3C0DA

Crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
109
Chain Sequence
LTKVKLCQLDDLMPFIGATVLIEGERVALFYIPDSGVYAVQDWDPIGKAYVMSRGIVGDINGEMCVASPLYKQHFSLKSGQCLEDEAHCLKTWRVTVDDNQVCYLAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative nitrite reductase NADPH (Small subunit) oxidoreduct
publication title Crystal structure of the putative nitrite reductase NADPH (small subunit) oxidoreductase protein Q87HB1.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
total genus 14
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13806 Rieske_2 Rieske-like [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3c0dA00
1O7MA 1O7WA 2QJYC 1BCCE 1JM1A 1UUVA 1Q90C 3GTEA 4NBBD 5KLVE 3VMGD 4NBHD 4QUQA 4NBAD 3AZCA 2DE6D 2NVFA 2YFJA 1O7PA 1VM9A 4QDFB 2Q3WA 2FYUE 2E4PA 1SQPE 1NU1E 1RFSA 2YFLA 3L70E 2IBZE 2YIUC 3VCPA 3DQYA 1NTME 4HM2A 2CKFA 3L73E 2HMMA 2QPZA 3H1LE 1ZRTE 2BMQA 2ZYLA 2BCCE 3FOUA 4H13D 4PD4E 1UUWA 3EN1A 2DE5D 4HM8A 4QDFA 2HMJA 3L71E 2QJPC 4QCKA 5BOKA 2GBWA 4QURA 4NBFD 2NVGA 2HMNA 2NUKA 3GZXA 1L0NE 4HKVA 4NBED 1BE3E 2ZT9D 2XSHA 1SQBE 1SQVE 1WQLA 4NBDD 2I7FA 1O7HA 4H0LD 2D2CD 3GB4A 2JO6A 2DE7D 1L0LE 2YFIA 3N0QA 1KYOE 3BCCE 4P1CH 4OGQD 3EQQA 3H1IE 3GZYA 4HM4A 3GCEA 5HL4A 4AAYB 4EMJB 1VCKA 4HM5A 4QUPA 5KLIC 3H1HE 1O7NA 2BMOA 2HMLA 2GBXA 3GL2A 3L74E 4HM6A 2E75D 2NWFA 3L75E 3H1JE 2JZAA 1NYKA 3GL0A 1SQQE 5AEUA 3VMID 3D89A 1EG9A 4HM1A 5KKZC 1G8KB 2NVEA 3C0DA 4HM0A 1SQXE 4HJLA 4U3FE 3VCAA 1ULIA 3H1KE 4AIVA 2XRXA 3GKEA 3VMHD 1P84E 2YVJB 2E74D 3CWBE 2XSOA 4H44D 1SJGA 1FQTA 1KB9E 4NBCD 2NUMA 1ULJA 4PV1D 1PP9E 2A06E 3L72E 4NB8D 2HMKA 2FYNC 1G8JB 1EZVE 2XR8A 3GOBA 4QDCA 1NDOA 1NTZE 1O7GA 1PPJE 1NTKE 4P1BH 2BMRA 3CX5E 2HMOA 4NBGD 5CXMA 1VF5D 2B24A 2B1XA 4HM3A 5AEWA 3GTSA 4NB9D 2QJKC 3TGUE 2E4QA 3CXHE 2E76D 1RIEA 4HM7A 4QDDA
chains in the Genus database with same CATH superfamily
1O7MA 1O7WA 2QJYC 1BCCE 1JM1A 1UUVA 1Q90C 3GTEA 4NBBD 5KLVE 3VMGD 4NBHD 4QUQA 4NBAD 3AZCA 2DE6D 2NVFA 2YFJA 1O7PA 1VM9A 4QDFB 2Q3WA 2FYUE 2E4PA 1SQPE 1NU1E 1RFSA 2YFLA 3L70E 2IBZE 2YIUC 3VCPA 3DQYA 1NTME 4HM2A 2CKFA 3L73E 2HMMA 2QPZA 3H1LE 1ZRTE 2BMQA 2ZYLA 2BCCE 3FOUA 4H13D 4PD4E 1UUWA 3EN1A 2DE5D 4HM8A 4QDFA 2HMJA 3L71E 2QJPC 4QCKA 5BOKA 2GBWA 4QURA 4NBFD 2NVGA 2HMNA 2NUKA 3GZXA 1L0NE 4HKVA 4NBED 1BE3E 2ZT9D 2XSHA 1SQBE 1SQVE 1WQLA 4NBDD 2I7FA 1O7HA 4H0LD 2D2CD 3GB4A 2JO6A 2DE7D 1L0LE 2YFIA 3N0QA 1KYOE 3BCCE 4P1CH 4OGQD 3EQQA 3H1IE 3GZYA 4HM4A 3GCEA 5HL4A 4AAYB 4EMJB 1VCKA 4HM5A 4QUPA 5KLIC 3H1HE 1O7NA 2BMOA 2HMLA 2GBXA 3GL2A 3L74E 4HM6A 2E75D 2NWFA 3L75E 3H1JE 2JZAA 1NYKA 3GL0A 1SQQE 5AEUA 3VMID 3D89A 1EG9A 4HM1A 5KKZC 1G8KB 2NVEA 3C0DA 4HM0A 1SQXE 4HJLA 4U3FE 3VCAA 1ULIA 3H1KE 4AIVA 2XRXA 3GKEA 3VMHD 1P84E 2YVJB 2E74D 3CWBE 2XSOA 4H44D 1SJGA 1FQTA 1KB9E 4NBCD 2NUMA 1ULJA 4PV1D 1PP9E 2A06E 3L72E 4NB8D 2HMKA 2FYNC 1G8JB 1EZVE 2XR8A 3GOBA 4QDCA 1NDOA 1NTZE 1O7GA 1PPJE 1NTKE 4P1BH 2BMRA 3CX5E 2HMOA 4NBGD 5CXMA 1VF5D 2B24A 2B1XA 4HM3A 5AEWA 3GTSA 4NB9D 2QJKC 3TGUE 2E4QA 3CXHE 2E76D 1RIEA 4HM7A 4QDDA
chains in the Genus database with same CATH topology
1O7MA 1O7WA 2QJYC 1BCCE 1JM1A 1UUVA 1Q90C 3GTEA 4NBBD 5KLVE 3VMGD 4NBHD 4QUQA 4NBAD 3AZCA 2DE6D 2NVFA 2YFJA 1O7PA 1VM9A 4QDFB 2Q3WA 2FYUE 2E4PA 1SQPE 1NU1E 1RFSA 2YFLA 3L70E 2IBZE 2YIUC 3VCPA 3DQYA 1NTME 4HM2A 2CKFA 3L73E 2HMMA 2QPZA 3H1LE 1ZRTE 2BMQA 2ZYLA 2BCCE 3FOUA 4H13D 4PD4E 1UUWA 3EN1A 2DE5D 4HM8A 4QDFA 2HMJA 3L71E 2QJPC 4QCKA 5BOKA 2GBWA 4QURA 4NBFD 2NVGA 2HMNA 2NUKA 3GZXA 1L0NE 4HKVA 4NBED 1BE3E 2ZT9D 2XSHA 1SQBE 1SQVE 1WQLA 4NBDD 2I7FA 1O7HA 4H0LD 2D2CD 3GB4A 2JO6A 2DE7D 1L0LE 2YFIA 3N0QA 1KYOE 3BCCE 4P1CH 4OGQD 3EQQA 3H1IE 3GZYA 4HM4A 3GCEA 5HL4A 4AAYB 4EMJB 1VCKA 4HM5A 4QUPA 5KLIC 3H1HE 1O7NA 2BMOA 2HMLA 2GBXA 3GL2A 3L74E 4HM6A 2E75D 2NWFA 3L75E 3H1JE 2JZAA 1NYKA 3GL0A 1SQQE 5AEUA 3VMID 3D89A 1EG9A 4HM1A 5KKZC 1G8KB 2NVEA 3C0DA 4HM0A 1SQXE 4HJLA 4U3FE 3VCAA 1ULIA 3H1KE 4AIVA 2XRXA 3GKEA 3VMHD 1P84E 2YVJB 2E74D 3CWBE 2XSOA 4H44D 1SJGA 1FQTA 1KB9E 4NBCD 2NUMA 1ULJA 4PV1D 1PP9E 2A06E 3L72E 4NB8D 2HMKA 2FYNC 1G8JB 1EZVE 2XR8A 3GOBA 4QDCA 1NDOA 1NTZE 1O7GA 1PPJE 1NTKE 4P1BH 2BMRA 3CX5E 2HMOA 4NBGD 5CXMA 1VF5D 2B24A 2B1XA 4HM3A 5AEWA 3GTSA 4NB9D 2QJKC 3TGUE 2E4QA 3CXHE 2E76D 1RIEA 4HM7A 4QDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7M A;  1O7W A;  2QJY C;  1BCC E;  1JM1 A;  1UUV A;  1Q90 C;  3GTE A;  4NBB D;  5KLV E;  3VMG D;  4NBH D;  4QUQ A;  4NBA D;  3AZC A;  2DE6 D;  2NVF A;  2YFJ A;  1O7P A;  1VM9 A;  4QDF B;  2Q3W A;  2FYU E;  2E4P A;  1SQP E;  1NU1 E;  1RFS A;  2YFL A;  3L70 E;  2IBZ E;  2YIU C;  3VCP A;  3DQY A;  1NTM E;  4HM2 A;  2CKF A;  3L73 E;  2HMM A;  2QPZ A;  3H1L E;  1ZRT E;  2BMQ A;  2ZYL A;  2BCC E;  3FOU A;  4H13 D;  4PD4 E;  1UUW A;  3EN1 A;  2DE5 D;  4HM8 A;  4QDF A;  2HMJ A;  3L71 E;  2QJP C;  4QCK A;  5BOK A;  2GBW A;  4QUR A;  4NBF D;  2NVG A;  2HMN A;  2NUK A;  3GZX A;  1L0N E;  4HKV A;  4NBE D;  1BE3 E;  2ZT9 D;  2XSH A;  1SQB E;  1SQV E;  1WQL A;  4NBD D;  2I7F A;  1O7H A;  4H0L D;  2D2C D;  3GB4 A;  2JO6 A;  2DE7 D;  1L0L E;  2YFI A;  3N0Q A;  1KYO E;  3BCC E;  4P1C H;  4OGQ D;  3EQQ A;  3H1I E;  3GZY A;  4HM4 A;  3GCE A;  5HL4 A;  4AAY B;  4EMJ B;  1VCK A;  4HM5 A;  4QUP A;  5KLI C;  3H1H E;  1O7N A;  2BMO A;  2HML A;  2GBX A;  3GL2 A;  3L74 E;  4HM6 A;  2E75 D;  2NWF A;  3L75 E;  3H1J E;  2JZA A;  1NYK A;  3GL0 A;  1SQQ E;  5AEU A;  3VMI D;  3D89 A;  1EG9 A;  4HM1 A;  5KKZ C;  1G8K B;  2NVE A;  3C0D A;  4HM0 A;  1SQX E;  4HJL A;  4U3F E;  3VCA A;  1ULI A;  3H1K E;  4AIV A;  2XRX A;  3GKE A;  3VMH D;  1P84 E;  2YVJ B;  2E74 D;  3CWB E;  2XSO A;  4H44 D;  1SJG A;  1FQT A;  1KB9 E;  4NBC D;  2NUM A;  1ULJ A;  4PV1 D;  1PP9 E;  2A06 E;  3L72 E;  4NB8 D;  2HMK A;  2FYN C;  1G8J B;  1EZV E;  2XR8 A;  3GOB A;  4QDC A;  1NDO A;  1NTZ E;  1O7G A;  1PPJ E;  1NTK E;  4P1B H;  2BMR A;  3CX5 E;  2HMO A;  4NBG D;  5CXM A;  1VF5 D;  2B24 A;  2B1X A;  4HM3 A;  5AEW A;  3GTS A;  4NB9 D;  2QJK C;  3TGU E;  2E4Q A;  3CXH E;  2E76 D;  1RIE A;  4HM7 A;  4QDD A; 
#chains in the Genus database with same CATH topology
 1O7M A;  1O7W A;  2QJY C;  1BCC E;  1JM1 A;  1UUV A;  1Q90 C;  3GTE A;  4NBB D;  5KLV E;  3VMG D;  4NBH D;  4QUQ A;  4NBA D;  3AZC A;  2DE6 D;  2NVF A;  2YFJ A;  1O7P A;  1VM9 A;  4QDF B;  2Q3W A;  2FYU E;  2E4P A;  1SQP E;  1NU1 E;  1RFS A;  2YFL A;  3L70 E;  2IBZ E;  2YIU C;  3VCP A;  3DQY A;  1NTM E;  4HM2 A;  2CKF A;  3L73 E;  2HMM A;  2QPZ A;  3H1L E;  1ZRT E;  2BMQ A;  2ZYL A;  2BCC E;  3FOU A;  4H13 D;  4PD4 E;  1UUW A;  3EN1 A;  2DE5 D;  4HM8 A;  4QDF A;  2HMJ A;  3L71 E;  2QJP C;  4QCK A;  5BOK A;  2GBW A;  4QUR A;  4NBF D;  2NVG A;  2HMN A;  2NUK A;  3GZX A;  1L0N E;  4HKV A;  4NBE D;  1BE3 E;  2ZT9 D;  2XSH A;  1SQB E;  1SQV E;  1WQL A;  4NBD D;  2I7F A;  1O7H A;  4H0L D;  2D2C D;  3GB4 A;  2JO6 A;  2DE7 D;  1L0L E;  2YFI A;  3N0Q A;  1KYO E;  3BCC E;  4P1C H;  4OGQ D;  3EQQ A;  3H1I E;  3GZY A;  4HM4 A;  3GCE A;  5HL4 A;  4AAY B;  4EMJ B;  1VCK A;  4HM5 A;  4QUP A;  5KLI C;  3H1H E;  1O7N A;  2BMO A;  2HML A;  2GBX A;  3GL2 A;  3L74 E;  4HM6 A;  2E75 D;  2NWF A;  3L75 E;  3H1J E;  2JZA A;  1NYK A;  3GL0 A;  1SQQ E;  5AEU A;  3VMI D;  3D89 A;  1EG9 A;  4HM1 A;  5KKZ C;  1G8K B;  2NVE A;  3C0D A;  4HM0 A;  1SQX E;  4HJL A;  4U3F E;  3VCA A;  1ULI A;  3H1K E;  4AIV A;  2XRX A;  3GKE A;  3VMH D;  1P84 E;  2YVJ B;  2E74 D;  3CWB E;  2XSO A;  4H44 D;  1SJG A;  1FQT A;  1KB9 E;  4NBC D;  2NUM A;  1ULJ A;  4PV1 D;  1PP9 E;  2A06 E;  3L72 E;  4NB8 D;  2HMK A;  2FYN C;  1G8J B;  1EZV E;  2XR8 A;  3GOB A;  4QDC A;  1NDO A;  1NTZ E;  1O7G A;  1PPJ E;  1NTK E;  4P1B H;  2BMR A;  3CX5 E;  2HMO A;  4NBG D;  5CXM A;  1VF5 D;  2B24 A;  2B1X A;  4HM3 A;  5AEW A;  3GTS A;  4NB9 D;  2QJK C;  3TGU E;  2E4Q A;  3CXH E;  2E76 D;  1RIE A;  4HM7 A;  4QDD A; 
#chains in the Genus database with same CATH homology
 1O7M A;  1O7W A;  2QJY C;  1BCC E;  1JM1 A;  1UUV A;  1Q90 C;  3GTE A;  4NBB D;  5KLV E;  3VMG D;  4NBH D;  4QUQ A;  4NBA D;  3AZC A;  2DE6 D;  2NVF A;  2YFJ A;  1O7P A;  1VM9 A;  4QDF B;  2Q3W A;  2FYU E;  2E4P A;  1SQP E;  1NU1 E;  1RFS A;  2YFL A;  3L70 E;  2IBZ E;  2YIU C;  3VCP A;  3DQY A;  1NTM E;  4HM2 A;  2CKF A;  3L73 E;  2HMM A;  2QPZ A;  3H1L E;  1ZRT E;  2BMQ A;  2ZYL A;  2BCC E;  3FOU A;  4H13 D;  4PD4 E;  1UUW A;  3EN1 A;  2DE5 D;  4HM8 A;  4QDF A;  2HMJ A;  3L71 E;  2QJP C;  4QCK A;  5BOK A;  2GBW A;  4QUR A;  4NBF D;  2NVG A;  2HMN A;  2NUK A;  3GZX A;  1L0N E;  4HKV A;  4NBE D;  1BE3 E;  2ZT9 D;  2XSH A;  1SQB E;  1SQV E;  1WQL A;  4NBD D;  2I7F A;  1O7H A;  4H0L D;  2D2C D;  3GB4 A;  2JO6 A;  2DE7 D;  1L0L E;  2YFI A;  3N0Q A;  1KYO E;  3BCC E;  4P1C H;  4OGQ D;  3EQQ A;  3H1I E;  3GZY A;  4HM4 A;  3GCE A;  5HL4 A;  4AAY B;  4EMJ B;  1VCK A;  4HM5 A;  4QUP A;  5KLI C;  3H1H E;  1O7N A;  2BMO A;  2HML A;  2GBX A;  3GL2 A;  3L74 E;  4HM6 A;  2E75 D;  2NWF A;  3L75 E;  3H1J E;  2JZA A;  1NYK A;  3GL0 A;  1SQQ E;  5AEU A;  3VMI D;  3D89 A;  1EG9 A;  4HM1 A;  5KKZ C;  1G8K B;  2NVE A;  3C0D A;  4HM0 A;  1SQX E;  4HJL A;  4U3F E;  3VCA A;  1ULI A;  3H1K E;  4AIV A;  2XRX A;  3GKE A;  3VMH D;  1P84 E;  2YVJ B;  2E74 D;  3CWB E;  2XSO A;  4H44 D;  1SJG A;  1FQT A;  1KB9 E;  4NBC D;  2NUM A;  1ULJ A;  4PV1 D;  1PP9 E;  2A06 E;  3L72 E;  4NB8 D;  2HMK A;  2FYN C;  1G8J B;  1EZV E;  2XR8 A;  3GOB A;  4QDC A;  1NDO A;  1NTZ E;  1O7G A;  1PPJ E;  1NTK E;  4P1B H;  2BMR A;  3CX5 E;  2HMO A;  4NBG D;  5CXM A;  1VF5 D;  2B24 A;  2B1X A;  4HM3 A;  5AEW A;  3GTS A;  4NB9 D;  2QJK C;  3TGU E;  2E4Q A;  3CXH E;  2E76 D;  1RIE A;  4HM7 A;  4QDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...