3C0DA

Crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
109
Chain Sequence
LTKVKLCQLDDLMPFIGATVLIEGERVALFYIPDSGVYAVQDWDPIGKAYVMSRGIVGDINGEMCVASPLYKQHFSLKSGQCLEDEAHCLKTWRVTVDDNQVCYLAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nitrite reductase NADPH (Small subunit) oxidoreduct
publication title Crystal structure of the putative nitrite reductase NADPH (small subunit) oxidoreductase protein Q87HB1.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Oxidoreductase
total genus 14
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13806 Rieske_2 Rieske-like [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3c0dA00
5AEWA 1KB9E 4U3FE 3L70E 2NUMA 5BOKA 1FQTA 2GBXA 1SQBE 3L74E 3GL2A 2XSHA 4PV1D 4QDFA 4QUQA 3H1KE 3GOBA 3GKEA 1O7WA 2QPZA 4QDFB 1L0NE 2XR8A 5KLVE 1NTME 4PD4E 1VF5D 2E75D 1PPJE 1O7MA 1RIEA 3H1JE 4P1BH 3GTEA 1JM1A 2D2CD 3L72E 2A06E 1UUVA 3FOUA 2DE7D 4H13D 2DE6D 2YFJA 1SQQE 3L75E 2FYNC 2ZT9D 3L73E 5KKZC 5KLIC 3GCEA 5AEUA 4QUPA 1BCCE 4HKVA 2E76D 4QDDA 2BMRA 2FYUE 1P84E 3VMID 1G8KB 1Q90C 2HMMA 4NBBD 2DE5D 1BE3E 1UUWA 4NBHD 3GB4A 5HL4A 2I7FA 1NYKA 2HMJA 4AAYB 4HM4A 2QJYC 4H44D 3CWBE 1G8JB 4NBCD 4EMJB 3VMGD 1L0LE 3H1HE 1SQPE 4NB8D 2HMOA 2QJPC 1ZRTE 4NBAD 1WQLA 2GBWA 2BMQA 1KYOE 1SQXE 2XSOA 4HJLA 3CX5E 3D89A 4P1CH 2B1XA 5CXMA 2NVGA 2JZAA 4HM1A 2B24A 1VM9A 4OGQD 3H1IE 4NB9D 3N0QA 2E4PA 3VCAA 3VMHD 2YFLA 1O7PA 2NWFA 1NTZE 3BCCE 4HM6A 4HM7A 3GZYA 1O7NA 1ULJA 4HM0A 1NDOA 1RFSA 4NBFD 3GZXA 1SJGA 3GTSA 3H1LE 4QDCA 1EZVE 4H0LD 2YVJB 2ZYLA 3L71E 1SQVE 2JO6A 4HM2A 1VCKA 1O7HA 2BCCE 3AZCA 2Q3WA 1ULIA 4QURA 2BMOA 3CXHE 2E4QA 1NTKE 2NUKA 2HMLA 3C0DA 1PP9E 1EG9A 2HMKA 4HM8A 3DQYA 2QJKC 2IBZE 4QCKA 1NU1E 2YFIA 2XRXA 4NBED 3EQQA 1O7GA 4NBDD 2NVFA 4NBGD 4AIVA 2CKFA 4HM5A 2YIUC 3EN1A 2E74D 4HM3A 2HMNA 2NVEA 3GL0A 3VCPA 3TGUE
chains in the Genus database with same CATH superfamily
5AEWA 1KB9E 4U3FE 3L70E 2NUMA 5BOKA 1FQTA 2GBXA 1SQBE 3L74E 3GL2A 2XSHA 4PV1D 4QDFA 4QUQA 3H1KE 3GOBA 3GKEA 1O7WA 2QPZA 4QDFB 1L0NE 2XR8A 5KLVE 1NTME 4PD4E 1VF5D 2E75D 1PPJE 1O7MA 1RIEA 3H1JE 4P1BH 3GTEA 1JM1A 2D2CD 3L72E 2A06E 1UUVA 3FOUA 2DE7D 4H13D 2DE6D 2YFJA 1SQQE 3L75E 2FYNC 2ZT9D 3L73E 5KKZC 5KLIC 3GCEA 5AEUA 4QUPA 1BCCE 4HKVA 2E76D 4QDDA 2BMRA 2FYUE 1P84E 3VMID 1G8KB 1Q90C 2HMMA 4NBBD 2DE5D 1BE3E 1UUWA 4NBHD 3GB4A 5HL4A 2I7FA 1NYKA 2HMJA 4AAYB 4HM4A 2QJYC 4H44D 3CWBE 1G8JB 4NBCD 4EMJB 3VMGD 1L0LE 3H1HE 1SQPE 4NB8D 2HMOA 2QJPC 1ZRTE 4NBAD 1WQLA 2GBWA 2BMQA 1KYOE 1SQXE 2XSOA 4HJLA 3CX5E 3D89A 4P1CH 2B1XA 5CXMA 2NVGA 2JZAA 4HM1A 2B24A 1VM9A 4OGQD 3H1IE 4NB9D 3N0QA 2E4PA 3VCAA 3VMHD 2YFLA 1O7PA 2NWFA 1NTZE 3BCCE 4HM6A 4HM7A 3GZYA 1O7NA 1ULJA 4HM0A 1NDOA 1RFSA 4NBFD 3GZXA 1SJGA 3GTSA 3H1LE 4QDCA 1EZVE 4H0LD 2YVJB 2ZYLA 3L71E 1SQVE 2JO6A 4HM2A 1VCKA 1O7HA 2BCCE 3AZCA 2Q3WA 1ULIA 4QURA 2BMOA 3CXHE 2E4QA 1NTKE 2NUKA 2HMLA 3C0DA 1PP9E 1EG9A 2HMKA 4HM8A 3DQYA 2QJKC 2IBZE 4QCKA 1NU1E 2YFIA 2XRXA 4NBED 3EQQA 1O7GA 4NBDD 2NVFA 4NBGD 4AIVA 2CKFA 4HM5A 2YIUC 3EN1A 2E74D 4HM3A 2HMNA 2NVEA 3GL0A 3VCPA 3TGUE
chains in the Genus database with same CATH topology
5AEWA 1KB9E 4U3FE 3L70E 2NUMA 5BOKA 1FQTA 2GBXA 1SQBE 3L74E 3GL2A 2XSHA 4PV1D 4QDFA 4QUQA 3H1KE 3GOBA 3GKEA 1O7WA 2QPZA 4QDFB 1L0NE 2XR8A 5KLVE 1NTME 4PD4E 1VF5D 2E75D 1PPJE 1O7MA 1RIEA 3H1JE 4P1BH 3GTEA 1JM1A 2D2CD 3L72E 2A06E 1UUVA 3FOUA 2DE7D 4H13D 2DE6D 2YFJA 1SQQE 3L75E 2FYNC 2ZT9D 3L73E 5KKZC 5KLIC 3GCEA 5AEUA 4QUPA 1BCCE 4HKVA 2E76D 4QDDA 2BMRA 2FYUE 1P84E 3VMID 1G8KB 1Q90C 2HMMA 4NBBD 2DE5D 1BE3E 1UUWA 4NBHD 3GB4A 5HL4A 2I7FA 1NYKA 2HMJA 4AAYB 4HM4A 2QJYC 4H44D 3CWBE 1G8JB 4NBCD 4EMJB 3VMGD 1L0LE 3H1HE 1SQPE 4NB8D 2HMOA 2QJPC 1ZRTE 4NBAD 1WQLA 2GBWA 2BMQA 1KYOE 1SQXE 2XSOA 4HJLA 3CX5E 3D89A 4P1CH 2B1XA 5CXMA 2NVGA 2JZAA 4HM1A 2B24A 1VM9A 4OGQD 3H1IE 4NB9D 3N0QA 2E4PA 3VCAA 3VMHD 2YFLA 1O7PA 2NWFA 1NTZE 3BCCE 4HM6A 4HM7A 3GZYA 1O7NA 1ULJA 4HM0A 1NDOA 1RFSA 4NBFD 3GZXA 1SJGA 3GTSA 3H1LE 4QDCA 1EZVE 4H0LD 2YVJB 2ZYLA 3L71E 1SQVE 2JO6A 4HM2A 1VCKA 1O7HA 2BCCE 3AZCA 2Q3WA 1ULIA 4QURA 2BMOA 3CXHE 2E4QA 1NTKE 2NUKA 2HMLA 3C0DA 1PP9E 1EG9A 2HMKA 4HM8A 3DQYA 2QJKC 2IBZE 4QCKA 1NU1E 2YFIA 2XRXA 4NBED 3EQQA 1O7GA 4NBDD 2NVFA 4NBGD 4AIVA 2CKFA 4HM5A 2YIUC 3EN1A 2E74D 4HM3A 2HMNA 2NVEA 3GL0A 3VCPA 3TGUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEW A;  1KB9 E;  4U3F E;  3L70 E;  2NUM A;  5BOK A;  1FQT A;  2GBX A;  1SQB E;  3L74 E;  3GL2 A;  2XSH A;  4PV1 D;  4QDF A;  4QUQ A;  3H1K E;  3GOB A;  3GKE A;  1O7W A;  2QPZ A;  4QDF B;  1L0N E;  2XR8 A;  5KLV E;  1NTM E;  4PD4 E;  1VF5 D;  2E75 D;  1PPJ E;  1O7M A;  1RIE A;  3H1J E;  4P1B H;  3GTE A;  1JM1 A;  2D2C D;  3L72 E;  2A06 E;  1UUV A;  3FOU A;  2DE7 D;  4H13 D;  2DE6 D;  2YFJ A;  1SQQ E;  3L75 E;  2FYN C;  2ZT9 D;  3L73 E;  5KKZ C;  5KLI C;  3GCE A;  5AEU A;  4QUP A;  1BCC E;  4HKV A;  2E76 D;  4QDD A;  2BMR A;  2FYU E;  1P84 E;  3VMI D;  1G8K B;  1Q90 C;  2HMM A;  4NBB D;  2DE5 D;  1BE3 E;  1UUW A;  4NBH D;  3GB4 A;  5HL4 A;  2I7F A;  1NYK A;  2HMJ A;  4AAY B;  4HM4 A;  2QJY C;  4H44 D;  3CWB E;  1G8J B;  4NBC D;  4EMJ B;  3VMG D;  1L0L E;  3H1H E;  1SQP E;  4NB8 D;  2HMO A;  2QJP C;  1ZRT E;  4NBA D;  1WQL A;  2GBW A;  2BMQ A;  1KYO E;  1SQX E;  2XSO A;  4HJL A;  3CX5 E;  3D89 A;  4P1C H;  2B1X A;  5CXM A;  2NVG A;  2JZA A;  4HM1 A;  2B24 A;  1VM9 A;  4OGQ D;  3H1I E;  4NB9 D;  3N0Q A;  2E4P A;  3VCA A;  3VMH D;  2YFL A;  1O7P A;  2NWF A;  1NTZ E;  3BCC E;  4HM6 A;  4HM7 A;  3GZY A;  1O7N A;  1ULJ A;  4HM0 A;  1NDO A;  1RFS A;  4NBF D;  3GZX A;  1SJG A;  3GTS A;  3H1L E;  4QDC A;  1EZV E;  4H0L D;  2YVJ B;  2ZYL A;  3L71 E;  1SQV E;  2JO6 A;  4HM2 A;  1VCK A;  1O7H A;  2BCC E;  3AZC A;  2Q3W A;  1ULI A;  4QUR A;  2BMO A;  3CXH E;  2E4Q A;  1NTK E;  2NUK A;  2HML A;  3C0D A;  1PP9 E;  1EG9 A;  2HMK A;  4HM8 A;  3DQY A;  2QJK C;  2IBZ E;  4QCK A;  1NU1 E;  2YFI A;  2XRX A;  4NBE D;  3EQQ A;  1O7G A;  4NBD D;  2NVF A;  4NBG D;  4AIV A;  2CKF A;  4HM5 A;  2YIU C;  3EN1 A;  2E74 D;  4HM3 A;  2HMN A;  2NVE A;  3GL0 A;  3VCP A;  3TGU E; 
#chains in the Genus database with same CATH topology
 5AEW A;  1KB9 E;  4U3F E;  3L70 E;  2NUM A;  5BOK A;  1FQT A;  2GBX A;  1SQB E;  3L74 E;  3GL2 A;  2XSH A;  4PV1 D;  4QDF A;  4QUQ A;  3H1K E;  3GOB A;  3GKE A;  1O7W A;  2QPZ A;  4QDF B;  1L0N E;  2XR8 A;  5KLV E;  1NTM E;  4PD4 E;  1VF5 D;  2E75 D;  1PPJ E;  1O7M A;  1RIE A;  3H1J E;  4P1B H;  3GTE A;  1JM1 A;  2D2C D;  3L72 E;  2A06 E;  1UUV A;  3FOU A;  2DE7 D;  4H13 D;  2DE6 D;  2YFJ A;  1SQQ E;  3L75 E;  2FYN C;  2ZT9 D;  3L73 E;  5KKZ C;  5KLI C;  3GCE A;  5AEU A;  4QUP A;  1BCC E;  4HKV A;  2E76 D;  4QDD A;  2BMR A;  2FYU E;  1P84 E;  3VMI D;  1G8K B;  1Q90 C;  2HMM A;  4NBB D;  2DE5 D;  1BE3 E;  1UUW A;  4NBH D;  3GB4 A;  5HL4 A;  2I7F A;  1NYK A;  2HMJ A;  4AAY B;  4HM4 A;  2QJY C;  4H44 D;  3CWB E;  1G8J B;  4NBC D;  4EMJ B;  3VMG D;  1L0L E;  3H1H E;  1SQP E;  4NB8 D;  2HMO A;  2QJP C;  1ZRT E;  4NBA D;  1WQL A;  2GBW A;  2BMQ A;  1KYO E;  1SQX E;  2XSO A;  4HJL A;  3CX5 E;  3D89 A;  4P1C H;  2B1X A;  5CXM A;  2NVG A;  2JZA A;  4HM1 A;  2B24 A;  1VM9 A;  4OGQ D;  3H1I E;  4NB9 D;  3N0Q A;  2E4P A;  3VCA A;  3VMH D;  2YFL A;  1O7P A;  2NWF A;  1NTZ E;  3BCC E;  4HM6 A;  4HM7 A;  3GZY A;  1O7N A;  1ULJ A;  4HM0 A;  1NDO A;  1RFS A;  4NBF D;  3GZX A;  1SJG A;  3GTS A;  3H1L E;  4QDC A;  1EZV E;  4H0L D;  2YVJ B;  2ZYL A;  3L71 E;  1SQV E;  2JO6 A;  4HM2 A;  1VCK A;  1O7H A;  2BCC E;  3AZC A;  2Q3W A;  1ULI A;  4QUR A;  2BMO A;  3CXH E;  2E4Q A;  1NTK E;  2NUK A;  2HML A;  3C0D A;  1PP9 E;  1EG9 A;  2HMK A;  4HM8 A;  3DQY A;  2QJK C;  2IBZ E;  4QCK A;  1NU1 E;  2YFI A;  2XRX A;  4NBE D;  3EQQ A;  1O7G A;  4NBD D;  2NVF A;  4NBG D;  4AIV A;  2CKF A;  4HM5 A;  2YIU C;  3EN1 A;  2E74 D;  4HM3 A;  2HMN A;  2NVE A;  3GL0 A;  3VCP A;  3TGU E; 
#chains in the Genus database with same CATH homology
 5AEW A;  1KB9 E;  4U3F E;  3L70 E;  2NUM A;  5BOK A;  1FQT A;  2GBX A;  1SQB E;  3L74 E;  3GL2 A;  2XSH A;  4PV1 D;  4QDF A;  4QUQ A;  3H1K E;  3GOB A;  3GKE A;  1O7W A;  2QPZ A;  4QDF B;  1L0N E;  2XR8 A;  5KLV E;  1NTM E;  4PD4 E;  1VF5 D;  2E75 D;  1PPJ E;  1O7M A;  1RIE A;  3H1J E;  4P1B H;  3GTE A;  1JM1 A;  2D2C D;  3L72 E;  2A06 E;  1UUV A;  3FOU A;  2DE7 D;  4H13 D;  2DE6 D;  2YFJ A;  1SQQ E;  3L75 E;  2FYN C;  2ZT9 D;  3L73 E;  5KKZ C;  5KLI C;  3GCE A;  5AEU A;  4QUP A;  1BCC E;  4HKV A;  2E76 D;  4QDD A;  2BMR A;  2FYU E;  1P84 E;  3VMI D;  1G8K B;  1Q90 C;  2HMM A;  4NBB D;  2DE5 D;  1BE3 E;  1UUW A;  4NBH D;  3GB4 A;  5HL4 A;  2I7F A;  1NYK A;  2HMJ A;  4AAY B;  4HM4 A;  2QJY C;  4H44 D;  3CWB E;  1G8J B;  4NBC D;  4EMJ B;  3VMG D;  1L0L E;  3H1H E;  1SQP E;  4NB8 D;  2HMO A;  2QJP C;  1ZRT E;  4NBA D;  1WQL A;  2GBW A;  2BMQ A;  1KYO E;  1SQX E;  2XSO A;  4HJL A;  3CX5 E;  3D89 A;  4P1C H;  2B1X A;  5CXM A;  2NVG A;  2JZA A;  4HM1 A;  2B24 A;  1VM9 A;  4OGQ D;  3H1I E;  4NB9 D;  3N0Q A;  2E4P A;  3VCA A;  3VMH D;  2YFL A;  1O7P A;  2NWF A;  1NTZ E;  3BCC E;  4HM6 A;  4HM7 A;  3GZY A;  1O7N A;  1ULJ A;  4HM0 A;  1NDO A;  1RFS A;  4NBF D;  3GZX A;  1SJG A;  3GTS A;  3H1L E;  4QDC A;  1EZV E;  4H0L D;  2YVJ B;  2ZYL A;  3L71 E;  1SQV E;  2JO6 A;  4HM2 A;  1VCK A;  1O7H A;  2BCC E;  3AZC A;  2Q3W A;  1ULI A;  4QUR A;  2BMO A;  3CXH E;  2E4Q A;  1NTK E;  2NUK A;  2HML A;  3C0D A;  1PP9 E;  1EG9 A;  2HMK A;  4HM8 A;  3DQY A;  2QJK C;  2IBZ E;  4QCK A;  1NU1 E;  2YFI A;  2XRX A;  4NBE D;  3EQQ A;  1O7G A;  4NBD D;  2NVF A;  4NBG D;  4AIV A;  2CKF A;  4HM5 A;  2YIU C;  3EN1 A;  2E74 D;  4HM3 A;  2HMN A;  2NVE A;  3GL0 A;  3VCP A;  3TGU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...