 4OGQD 3VMGA 1Z03A 2XR8A 3VMGD 3C0DA 1O7HA 2QJKC 1PPJE 2NVGA 4QDDA 2NUMA 3L73E 2DE6A 2NVFA 2DE6D 3VCPA 3CX5E 3EN1A 3GOBA 4NBHA 4NBHD 5KLVE 1VCKA 3AZCA 4PD4E 4QDFB 3L70E 4HKVA 4P1BH 2HMJA 2BCCE 4HM5A 2E75D 3H1LE 4H44D 1UUWA 2HMOA 3D89A 3H1IE 4HM3A 5BOKA 1SQXE 1ULJA 2FYUE 2YFLA 1VM9A 4HM4A 1NU1E 4QUPA 3EQQA 1FQTA 2YFIA 2HMKA 3GZXA 1L0NE 1SQBE 2E74D 4QDFA 3VMHA 2YVJB 1BE3E 3VMHD 4H13D 2YIUC 2B1XA 4NB9A 2BMOA 4AAYB 3GB4A 1ULIA 4NB9D 2NVEA 1G8KB 5KLIC 2JZAA 2JO6A 3VMIA 1L0LE 2GBXA 1NYKA 3VMID 1Z02A 3GCEA 5AEWA 2IBZE 4HM6A 1NTME 3FOUA 4QDCA 3GTEA 2I7FA 4HM7A 2QJPC 1PP9E 5CXMA 2ZT9D 4U3FE 3L75E 4AIVA 3CWBE 4HM1A 3GL0A 2GBWA 2HMNA 3GKEA 4NBGA 2HMMA 4NBGD 4NBBA 3TGUE 1JM1A 2D2CD 4NBBD 4QCKA 2ZYLA 3L74E 2XSOA 2A06E 4NBCA 2CKFA 3GKQA 4EMJB 4NBCD 1O7WA 2E4QA 2HMLA 4H0LD 1SQQE 1O7NA 2NUKA 1NTZE 1O7MA 1WW9A 2QJYC 3CXHE 1NTKE 4NBAA 4P1CH 1SJGA 4NBAD 2E76D 1SQPE 1O7PA 2FYNC 4NBFA 1UUVA 3BCCE 2YFJA 4NBFD 1VF5D 4NBDA 4NBDD 4QUQA 1EG9A 1P84E 3GCFA 4NBEA 1G8JB 3L72E 4NBED 2E4PA 2QPZA 2BMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM8 A;  5HL4 A;  3H1K E;  2DE7 A;  2DE5 A;  2DE7 D;  2DE5 D;  4HJL A;  4HM0 A;  4QUR A;  1Q90 C;  3H1J E;  3L71 E;  1Z01 A;  1RFS A;  3VCA A;  5KKZ C;  4HM2 A;  1KYO E;  2BMQ A;  3GZY A;  2XSH A;  1KB9 E;  1EZV E;  5AEU A;  1NDO A;  1SQV E;  1ZRT E;  1RIE A;  4PV1 D;  3H1H E;  3N0Q A;  1BCC E;  1O7G A;  3GTS A;  2NWF A;  3DQY A;  2Q3W A;  1WQL A;  4NB8 A;  4NB8 D;  2B24 A;  3GL2 A;  2XRX A;  4OGQ D;  3VMG A;  1Z03 A;  2XR8 A;  3VMG D;  3C0D A;  1O7H A;  2QJK C;  1PPJ E;  2NVG A;  4QDD A;  2NUM A;  3L73 E;  2DE6 A;  2NVF A;  2DE6 D;  3VCP A;  3CX5 E;  3EN1 A;  3GOB A;  4NBH A;  4NBH D;  5KLV E;  1VCK A;  3AZC A;  4PD4 E;  4QDF B;  3L70 E;  4HKV A;  4P1B H;  2HMJ A;  2BCC E;  4HM5 A;  2E75 D;  3H1L E;  4H44 D;  1UUW A;  2HMO A;  3D89 A;  3H1I E;  4HM3 A;  5BOK A;  1SQX E;  1ULJ A;  2FYU E;  2YFL A;  1VM9 A;  4HM4 A;  1NU1 E;  4QUP A;  3EQQ A;  1FQT A;  2YFI A;  2HMK A;  3GZX A;  1L0N E;  1SQB E;  2E74 D;  4QDF A;  3VMH A;  2YVJ B;  1BE3 E;  3VMH D;  4H13 D;  2YIU C;  2B1X A;  4NB9 A;  2BMO A;  4AAY B;  3GB4 A;  1ULI A;  4NB9 D;  2NVE A;  1G8K B;  5KLI C;  2JZA A;  2JO6 A;  3VMI A;  1L0L E;  2GBX A;  1NYK A;  3VMI D;  1Z02 A;  3GCE A;  5AEW A;  2IBZ E;  4HM6 A;  1NTM E;  3FOU A;  4QDC A;  3GTE A;  2I7F A;  4HM7 A;  2QJP C;  1PP9 E;  5CXM A;  2ZT9 D;  4U3F E;  3L75 E;  4AIV A;  3CWB E;  4HM1 A;  3GL0 A;  2GBW A;  2HMN A;  3GKE A;  4NBG A;  2HMM A;  4NBG D;  4NBB A;  3TGU E;  1JM1 A;  2D2C D;  4NBB D;  4QCK A;  2ZYL A;  3L74 E;  2XSO A;  2A06 E;  4NBC A;  2CKF A;  3GKQ A;  4EMJ B;  4NBC D;  1O7W A;  2E4Q A;  2HML A;  4H0L D;  1SQQ E;  1O7N A;  2NUK A;  1NTZ E;  1O7M A;  1WW9 A;  2QJY C;  3CXH E;  1NTK E;  4NBA A;  4P1C H;  1SJG A;  4NBA D;  2E76 D;  1SQP E;  1O7P A;  2FYN C;  4NBF A;  1UUV A;  3BCC E;  2YFJ A;  4NBF D;  1VF5 D;  4NBD A;  4NBD D;  4QUQ A;  1EG9 A;  1P84 E;  3GCF A;  4NBE A;  1G8J B;  3L72 E;  4NBE D;  2E4P A;  2QPZ A;  2BMR A; 
#chains in the Genus database with same CATH topology
 4HM8 A;  5HL4 A;  3H1K E;  2DE7 A;  2DE5 A;  2DE7 D;  2DE5 D;  4HJL A;  4HM0 A;  4QUR A;  1Q90 C;  3H1J E;  3L71 E;  1Z01 A;  1RFS A;  3VCA A;  5KKZ C;  4HM2 A;  1KYO E;  2BMQ A;  3GZY A;  2XSH A;  1KB9 E;  1EZV E;  5AEU A;  1NDO A;  1SQV E;  1ZRT E;  1RIE A;  4PV1 D;  3H1H E;  3N0Q A;  1BCC E;  1O7G A;  3GTS A;  2NWF A;  3DQY A;  2Q3W A;  1WQL A;  4NB8 A;  4NB8 D;  2B24 A;  3GL2 A;  2XRX A;  4OGQ D;  3VMG A;  1Z03 A;  2XR8 A;  3VMG D;  3C0D A;  1O7H A;  2QJK C;  1PPJ E;  2NVG A;  4QDD A;  2NUM A;  3L73 E;  2DE6 A;  2NVF A;  2DE6 D;  3VCP A;  3CX5 E;  3EN1 A;  3GOB A;  4NBH A;  4NBH D;  5KLV E;  1VCK A;  3AZC A;  4PD4 E;  4QDF B;  3L70 E;  4HKV A;  4P1B H;  2HMJ A;  2BCC E;  4HM5 A;  2E75 D;  3H1L E;  4H44 D;  1UUW A;  2HMO A;  3D89 A;  3H1I E;  4HM3 A;  5BOK A;  1SQX E;  1ULJ A;  2FYU E;  2YFL A;  1VM9 A;  4HM4 A;  1NU1 E;  4QUP A;  3EQQ A;  1FQT A;  2YFI A;  2HMK A;  3GZX A;  1L0N E;  1SQB E;  2E74 D;  4QDF A;  3VMH A;  2YVJ B;  1BE3 E;  3VMH D;  4H13 D;  2YIU C;  2B1X A;  4NB9 A;  2BMO A;  4AAY B;  3GB4 A;  1ULI A;  4NB9 D;  2NVE A;  1G8K B;  5KLI C;  2JZA A;  2JO6 A;  3VMI A;  1L0L E;  2GBX A;  1NYK A;  3VMI D;  1Z02 A;  3GCE A;  5AEW A;  2IBZ E;  4HM6 A;  1NTM E;  3FOU A;  4QDC A;  3GTE A;  2I7F A;  4HM7 A;  2QJP C;  1PP9 E;  5CXM A;  2ZT9 D;  4U3F E;  3L75 E;  4AIV A;  3CWB E;  4HM1 A;  3GL0 A;  2GBW A;  2HMN A;  3GKE A;  4NBG A;  2HMM A;  4NBG D;  4NBB A;  3TGU E;  1JM1 A;  2D2C D;  4NBB D;  4QCK A;  2ZYL A;  3L74 E;  2XSO A;  2A06 E;  4NBC A;  2CKF A;  3GKQ A;  4EMJ B;  4NBC D;  1O7W A;  2E4Q A;  2HML A;  4H0L D;  1SQQ E;  1O7N A;  2NUK A;  1NTZ E;  1O7M A;  1WW9 A;  2QJY C;  3CXH E;  1NTK E;  4NBA A;  4P1C H;  1SJG A;  4NBA D;  2E76 D;  1SQP E;  1O7P A;  2FYN C;  4NBF A;  1UUV A;  3BCC E;  2YFJ A;  4NBF D;  1VF5 D;  4NBD A;  4NBD D;  4QUQ A;  1EG9 A;  1P84 E;  3GCF A;  4NBE A;  1G8J B;  3L72 E;  4NBE D;  2E4P A;  2QPZ A;  2BMR A; 
#chains in the Genus database with same CATH homology
 4HM8 A;  5HL4 A;  3H1K E;  2DE7 A;  2DE5 A;  2DE7 D;  2DE5 D;  4HJL A;  4HM0 A;  4QUR A;  1Q90 C;  3H1J E;  3L71 E;  1Z01 A;  1RFS A;  3VCA A;  5KKZ C;  4HM2 A;  1KYO E;  2BMQ A;  3GZY A;  2XSH A;  1KB9 E;  1EZV E;  5AEU A;  1NDO A;  1SQV E;  1ZRT E;  1RIE A;  4PV1 D;  3H1H E;  3N0Q A;  1BCC E;  1O7G A;  3GTS A;  2NWF A;  3DQY A;  2Q3W A;  1WQL A;  4NB8 A;  4NB8 D;  2B24 A;  3GL2 A;  2XRX A;  4OGQ D;  3VMG A;  1Z03 A;  2XR8 A;  3VMG D;  3C0D A;  1O7H A;  2QJK C;  1PPJ E;  2NVG A;  4QDD A;  2NUM A;  3L73 E;  2DE6 A;  2NVF A;  2DE6 D;  3VCP A;  3CX5 E;  3EN1 A;  3GOB A;  4NBH A;  4NBH D;  5KLV E;  1VCK A;  3AZC A;  4PD4 E;  4QDF B;  3L70 E;  4HKV A;  4P1B H;  2HMJ A;  2BCC E;  4HM5 A;  2E75 D;  3H1L E;  4H44 D;  1UUW A;  2HMO A;  3D89 A;  3H1I E;  4HM3 A;  5BOK A;  1SQX E;  1ULJ A;  2FYU E;  2YFL A;  1VM9 A;  4HM4 A;  1NU1 E;  4QUP A;  3EQQ A;  1FQT A;  2YFI A;  2HMK A;  3GZX A;  1L0N E;  1SQB E;  2E74 D;  4QDF A;  3VMH A;  2YVJ B;  1BE3 E;  3VMH D;  4H13 D;  2YIU C;  2B1X A;  4NB9 A;  2BMO A;  4AAY B;  3GB4 A;  1ULI A;  4NB9 D;  2NVE A;  1G8K B;  5KLI C;  2JZA A;  2JO6 A;  3VMI A;  1L0L E;  2GBX A;  1NYK A;  3VMI D;  1Z02 A;  3GCE A;  5AEW A;  2IBZ E;  4HM6 A;  1NTM E;  3FOU A;  4QDC A;  3GTE A;  2I7F A;  4HM7 A;  2QJP C;  1PP9 E;  5CXM A;  2ZT9 D;  4U3F E;  3L75 E;  4AIV A;  3CWB E;  4HM1 A;  3GL0 A;  2GBW A;  2HMN A;  3GKE A;  4NBG A;  2HMM A;  4NBG D;  4NBB A;  3TGU E;  1JM1 A;  2D2C D;  4NBB D;  4QCK A;  2ZYL A;  3L74 E;  2XSO A;  2A06 E;  4NBC A;  2CKF A;  3GKQ A;  4EMJ B;  4NBC D;  1O7W A;  2E4Q A;  2HML A;  4H0L D;  1SQQ E;  1O7N A;  2NUK A;  1NTZ E;  1O7M A;  1WW9 A;  2QJY C;  3CXH E;  1NTK E;  4NBA A;  4P1C H;  1SJG A;  4NBA D;  2E76 D;  1SQP E;  1O7P A;  2FYN C;  4NBF A;  1UUV A;  3BCC E;  2YFJ A;  4NBF D;  1VF5 D;  4NBD A;  4NBD D;  4QUQ A;  1EG9 A;  1P84 E;  3GCF A;  4NBE A;  1G8J B;  3L72 E;  4NBE D;  2E4P A;  2QPZ A;  2BMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...