1KB9E

Yeast cytochrome bc1 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 47
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1kb9E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1kb9E02
1BE3E 3L73E 2NVGA 3FOUA 4QDFB 5AEUA 1VCKA 2BMRA 1JM1A 1SQXE 4HM1A 3H1LE 2E75D 3AZCA 4HM7A 3L72E 1BCCE 3H1KE 1ULJA 3GOBA 2BMQA 2E4QA 3CXHE 3D89A 4H13D 1O7PA 3VMID 4HM3A 2GBWA 4NBFD 2HMMA 2E74D 1O7NA 2BMOA 4HM4A 1ZRTE 1O7WA 2YVJB 2ZT9D 2FYUE 3GL0A 3VCAA 2QJKC 1L0NE 1UUVA 1RFSA 5KLVE 3L70E 1RIEA 4NBAD 2HMKA 5CXMA 2XRXA 4NBBD 1SQBE 2B24A 2DE7D 2QJPC 2Q3WA 1O7MA 4P1BH 4QCKA 4EMJB 1SQQE 5AEWA 2B1XA 2HMJA 2NUKA 3TGUE 2YFIA 2QPZA 2YFLA 2NVEA 3BCCE 2E4PA 4P1CH 1G8JB 1SQPE 1L0LE 2YIUC 4PV1D 3GTEA 4NBDD 3VCPA 2DE6D 3H1HE 2FYNC 3DQYA 3H1JE 1ULIA 1KB9E 1NTME 3GCEA 5HL4A 2JO6A 2I7FA 4HM5A 2QJYC 4QUPA 2HMOA 2YFJA 4QDCA 3GL2A 1SJGA 1BGYE 4QUQA 3L74E 2NUMA 3GTSA 1VF5D 1O7GA 2HMLA 4HM0A 4QDFA 2DE5D 1EG9A 1NTZE 2NVFA 2JZAA 1NU1E 4NB9D 1NYKA 3VMHD 4AIVA 4PD4E 3CWBE 4U3FE 3EN1A 3GZYA 2ZYLA 3L71E 3EQQA 4NBGD 4HKVA 3GB4A 3GKEA 2HMNA 1SQVE 1VM9A 1PP9E 4NBHD 2BCCE 4HM2A 2XSOA 5KLIC 1WQLA 4H44D 4OGQD 4D6TE 1NDOA 4HM6A 3VMGD 3GZXA 2XR8A 4AAYB 1PPJE 3L75E 3CX5E 1KYOE 1NTKE 2IBZE 1G8KB 2E76D 4H0LD 1O7HA 4NB8D 4NBED 1FQTA 4QDDA 4QURA 3N0QA 2GBXA 4HM8A 5BOKA 1P84E 1Q90C 1UUWA 2A06E 3C0DA 5KKZC 2XSHA 2NWFA 1EZVE 4NBCD 2D2CD 2CKFA 4HJLA 3H1IE
chains in the Genus database with same CATH superfamily
1FS0E 2G8YA 3AE2C 2J5UA 2BMRA 4BRYA 2C9LY 3VMZA 3L71J 1QVFO 1ZMEC 2IPPA 3H1IJ 1FE6A 4L75A 5AVZB 4BWNA 1OVVA 3WU2E 5CXMA 3A0HH 1X0TA 2DE7D 2XDJA 3G9RA 2JEEA 5KAFE 1A02J 1IFDA 1FAVA 2FYUJ 1T2KC 2KNCB 1GL2B 3IR9A 1NTZK 1SQBJ 4PJ0H 1IFJA 3W67A 1J1DB 3H32A 1SFCB 1BGYD 3RK3D 1J1DC 1MUUA 3CI9A 2XU6A 3AEDC 2POHA 1OMIA 3EN1A 3L71D 5GTHH 1YI2P 3VMAA 4A7PA 1ZR2A 3GKEA 3P32A 4K35A 4WY4B 4NBHD 2BCCE 4H0LC 5AVWB 1SQXG 3LIEA 3CX5I 4XA4A 3H1KG 1JB0J 3Q3DA 2QA4P 4H44B 4OGQB 2WSCJ 3M0DC 4BXLA 3TSIA 1AFOA 1EZVI 1EQ7A 2QEXP 4ZNCA 4D6TJ 3MUDA 3C0DA 3WMM0 3L70G 1Z56A 4HH2A 3TNUA 3L75J 1NTKJ 3L73D 3CXHI 1LP1B 1XTGB 3AEGC 4K3AA 2BMQA 1OWAA 5KTBA 1KILE 3D89A 4IFFA 4YPCA 1HF9A 1DEBA 1GK4A 1RF0C 3HUSA 2BMOA 1AQTA 1M1JB 1UUVA 4NPDA 5KLVE 1M90Q 1OW7A 1Q82Q 2DW3A 1Q2NA 3JCUE 1O7MA 1IO4A 5AEWA 1N73A 3A0BH 1IC2A 5KJ7D 3TGUD 3V2RA 1Q86Q 3T97A 1EXIA 1CSBA 4JYCA 1NU1G 3U1CA 1FZGA 4EYYQ 2K9JB 3M9BA 1FZAA 1SQPE 3PJSK 2QJYC 1NTMK 1BDCA 4DCKA 2HMLA 1KQFB 3TDKA 1PL5A 2OYHB 2C0WA 3L4FA 3B5NA 2OYIB 2K1AA 5AW1B 2IZ0A 2GA1A 4I1LA 1PP9E 1MFZA 1SQVD 2LKMA 2NPSA 4BRYB 1PGPA 1NWQA 2O1JA 1X9VA 1LTGC 1PPJE 4U7JA 1GDTA 3CX5E 1KYOD 4PV1B 1Q90C 1HVVA 1N7SA 1NJIQ 2FYUK 1EZVE 2WT7A 3E1IA 1SQBK 2GM4A 3CXHE 1LNQA 1DD3A 4HM3A 1URQB 1H89A 3IN6A 3VYIA 1ZRTE 4RJTA 3H32B 5CJ4A 1URQC 3IAOA 2XKMA 2AEJA 3P7KA 3R2PA 3S4RA 2YXQB 1NGMB 1S1CX 1L0NJ 3OAKA 3PLNA 1KB9I 2OYOA 2ITAA 3H1HE 2GUSA 1LWUA 1AV1A 4UB6H 1SJGA 1RQUA 3MTUE 2YIUB 2YXRB 4PD4I 5CBOA 1NTKK 1NYHA 2HYNA 3CWBE 4UB8E 2Y9ZA 3TNUB 1SQQJ 1SQPD 3TYYA 1JY2P 2KI7B 1BE3G 5CCHC 3L72G 1SP4A 4QURA 1S2EA 3L36A 5M1BA 1LTTC 3Q5RA 2ZVOB 2N1TD 2ZFCA 1DX7A 3D71A 1KILC 5KAIE 3FOUA 1N73B 2NVGA 4C46A 5AVUB 3T97B 4LC1A 2IFMA 3CX5D 3USSA 2KLUA 4H13B 2YVJB 2R3CA 2WWWA 1SQXJ 1Y47A 3A2AA 3H1KJ 1HGZA 1AVOA 1EZVD 2ZXXA 2B24A 2QJPC 2B1XA 2AXTE 1VQMP 5APUA 3NFQA 1USDA 3L70J 2AEFA 2V4HA 1VL2A 5AW7B 1LTSC 3RK2B 5E79E 2HLOA 1L0LD 1ZRTD 2NPSB 2LR2A 3H1JD 1KB9E 4L76A 4HM5A 2OTJP 4QUPA 4N3YB 2R3SA 1U7JA 1FDIA 1G1JA 4C7NA 3CMAP 2XNXA 1KQSO 1FBMA 1EG9A 1N7SB 1L2PA 2KLVA 1S9KD 4PD4E 5APTA 2WT7B 5TISE 2RN0A 1K04A 5AW9B 3FWLA 2A45I 3SFEC 3CPWO 2CK3H 1ZLLA 3CC2P 1LT9C 1WQLA 1NU1J 3BCCJ 5DJUB 2WSEH 2PP6A 4N78E 2JO1A 4NBED 1YQ3C 1O7HA 2IBZD 1D7MA 1Y9BA 2L5GB 5CCGA 4DOJA 1RE4A 2HR3A 2A06E 2ZVNB 1LGHB 3EFGA 3SFDC 1RE3C 3SSUA 1L4AC 1T6AA 2E75D 4O9BA 1ZR4A 2W83C 2ZXEB 1BCCD 5AVRB 4U3FJ 1PIXA 1GD2E 5KKZB 1LT1A 2QRXA 1FZBA 2KXPB 5BU8B 1FZCB 2M0BA 3AECC 1AVYA 2K3RA 4EMJB 2Z4EA 2H89C 1H0TB 2NUKA 1SQQK 2V7QJ 3MIWA 3CCVP 1NOHA 2JP3A 1JY3P 2PAJA 1YTZI 3RBZA 3LIDA 1JUNA 1NTME 1S5LE 3B8EB 2BCCG 3V4WA 2YMKA 3HD7B 1BGYE 2NUMA 2P67A 1VF5D 3RK3E 1RF0A 1FJPA 4I7ZC 1NTZD 3HD7C 3O6QB 4U3FD 3L71E 1K9MQ 2YKOA 2BEZF 4RKUJ 3CMEP 2Q6QA 5KAIH 2QSIA 3CCQP 1R8EA 2H88C 2Z5HA 3AE3C 1NDOA 1KYOI 1PV3A 1SQXK 2WMMA 1P84I 5CJ0A 2W90A 1FZEA 5BVZA 1YJNP 3S9OA 3AE1C 5GTIH 4PD4D 3G71P 5KLVG 3WUVA 3L73E 1HH0A 1NKZB 5B66E 2YO3A 3U59A 3CD6P 1FJKA 4YTPC 1R5SA 4N78D 4Z1MH 4YXWH 3PH0A 1IK9A 1T3UA 1NH4A 1SQPG 1AA0A 2W6JH 3L72J 1NAYA 1YBKA 1NHLA 4QCKA 2WSFH 1GL2D 3TGUE 2YFIA 1ZOYC 1JEKA 2MKVA 3BATA 2QPZA 3RL0D 3KZIE 3KXDA 1NU1K 2JWAA 5L8RJ 2DE6D 2FYNC 3CCLP 1SFCD 4IL6E 1PP9G 2I7FA 2Y0EA 5AW5B 2RMZA 1ZW0A 1PPJG 2QM7A 2Q1KA 2H7HA 1SLQA 3II6A 4WY4D 5AW6B 3FXDA 1URQA 1EZVG 3L74J 2HMNA 1SQVE 1JY2N 1YJ9P 2JJLA 2KYVA 1NTMD 4H44D 4OGQD 2QIWA 4OVNF 2Y0DA 2RKLA 2P7JA 1KYOE 1M56D 3OJAB 1P84E 2P58A 1KQGB 2CPSA 4H0LB 1T3JA 4KHXA 1TU3F 2M5AA 1HGVA 3H1ID 1VCKA 3PTZA 1BSNA 2BEQD 2B9BA 1O7PA 1JOCA 2HMMA 2HODA 3WUUA 3GW6A 2FYUD 2QJKC 3GL0A 1JM0A 3VCAA 3VP8A 3H1HG 1EDJA 5CCHA 1SQBD 3O8ZA 1G1IA 2JKVA 3VP9A 3L35A 1FU1A 2YKPA 2N9BA 3CWBG 3DQYA 3D6ZA 3H1LJ 1KILA 1JNMA 2FYZA 3CCRP 3RK3C 2YFJA 4EI2A 1W2EA 2H8PD 4CPGA 2W27A 4NB9D 2QJYB 3A5TA 3GB4A 1FC2C 2W6BA 1HTLC 3Q5PA 4D6TD 2FFDC 2IBZI 1QVGO 1EDLA 2KIKA 4PV1D 2E76D 3L75D 1NTKD 3N0QA 1RQVA 5AW0B 3AEBC 2BCCJ 2NRGA 3GHGB 5APWA 5AEUA 3M0AA 3GHGC 3H1LD 3HE5B 1PFIA 2VRSA 1EDIA 3KZIH 3D70A 3CCUP 3U1AA 1O7NA 2LXCB 1P84D 2KZIA 3WU2H 1BSHA 1LT9A 1JMBA 5KJ7C 1SQQE 2R5DA 5KAFH 3GF7A 1MV8A 2O3JA 2WPSA 5KLVJ 2YFLA 3N7NA 1L0LE 1JY2O 1JY3N 3H1JE 4RESB 1RE3A 1L4AA 1CZQA 2E76C 3V4QA 1VDFA 3B71A 3ABVC 5H2FE 1ZP0C 2WPRA 3TK1A 5AVXB 2AXCA 2M5AB 3ITKA 1S9KE 4AIVA 3LW5H 4HYTB 4NPFX 2Q5UA 2A06G 3VTPC 2OTLP 4GT1A 5KLIC 1H8AA 5APYA 1FZCA 3VMYA 2KSJA 3GZXA 2HODB 4AAYB 2IBZE 1JCCA 1H0TA 1S4XA 2GBXA 2B89A 2N9YB 3G4SP 1PP9J 2O01H 3HE4A 5CHXA 2CKFA 4HJLA 3AE6C 3IF4A 2IDBA 4ASWA 1JM1A 1BCCE 2XNDH 4C7RA 1OW6A 4GODA 4H13D 3RGUA 3HD7A 1VQ5P 4KT0J 1KILB 3GF3A 1RFSA 1L0ND 1VPCA 3O6QA 1NTMG 5AW4B 2WSEJ 1YHQP 3B5ND 2P1JA 3JCUH 3M06A 3MD0A 3CL3D 2PRRA 2E5TA 1BGYG 3I55P 1U7MA 1JTHB 3RK2D 2ZAEB 2WPVB 2NPSD 4EDFA 3BCCE 2IZ1A 3HUSC 3ZDMA 2QJPB 2E5YA 3L71G 1N86A 1UIXA 2G3AA 2A45G 2HMOA 5AVSB 1N7SD 1SQQD 1IJDB 4QUQA 3CCJP 3H1HJ 1NTZE 4R4LA 3RL0g 2KB7P 1K73Q 3CLQA 4U3FE 3EQQA 3M91A 2PFXA 1PZQA 4TT3H 1WMKA 3L73G 4Y28J 1VQNP 2H43A 3Q2YA 3VMGD 3CWBJ 3CX5H 2N1TC 1MFTA 5CMZA 1LT9B 4Y99C 2J58A 1N7LA 1UUWA 4I2LC 2XSHA 3NTNA 3AE8C 5KLVK 3AE7C 4YXDC 2OGUA 1VQ7P 4QDFB 1RF1C 1SQXD 1Q7YQ 1ULJA 3H1KD 1OW8A 1GW4A 3TGUG 3CXHH 4JQ0D 3C8VA 2GBWA 1JY3O 3H25A 2E43A 1LTJC 1DH3A 4JPZB 1J1EC 1VQ6P 1L4AB 3BVHA 2LXBA 3L70D 3A0HE 2W6AA 1L0NK 3SWKA 1LJ2A 2AEMA 1EC5A 1NTKG 2I8DA 3A7OA 2OQQA 4PJ0E 2O01N 2M3BA 1SQVG 1M7LA 2HPCA 3PP5A 1CW5A 1KTMA 2MJZA 3MGNA 3MP7B 3M0DA 1PGOA 3V5BA 1CI6B 3HE4B 1NU1D 3VMHD 3BCCD 4UB8H 1J2JB 4JYBA 5GTHE 4HKVA 2B87B 2FXPA 4NPEA 2WSFJ 3QWOC 2PGDA 2FBWC 1LWUC 4I7ZB 3N4XA 3JSVC 2KS1B 4MN4C 2YKQA 1RY3A 3CC7P 1E5WA 2E75C 1YQ4C 1IFPA 3AE5C 3AE9C 2D2CD 3JC22 3H1IE 5TJHA 4GKGA 1A02F 4HM7A 2E4QA 4WBAA 3VMID 2E74D 3EFFK 3KQGA 4HM4A 3KPEA 2ZT9D 2FYUE 2Q7CA 1W5CE 3F5HA 2XV5A 1R5LA 3GLMA 1SQBE 2FFDA 1VQ4P 2ZYDA 4N6JA 4P1BH 1E79H 2AXTH 1IK7A 5AVVB 2WZ7A 1OZHA 1AJYA 4M3LA 3SWFA 3B4SA 1FDOA 1BE3J 5E79H 1T2KD 1PGQA 1VF5C 1ULIA 1KB9H 3GHGA 2JR8A 4ASVA 3QH9A 3GL2A 5CCGD 5APXA 2GUVA 1IFNA 2WITA 2B88A 2Z5IA 2FYNB 3HE5A 2D2CC 3G3ZA 2KSEA 4PD4H 4ZKUA 4LGDE 5TISH 1OFCX 5KJ7A 1BGYJ 1HJBA 4D6TE 2E74C 1GTWA 2XR8A 2ZT9C 3GG2A 2Q3EA 2FY8A 3L75E 1NTKE 4QDDA 4H0LD 4NB8D 1USEA 3BRVB 1QL2A 3Q1MA 1X22A 3FGAD 2QG4A 1WRGA 2NWFA 4HB1A 1N2DC 5BU5A 1BE3D 1SQQG 3H1LE 2K9YA 3L72D 2Q3IA 1QEXA 4W7ZA 1EDKA 2IYPA 3BRTB 2ZYGA 1IZNB 3S1KA 3L73J 1SVFA 1L0LG 3RL0B 1NO4A 1KZUB 3MHVA 2HPCB 5CCGC 1RE4C 3H1JG 1GL2C 3L37A 5AW3B 1LTBC 1GZLA 2Q3WA 1K05A 1VQ8P 3RL0C 2HMJA 2QE7H 2C9NY 1OXZA 2QJKB 4HKZH 1EXJA 2JWDA 1NAFA 1SFCC 4P1CH 1GU5A 4IFDK 5B5EE 3TGUJ 2JO6A 4UB6E 1S5LH 4AYCA 3HRNA 5CBNA 3GTSA 3L74D 4WY4C 2IBZG 1KD1Q 3RK3B 2R44A 4H44C 4OGQC 1HBWA 2A45H 4XFJA 1BCCG 3UIAA 1FQTA 1IFMA 2KUBA 4HM8A 2Y0CA 1SQVJ 1JTHA 2FFDB 1DEEG 3AEEC 3AEAC 1Q90D 3PRJA 5B66H 1M1JC 3GOBA 3LW5J 2WVRA 1Y8AA 1GMJA 3PHLA 3BCCG 1O7WA 4I6MC 2WTYA 1L0NE 2KP8A 1RIEA 4WWIA 3D6YA 2XRXA 4NBBD 2M3EA 1ZV8A 1N8RQ 1WT6A 2FKWB 3VOPA 1URQD 3VN0A 2IX7C 2O01J 2N1TA 1NTZG 2WPQA 3H6PA 4B86A 4RO0A 4U3FG 2IFNA 3EQ2A 2WSCH 4W7YA 2OYHC 1MKMA 4IL6H 2OYIC 3GCEA 5HL4A 1GK6A 1RF1A 1T8ZA 5APVA 1XTCC 3I56P 2C0XA 3V6IA 3NMDA 5APSA 4QDFA 1UIIA 2DE5D 1LTJA 3NXSA 2E76B 4NBGD 4PV1C 4HM2A 1SS1A 2BCCD 2W8ZA 3TF5A 4L74A 2I1JA 4KJMA 2R5BA 1G2CA 3FWNA 1ZXGA 1KYOH 1SQPJ 1VQLP 5CCHD 3CCEP 2R32A 1P84H 1VQ9P 5KLIB 1GU4A 3G6EP 4NBCD 2NVEA 4AUWA 2RH0A 1H88A 4EOTA 1SQXE 3AZCA 3H1KE 1KV4A 1KILD 4OH8B 1KFMA 4NBFD 3Q5SA 3KDPB 1S72P 4JF7A 3KHUA 1MZ9A 1CI6A 5B5EH 3L70E 5KLVD 2L91A 2HMKA 4TLFA 2YMYA 2B87A 5APQA 3R4YA 1S5LX 1K8AQ 2BASA 2O1KA 2OARA 2E4PA 2KS1A 4AQRD 3W68A 2YIUC 3GTEA 3VCPA 2E42A 1M57D 3MUDC 2P10A 3A3YB 3F89A 3KYQA 1SQVK 1DD4A 4QDCA 3C1LA 3E7KA 2YNYA 3HUSB 5AVTB 4W80A 1L0LJ 1RH5B 2HFED 3H1JJ 2JZAA 1NU1E 1OIPA 2NVFA 2WQYC 1NYKA 3GZYA 2ZYLA 1VM9A 3H1IG 1PP9D 2CPBA 1GW3A 2IYOA 4DJGA 1PPJD 1LTAC 1N73C 1HJ0A 3FXEA 1JO5A 4LLHA 5GTIE 2FYUG 2YO2A 1YIJP 1FOSF 3FX0A 1VQKP 2I1KA 4H13C 1SQBG 3M9HA 2J59M 3P8MC 5AW2B 2KZJA 1OX3A 3V2QA 2N1TB 3L74G 3C9IA 3B5NB 1AQ5A 4Y99B 5AW8B 3CXHD 1FOSE 1X8YA 1RHZB 1L4AD 2FXOA 1BDDA 3B5NC 4EIJA 1M1KQ 1RF1B 1VQOP 1IFIA 1KN7A 1BCCJ 2XZRA 4NBAD 1KMIZ 3RK2C 1U57A 2KK7A 4IL6X 2NPSC 3HTKA 1NKNA 1LTJB 4WB4A 5EFWB 1J1EB 3CC4P 2WSSH 2FXMA 4NBDD 3CCSP 1N7SC 3H1HD 1SQPK 1G2CB 1LTIC 4D6TG 3I5CA 5H2FH 3L75G 1KQLA 3P8CE 1M8OB 4IFMA 1KFNA 1JCDA 1FZFA 3V2PA 3AE4C 2QM8A 2KNCA 3CWBD 1GL2A 3OW2O 2K88A 1X79B 3HD7D 3MZWB 1ZN5A 4DT0A 1NTZJ 1VQPP 3H1LG 1FDMA 5C39A 2QVAA 1QL1A 1SFCA 3M9QA 3RBXA 1LWUB 3V2NA 5KKZC 4XE5B 1BE3E 2P2UA 3SWYA 4HM1A 3L72E 4WY4A 1FZCC 3IFMA 4OWFA 5AVQB 2UWJE 2E75B 4QMAA 4R4MA 4WVZA 4GDOA 2KOGA 4JBZA 1HWTC 4GIFA 1KC8Q 1QGKB 1L0LK 2JDIH 1HUCA 2OTKE 3BASA 1LP1A 5DJTB 4L73A 1DIPA 1G8JB 4GOEA 4DZOA 1OVUA 4GOFA 4HJGH 2SPZA 1KORA 3K5BA 3VMXA 1PGJA 1QX8A 1KB9D 1M1JA 2M8RA 3CCMP 3WUTA 3EWKA 3L74E 1O7GA 4HM0A 3A0BE 1YITP 1W2BO 1JMMA 3GMAA 4IOIH 1QLED 1VF5B 3OA7A 1YTZT 2NZ2A 4ZKPA 2K9JA 2Q9IA 2K37A 2XSOA 1Q81Q 5AVYB 1YYCA 2D2CB 4HM6A 3E1RA 3AEFC 1G8KB 2Y9YA 3P8CD 5BOKA 5K5GB 1NTMJ 1S3JA 2V7QH 2OYHA 1OVRA 2E74B 2ZJSE 1L0NG 1YJWP 2OYIA 2A06D 4ZMDA 1NVOA 4C7NB 3HTKB 2ZT9B 2HG5D 2ZYAA
chains in the Genus database with same CATH topology
1BE3E 3L73E 2NVGA 3FOUA 4QDFB 5AEUA 1VCKA 2BMRA 1JM1A 1SQXE 4HM1A 3H1LE 2E75D 3AZCA 4HM7A 3L72E 1BCCE 3H1KE 1ULJA 3GOBA 2BMQA 2E4QA 3CXHE 3D89A 4H13D 1O7PA 3VMID 4HM3A 2GBWA 4NBFD 2HMMA 2E74D 1O7NA 2BMOA 4HM4A 1ZRTE 1O7WA 2YVJB 2ZT9D 2FYUE 3GL0A 3VCAA 2QJKC 1L0NE 1UUVA 1RFSA 5KLVE 3L70E 1RIEA 4NBAD 2HMKA 5CXMA 2XRXA 4NBBD 1SQBE 2B24A 2DE7D 2QJPC 2Q3WA 1O7MA 4P1BH 4QCKA 4EMJB 1SQQE 5AEWA 2B1XA 2HMJA 2NUKA 3TGUE 2YFIA 2QPZA 2YFLA 2NVEA 3BCCE 2E4PA 4P1CH 1G8JB 1SQPE 1L0LE 2YIUC 4PV1D 3GTEA 4NBDD 3VCPA 2DE6D 3H1HE 2FYNC 3DQYA 3H1JE 1ULIA 1KB9E 1NTME 3GCEA 5HL4A 2JO6A 2I7FA 4HM5A 2QJYC 4QUPA 2HMOA 2YFJA 4QDCA 3GL2A 1SJGA 1BGYE 4QUQA 3L74E 2NUMA 3GTSA 1VF5D 1O7GA 2HMLA 4HM0A 4QDFA 2DE5D 1EG9A 1NTZE 2NVFA 2JZAA 1NU1E 4NB9D 1NYKA 3VMHD 4AIVA 4PD4E 3CWBE 4U3FE 3EN1A 3GZYA 2ZYLA 3L71E 3EQQA 4NBGD 4HKVA 3GB4A 3GKEA 2HMNA 1SQVE 1VM9A 1PP9E 4NBHD 2BCCE 4HM2A 2XSOA 5KLIC 1WQLA 4H44D 4OGQD 4D6TE 1NDOA 4HM6A 3VMGD 3GZXA 2XR8A 4AAYB 1PPJE 3L75E 3CX5E 1KYOE 1NTKE 2IBZE 1G8KB 2E76D 4H0LD 1O7HA 4NB8D 4NBED 1FQTA 4QDDA 4QURA 3N0QA 2GBXA 4HM8A 5BOKA 1P84E 1Q90C 1UUWA 2A06E 3C0DA 5KKZC 2XSHA 2NWFA 1EZVE 4NBCD 2D2CD 2CKFA 4HJLA 3H1IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 E;  3L73 E;  2NVG A;  3FOU A;  4QDF B;  5AEU A;  1VCK A;  2BMR A;  1JM1 A;  1SQX E;  4HM1 A;  3H1L E;  2E75 D;  3AZC A;  4HM7 A;  3L72 E;  1BCC E;  3H1K E;  1ULJ A;  3GOB A;  2BMQ A;  2E4Q A;  3CXH E;  3D89 A;  4H13 D;  1O7P A;  3VMI D;  4HM3 A;  2GBW A;  4NBF D;  2HMM A;  2E74 D;  1O7N A;  2BMO A;  4HM4 A;  1ZRT E;  1O7W A;  2YVJ B;  2ZT9 D;  2FYU E;  3GL0 A;  3VCA A;  2QJK C;  1L0N E;  1UUV A;  1RFS A;  5KLV E;  3L70 E;  1RIE A;  4NBA D;  2HMK A;  5CXM A;  2XRX A;  4NBB D;  1SQB E;  2B24 A;  2DE7 D;  2QJP C;  2Q3W A;  1O7M A;  4P1B H;  4QCK A;  4EMJ B;  1SQQ E;  5AEW A;  2B1X A;  2HMJ A;  2NUK A;  3TGU E;  2YFI A;  2QPZ A;  2YFL A;  2NVE A;  3BCC E;  2E4P A;  4P1C H;  1G8J B;  1SQP E;  1L0L E;  2YIU C;  4PV1 D;  3GTE A;  4NBD D;  3VCP A;  2DE6 D;  3H1H E;  2FYN C;  3DQY A;  3H1J E;  1ULI A;  1KB9 E;  1NTM E;  3GCE A;  5HL4 A;  2JO6 A;  2I7F A;  4HM5 A;  2QJY C;  4QUP A;  2HMO A;  2YFJ A;  4QDC A;  3GL2 A;  1SJG A;  1BGY E;  4QUQ A;  3L74 E;  2NUM A;  3GTS A;  1VF5 D;  1O7G A;  2HML A;  4HM0 A;  4QDF A;  2DE5 D;  1EG9 A;  1NTZ E;  2NVF A;  2JZA A;  1NU1 E;  4NB9 D;  1NYK A;  3VMH D;  4AIV A;  4PD4 E;  3CWB E;  4U3F E;  3EN1 A;  3GZY A;  2ZYL A;  3L71 E;  3EQQ A;  4NBG D;  4HKV A;  3GB4 A;  3GKE A;  2HMN A;  1SQV E;  1VM9 A;  1PP9 E;  4NBH D;  2BCC E;  4HM2 A;  2XSO A;  5KLI C;  1WQL A;  4H44 D;  4OGQ D;  4D6T E;  1NDO A;  4HM6 A;  3VMG D;  3GZX A;  2XR8 A;  4AAY B;  1PPJ E;  3L75 E;  3CX5 E;  1KYO E;  1NTK E;  2IBZ E;  1G8K B;  2E76 D;  4H0L D;  1O7H A;  4NB8 D;  4NBE D;  1FQT A;  4QDD A;  4QUR A;  3N0Q A;  2GBX A;  4HM8 A;  5BOK A;  1P84 E;  1Q90 C;  1UUW A;  2A06 E;  3C0D A;  5KKZ C;  2XSH A;  2NWF A;  1EZV E;  4NBC D;  2D2C D;  2CKF A;  4HJL A;  3H1I E; 
#chains in the Genus database with same CATH topology
 1FS0 E;  2G8Y A;  3AE2 C;  2J5U A;  2BMR A;  4BRY A;  2C9L Y;  3VMZ A;  3L71 J;  1QVF O;  1ZME C;  2IPP A;  3H1I J;  1FE6 A;  4L75 A;  5AVZ B;  4BWN A;  1OVV A;  3WU2 E;  5CXM A;  3A0H H;  1X0T A;  2DE7 D;  2XDJ A;  3G9R A;  2JEE A;  5KAF E;  1A02 J;  1IFD A;  1FAV A;  2FYU J;  1T2K C;  2KNC B;  1GL2 B;  3IR9 A;  1NTZ K;  1SQB J;  4PJ0 H;  1IFJ A;  3W67 A;  1J1D B;  3H32 A;  1SFC B;  1BGY D;  3RK3 D;  1J1D C;  1MUU A;  3CI9 A;  2XU6 A;  3AED C;  2POH A;  1OMI A;  3EN1 A;  3L71 D;  5GTH H;  1YI2 P;  3VMA A;  4A7P A;  1ZR2 A;  3GKE A;  3P32 A;  4K35 A;  4WY4 B;  4NBH D;  2BCC E;  4H0L C;  5AVW B;  1SQX G;  3LIE A;  3CX5 I;  4XA4 A;  3H1K G;  1JB0 J;  3Q3D A;  2QA4 P;  4H44 B;  4OGQ B;  2WSC J;  3M0D C;  4BXL A;  3TSI A;  1AFO A;  1EZV I;  1EQ7 A;  2QEX P;  4ZNC A;  4D6T J;  3MUD A;  3C0D A;  3WMM 0;  3L70 G;  1Z56 A;  4HH2 A;  3TNU A;  3L75 J;  1NTK J;  3L73 D;  3CXH I;  1LP1 B;  1XTG B;  3AEG C;  4K3A A;  2BMQ A;  1OWA A;  5KTB A;  1KIL E;  3D89 A;  4IFF A;  4YPC A;  1HF9 A;  1DEB A;  1GK4 A;  1RF0 C;  3HUS A;  2BMO A;  1AQT A;  1M1J B;  1UUV A;  4NPD A;  5KLV E;  1M90 Q;  1OW7 A;  1Q82 Q;  2DW3 A;  1Q2N A;  3JCU E;  1O7M A;  1IO4 A;  5AEW A;  1N73 A;  3A0B H;  1IC2 A;  5KJ7 D;  3TGU D;  3V2R A;  1Q86 Q;  3T97 A;  1EXI A;  1CSB A;  4JYC A;  1NU1 G;  3U1C A;  1FZG A;  4EYY Q;  2K9J B;  3M9B A;  1FZA A;  1SQP E;  3PJS K;  2QJY C;  1NTM K;  1BDC A;  4DCK A;  2HML A;  1KQF B;  3TDK A;  1PL5 A;  2OYH B;  2C0W A;  3L4F A;  3B5N A;  2OYI B;  2K1A A;  5AW1 B;  2IZ0 A;  2GA1 A;  4I1L A;  1PP9 E;  1MFZ A;  1SQV D;  2LKM A;  2NPS A;  4BRY B;  1PGP A;  1NWQ A;  2O1J A;  1X9V A;  1LTG C;  1PPJ E;  4U7J A;  1GDT A;  3CX5 E;  1KYO D;  4PV1 B;  1Q90 C;  1HVV A;  1N7S A;  1NJI Q;  2FYU K;  1EZV E;  2WT7 A;  3E1I A;  1SQB K;  2GM4 A;  3CXH E;  1LNQ A;  1DD3 A;  4HM3 A;  1URQ B;  1H89 A;  3IN6 A;  3VYI A;  1ZRT E;  4RJT A;  3H32 B;  5CJ4 A;  1URQ C;  3IAO A;  2XKM A;  2AEJ A;  3P7K A;  3R2P A;  3S4R A;  2YXQ B;  1NGM B;  1S1C X;  1L0N J;  3OAK A;  3PLN A;  1KB9 I;  2OYO A;  2ITA A;  3H1H E;  2GUS A;  1LWU A;  1AV1 A;  4UB6 H;  1SJG A;  1RQU A;  3MTU E;  2YIU B;  2YXR B;  4PD4 I;  5CBO A;  1NTK K;  1NYH A;  2HYN A;  3CWB E;  4UB8 E;  2Y9Z A;  3TNU B;  1SQQ J;  1SQP D;  3TYY A;  1JY2 P;  2KI7 B;  1BE3 G;  5CCH C;  3L72 G;  1SP4 A;  4QUR A;  1S2E A;  3L36 A;  5M1B A;  1LTT C;  3Q5R A;  2ZVO B;  2N1T D;  2ZFC A;  1DX7 A;  3D71 A;  1KIL C;  5KAI E;  3FOU A;  1N73 B;  2NVG A;  4C46 A;  5AVU B;  3T97 B;  4LC1 A;  2IFM A;  3CX5 D;  3USS A;  2KLU A;  4H13 B;  2YVJ B;  2R3C A;  2WWW A;  1SQX J;  1Y47 A;  3A2A A;  3H1K J;  1HGZ A;  1AVO A;  1EZV D;  2ZXX A;  2B24 A;  2QJP C;  2B1X A;  2AXT E;  1VQM P;  5APU A;  3NFQ A;  1USD A;  3L70 J;  2AEF A;  2V4H A;  1VL2 A;  5AW7 B;  1LTS C;  3RK2 B;  5E79 E;  2HLO A;  1L0L D;  1ZRT D;  2NPS B;  2LR2 A;  3H1J D;  1KB9 E;  4L76 A;  4HM5 A;  2OTJ P;  4QUP A;  4N3Y B;  2R3S A;  1U7J A;  1FDI A;  1G1J A;  4C7N A;  3CMA P;  2XNX A;  1KQS O;  1FBM A;  1EG9 A;  1N7S B;  1L2P A;  2KLV A;  1S9K D;  4PD4 E;  5APT A;  2WT7 B;  5TIS E;  2RN0 A;  1K04 A;  5AW9 B;  3FWL A;  2A45 I;  3SFE C;  3CPW O;  2CK3 H;  1ZLL A;  3CC2 P;  1LT9 C;  1WQL A;  1NU1 J;  3BCC J;  5DJU B;  2WSE H;  2PP6 A;  4N78 E;  2JO1 A;  4NBE D;  1YQ3 C;  1O7H A;  2IBZ D;  1D7M A;  1Y9B A;  2L5G B;  5CCG A;  4DOJ A;  1RE4 A;  2HR3 A;  2A06 E;  2ZVN B;  1LGH B;  3EFG A;  3SFD C;  1RE3 C;  3SSU A;  1L4A C;  1T6A A;  2E75 D;  4O9B A;  1ZR4 A;  2W83 C;  2ZXE B;  1BCC D;  5AVR B;  4U3F J;  1PIX A;  1GD2 E;  5KKZ B;  1LT1 A;  2QRX A;  1FZB A;  2KXP B;  5BU8 B;  1FZC B;  2M0B A;  3AEC C;  1AVY A;  2K3R A;  4EMJ B;  2Z4E A;  2H89 C;  1H0T B;  2NUK A;  1SQQ K;  2V7Q J;  3MIW A;  3CCV P;  1NOH A;  2JP3 A;  1JY3 P;  2PAJ A;  1YTZ I;  3RBZ A;  3LID A;  1JUN A;  1NTM E;  1S5L E;  3B8E B;  2BCC G;  3V4W A;  2YMK A;  3HD7 B;  1BGY E;  2NUM A;  2P67 A;  1VF5 D;  3RK3 E;  1RF0 A;  1FJP A;  4I7Z C;  1NTZ D;  3HD7 C;  3O6Q B;  4U3F D;  3L71 E;  1K9M Q;  2YKO A;  2BEZ F;  4RKU J;  3CME P;  2Q6Q A;  5KAI H;  2QSI A;  3CCQ P;  1R8E A;  2H88 C;  2Z5H A;  3AE3 C;  1NDO A;  1KYO I;  1PV3 A;  1SQX K;  2WMM A;  1P84 I;  5CJ0 A;  2W90 A;  1FZE A;  5BVZ A;  1YJN P;  3S9O A;  3AE1 C;  5GTI H;  4PD4 D;  3G71 P;  5KLV G;  3WUV A;  3L73 E;  1HH0 A;  1NKZ B;  5B66 E;  2YO3 A;  3U59 A;  3CD6 P;  1FJK A;  4YTP C;  1R5S A;  4N78 D;  4Z1M H;  4YXW H;  3PH0 A;  1IK9 A;  1T3U A;  1NH4 A;  1SQP G;  1AA0 A;  2W6J H;  3L72 J;  1NAY A;  1YBK A;  1NHL A;  4QCK A;  2WSF H;  1GL2 D;  3TGU E;  2YFI A;  1ZOY C;  1JEK A;  2MKV A;  3BAT A;  2QPZ A;  3RL0 D;  3KZI E;  3KXD A;  1NU1 K;  2JWA A;  5L8R J;  2DE6 D;  2FYN C;  3CCL P;  1SFC D;  4IL6 E;  1PP9 G;  2I7F A;  2Y0E A;  5AW5 B;  2RMZ A;  1ZW0 A;  1PPJ G;  2QM7 A;  2Q1K A;  2H7H A;  1SLQ A;  3II6 A;  4WY4 D;  5AW6 B;  3FXD A;  1URQ A;  1EZV G;  3L74 J;  2HMN A;  1SQV E;  1JY2 N;  1YJ9 P;  2JJL A;  2KYV A;  1NTM D;  4H44 D;  4OGQ D;  2QIW A;  4OVN F;  2Y0D A;  2RKL A;  2P7J A;  1KYO E;  1M56 D;  3OJA B;  1P84 E;  2P58 A;  1KQG B;  2CPS A;  4H0L B;  1T3J A;  4KHX A;  1TU3 F;  2M5A A;  1HGV A;  3H1I D;  1VCK A;  3PTZ A;  1BSN A;  2BEQ D;  2B9B A;  1O7P A;  1JOC A;  2HMM A;  2HOD A;  3WUU A;  3GW6 A;  2FYU D;  2QJK C;  3GL0 A;  1JM0 A;  3VCA A;  3VP8 A;  3H1H G;  1EDJ A;  5CCH A;  1SQB D;  3O8Z A;  1G1I A;  2JKV A;  3VP9 A;  3L35 A;  1FU1 A;  2YKP A;  2N9B A;  3CWB G;  3DQY A;  3D6Z A;  3H1L J;  1KIL A;  1JNM A;  2FYZ A;  3CCR P;  3RK3 C;  2YFJ A;  4EI2 A;  1W2E A;  2H8P D;  4CPG A;  2W27 A;  4NB9 D;  2QJY B;  3A5T A;  3GB4 A;  1FC2 C;  2W6B A;  1HTL C;  3Q5P A;  4D6T D;  2FFD C;  2IBZ I;  1QVG O;  1EDL A;  2KIK A;  4PV1 D;  2E76 D;  3L75 D;  1NTK D;  3N0Q A;  1RQV A;  5AW0 B;  3AEB C;  2BCC J;  2NRG A;  3GHG B;  5APW A;  5AEU A;  3M0A A;  3GHG C;  3H1L D;  3HE5 B;  1PFI A;  2VRS A;  1EDI A;  3KZI H;  3D70 A;  3CCU P;  3U1A A;  1O7N A;  2LXC B;  1P84 D;  2KZI A;  3WU2 H;  1BSH A;  1LT9 A;  1JMB A;  5KJ7 C;  1SQQ E;  2R5D A;  5KAF H;  3GF7 A;  1MV8 A;  2O3J A;  2WPS A;  5KLV J;  2YFL A;  3N7N A;  1L0L E;  1JY2 O;  1JY3 N;  3H1J E;  4RES B;  1RE3 A;  1L4A A;  1CZQ A;  2E76 C;  3V4Q A;  1VDF A;  3B71 A;  3ABV C;  5H2F E;  1ZP0 C;  2WPR A;  3TK1 A;  5AVX B;  2AXC A;  2M5A B;  3ITK A;  1S9K E;  4AIV A;  3LW5 H;  4HYT B;  4NPF X;  2Q5U A;  2A06 G;  3VTP C;  2OTL P;  4GT1 A;  5KLI C;  1H8A A;  5APY A;  1FZC A;  3VMY A;  2KSJ A;  3GZX A;  2HOD B;  4AAY B;  2IBZ E;  1JCC A;  1H0T A;  1S4X A;  2GBX A;  2B89 A;  2N9Y B;  3G4S P;  1PP9 J;  2O01 H;  3HE4 A;  5CHX A;  2CKF A;  4HJL A;  3AE6 C;  3IF4 A;  2IDB A;  4ASW A;  1JM1 A;  1BCC E;  2XND H;  4C7R A;  1OW6 A;  4GOD A;  4H13 D;  3RGU A;  3HD7 A;  1VQ5 P;  4KT0 J;  1KIL B;  3GF3 A;  1RFS A;  1L0N D;  1VPC A;  3O6Q A;  1NTM G;  5AW4 B;  2WSE J;  1YHQ P;  3B5N D;  2P1J A;  3JCU H;  3M06 A;  3MD0 A;  3CL3 D;  2PRR A;  2E5T A;  1BGY G;  3I55 P;  1U7M A;  1JTH B;  3RK2 D;  2ZAE B;  2WPV B;  2NPS D;  4EDF A;  3BCC E;  2IZ1 A;  3HUS C;  3ZDM A;  2QJP B;  2E5Y A;  3L71 G;  1N86 A;  1UIX A;  2G3A A;  2A45 G;  2HMO A;  5AVS B;  1N7S D;  1SQQ D;  1IJD B;  4QUQ A;  3CCJ P;  3H1H J;  1NTZ E;  4R4L A;  3RL0 g;  2KB7 P;  1K73 Q;  3CLQ A;  4U3F E;  3EQQ A;  3M91 A;  2PFX A;  1PZQ A;  4TT3 H;  1WMK A;  3L73 G;  4Y28 J;  1VQN P;  2H43 A;  3Q2Y A;  3VMG D;  3CWB J;  3CX5 H;  2N1T C;  1MFT A;  5CMZ A;  1LT9 B;  4Y99 C;  2J58 A;  1N7L A;  1UUW A;  4I2L C;  2XSH A;  3NTN A;  3AE8 C;  5KLV K;  3AE7 C;  4YXD C;  2OGU A;  1VQ7 P;  4QDF B;  1RF1 C;  1SQX D;  1Q7Y Q;  1ULJ A;  3H1K D;  1OW8 A;  1GW4 A;  3TGU G;  3CXH H;  4JQ0 D;  3C8V A;  2GBW A;  1JY3 O;  3H25 A;  2E43 A;  1LTJ C;  1DH3 A;  4JPZ B;  1J1E C;  1VQ6 P;  1L4A B;  3BVH A;  2LXB A;  3L70 D;  3A0H E;  2W6A A;  1L0N K;  3SWK A;  1LJ2 A;  2AEM A;  1EC5 A;  1NTK G;  2I8D A;  3A7O A;  2OQQ A;  4PJ0 E;  2O01 N;  2M3B A;  1SQV G;  1M7L A;  2HPC A;  3PP5 A;  1CW5 A;  1KTM A;  2MJZ A;  3MGN A;  3MP7 B;  3M0D A;  1PGO A;  3V5B A;  1CI6 B;  3HE4 B;  1NU1 D;  3VMH D;  3BCC D;  4UB8 H;  1J2J B;  4JYB A;  5GTH E;  4HKV A;  2B87 B;  2FXP A;  4NPE A;  2WSF J;  3QWO C;  2PGD A;  2FBW C;  1LWU C;  4I7Z B;  3N4X A;  3JSV C;  2KS1 B;  4MN4 C;  2YKQ A;  1RY3 A;  3CC7 P;  1E5W A;  2E75 C;  1YQ4 C;  1IFP A;  3AE5 C;  3AE9 C;  2D2C D;  3JC2 2;  3H1I E;  5TJH A;  4GKG A;  1A02 F;  4HM7 A;  2E4Q A;  4WBA A;  3VMI D;  2E74 D;  3EFF K;  3KQG A;  4HM4 A;  3KPE A;  2ZT9 D;  2FYU E;  2Q7C A;  1W5C E;  3F5H A;  2XV5 A;  1R5L A;  3GLM A;  1SQB E;  2FFD A;  1VQ4 P;  2ZYD A;  4N6J A;  4P1B H;  1E79 H;  2AXT H;  1IK7 A;  5AVV B;  2WZ7 A;  1OZH A;  1AJY A;  4M3L A;  3SWF A;  3B4S A;  1FDO A;  1BE3 J;  5E79 H;  1T2K D;  1PGQ A;  1VF5 C;  1ULI A;  1KB9 H;  3GHG A;  2JR8 A;  4ASV A;  3QH9 A;  3GL2 A;  5CCG D;  5APX A;  2GUV A;  1IFN A;  2WIT A;  2B88 A;  2Z5I A;  2FYN B;  3HE5 A;  2D2C C;  3G3Z A;  2KSE A;  4PD4 H;  4ZKU A;  4LGD E;  5TIS H;  1OFC X;  5KJ7 A;  1BGY J;  1HJB A;  4D6T E;  2E74 C;  1GTW A;  2XR8 A;  2ZT9 C;  3GG2 A;  2Q3E A;  2FY8 A;  3L75 E;  1NTK E;  4QDD A;  4H0L D;  4NB8 D;  1USE A;  3BRV B;  1QL2 A;  3Q1M A;  1X22 A;  3FGA D;  2QG4 A;  1WRG A;  2NWF A;  4HB1 A;  1N2D C;  5BU5 A;  1BE3 D;  1SQQ G;  3H1L E;  2K9Y A;  3L72 D;  2Q3I A;  1QEX A;  4W7Z A;  1EDK A;  2IYP A;  3BRT B;  2ZYG A;  1IZN B;  3S1K A;  3L73 J;  1SVF A;  1L0L G;  3RL0 B;  1NO4 A;  1KZU B;  3MHV A;  2HPC B;  5CCG C;  1RE4 C;  3H1J G;  1GL2 C;  3L37 A;  5AW3 B;  1LTB C;  1GZL A;  2Q3W A;  1K05 A;  1VQ8 P;  3RL0 C;  2HMJ A;  2QE7 H;  2C9N Y;  1OXZ A;  2QJK B;  4HKZ H;  1EXJ A;  2JWD A;  1NAF A;  1SFC C;  4P1C H;  1GU5 A;  4IFD K;  5B5E E;  3TGU J;  2JO6 A;  4UB6 E;  1S5L H;  4AYC A;  3HRN A;  5CBN A;  3GTS A;  3L74 D;  4WY4 C;  2IBZ G;  1KD1 Q;  3RK3 B;  2R44 A;  4H44 C;  4OGQ C;  1HBW A;  2A45 H;  4XFJ A;  1BCC G;  3UIA A;  1FQT A;  1IFM A;  2KUB A;  4HM8 A;  2Y0C A;  1SQV J;  1JTH A;  2FFD B;  1DEE G;  3AEE C;  3AEA C;  1Q90 D;  3PRJ A;  5B66 H;  1M1J C;  3GOB A;  3LW5 J;  2WVR A;  1Y8A A;  1GMJ A;  3PHL A;  3BCC G;  1O7W A;  4I6M C;  2WTY A;  1L0N E;  2KP8 A;  1RIE A;  4WWI A;  3D6Y A;  2XRX A;  4NBB D;  2M3E A;  1ZV8 A;  1N8R Q;  1WT6 A;  2FKW B;  3VOP A;  1URQ D;  3VN0 A;  2IX7 C;  2O01 J;  2N1T A;  1NTZ G;  2WPQ A;  3H6P A;  4B86 A;  4RO0 A;  4U3F G;  2IFN A;  3EQ2 A;  2WSC H;  4W7Y A;  2OYH C;  1MKM A;  4IL6 H;  2OYI C;  3GCE A;  5HL4 A;  1GK6 A;  1RF1 A;  1T8Z A;  5APV A;  1XTC C;  3I56 P;  2C0X A;  3V6I A;  3NMD A;  5APS A;  4QDF A;  1UII A;  2DE5 D;  1LTJ A;  3NXS A;  2E76 B;  4NBG D;  4PV1 C;  4HM2 A;  1SS1 A;  2BCC D;  2W8Z A;  3TF5 A;  4L74 A;  2I1J A;  4KJM A;  2R5B A;  1G2C A;  3FWN A;  1ZXG A;  1KYO H;  1SQP J;  1VQL P;  5CCH D;  3CCE P;  2R32 A;  1P84 H;  1VQ9 P;  5KLI B;  1GU4 A;  3G6E P;  4NBC D;  2NVE A;  4AUW A;  2RH0 A;  1H88 A;  4EOT A;  1SQX E;  3AZC A;  3H1K E;  1KV4 A;  1KIL D;  4OH8 B;  1KFM A;  4NBF D;  3Q5S A;  3KDP B;  1S72 P;  4JF7 A;  3KHU A;  1MZ9 A;  1CI6 A;  5B5E H;  3L70 E;  5KLV D;  2L91 A;  2HMK A;  4TLF A;  2YMY A;  2B87 A;  5APQ A;  3R4Y A;  1S5L X;  1K8A Q;  2BAS A;  2O1K A;  2OAR A;  2E4P A;  2KS1 A;  4AQR D;  3W68 A;  2YIU C;  3GTE A;  3VCP A;  2E42 A;  1M57 D;  3MUD C;  2P10 A;  3A3Y B;  3F89 A;  3KYQ A;  1SQV K;  1DD4 A;  4QDC A;  3C1L A;  3E7K A;  2YNY A;  3HUS B;  5AVT B;  4W80 A;  1L0L J;  1RH5 B;  2HFE D;  3H1J J;  2JZA A;  1NU1 E;  1OIP A;  2NVF A;  2WQY C;  1NYK A;  3GZY A;  2ZYL A;  1VM9 A;  3H1I G;  1PP9 D;  2CPB A;  1GW3 A;  2IYO A;  4DJG A;  1PPJ D;  1LTA C;  1N73 C;  1HJ0 A;  3FXE A;  1JO5 A;  4LLH A;  5GTI E;  2FYU G;  2YO2 A;  1YIJ P;  1FOS F;  3FX0 A;  1VQK P;  2I1K A;  4H13 C;  1SQB G;  3M9H A;  2J59 M;  3P8M C;  5AW2 B;  2KZJ A;  1OX3 A;  3V2Q A;  2N1T B;  3L74 G;  3C9I A;  3B5N B;  1AQ5 A;  4Y99 B;  5AW8 B;  3CXH D;  1FOS E;  1X8Y A;  1RHZ B;  1L4A D;  2FXO A;  1BDD A;  3B5N C;  4EIJ A;  1M1K Q;  1RF1 B;  1VQO P;  1IFI A;  1KN7 A;  1BCC J;  2XZR A;  4NBA D;  1KMI Z;  3RK2 C;  1U57 A;  2KK7 A;  4IL6 X;  2NPS C;  3HTK A;  1NKN A;  1LTJ B;  4WB4 A;  5EFW B;  1J1E B;  3CC4 P;  2WSS H;  2FXM A;  4NBD D;  3CCS P;  1N7S C;  3H1H D;  1SQP K;  1G2C B;  1LTI C;  4D6T G;  3I5C A;  5H2F H;  3L75 G;  1KQL A;  3P8C E;  1M8O B;  4IFM A;  1KFN A;  1JCD A;  1FZF A;  3V2P A;  3AE4 C;  2QM8 A;  2KNC A;  3CWB D;  1GL2 A;  3OW2 O;  2K88 A;  1X79 B;  3HD7 D;  3MZW B;  1ZN5 A;  4DT0 A;  1NTZ J;  1VQP P;  3H1L G;  1FDM A;  5C39 A;  2QVA A;  1QL1 A;  1SFC A;  3M9Q A;  3RBX A;  1LWU B;  3V2N A;  5KKZ C;  4XE5 B;  1BE3 E;  2P2U A;  3SWY A;  4HM1 A;  3L72 E;  4WY4 A;  1FZC C;  3IFM A;  4OWF A;  5AVQ B;  2UWJ E;  2E75 B;  4QMA A;  4R4M A;  4WVZ A;  4GDO A;  2KOG A;  4JBZ A;  1HWT C;  4GIF A;  1KC8 Q;  1QGK B;  1L0L K;  2JDI H;  1HUC A;  2OTK E;  3BAS A;  1LP1 A;  5DJT B;  4L73 A;  1DIP A;  1G8J B;  4GOE A;  4DZO A;  1OVU A;  4GOF A;  4HJG H;  2SPZ A;  1KOR A;  3K5B A;  3VMX A;  1PGJ A;  1QX8 A;  1KB9 D;  1M1J A;  2M8R A;  3CCM P;  3WUT A;  3EWK A;  3L74 E;  1O7G A;  4HM0 A;  3A0B E;  1YIT P;  1W2B O;  1JMM A;  3GMA A;  4IOI H;  1QLE D;  1VF5 B;  3OA7 A;  1YTZ T;  2NZ2 A;  4ZKP A;  2K9J A;  2Q9I A;  2K37 A;  2XSO A;  1Q81 Q;  5AVY B;  1YYC A;  2D2C B;  4HM6 A;  3E1R A;  3AEF C;  1G8K B;  2Y9Y A;  3P8C D;  5BOK A;  5K5G B;  1NTM J;  1S3J A;  2V7Q H;  2OYH A;  1OVR A;  2E74 B;  2ZJS E;  1L0N G;  1YJW P;  2OYI A;  2A06 D;  4ZMD A;  1NVO A;  4C7N B;  3HTK B;  2ZT9 B;  2HG5 D;  2ZYA A; 
#chains in the Genus database with same CATH homology
 1BE3 E;  3L73 E;  2NVG A;  3FOU A;  4QDF B;  5AEU A;  1VCK A;  2BMR A;  1JM1 A;  1SQX E;  4HM1 A;  3H1L E;  2E75 D;  3AZC A;  4HM7 A;  3L72 E;  1BCC E;  3H1K E;  1ULJ A;  3GOB A;  2BMQ A;  2E4Q A;  3CXH E;  3D89 A;  4H13 D;  1O7P A;  3VMI D;  4HM3 A;  2GBW A;  4NBF D;  2HMM A;  2E74 D;  1O7N A;  2BMO A;  4HM4 A;  1ZRT E;  1O7W A;  2YVJ B;  2ZT9 D;  2FYU E;  3GL0 A;  3VCA A;  2QJK C;  1L0N E;  1UUV A;  1RFS A;  5KLV E;  3L70 E;  1RIE A;  4NBA D;  2HMK A;  5CXM A;  2XRX A;  4NBB D;  1SQB E;  2B24 A;  2DE7 D;  2QJP C;  2Q3W A;  1O7M A;  4P1B H;  4QCK A;  4EMJ B;  1SQQ E;  5AEW A;  2B1X A;  2HMJ A;  2NUK A;  3TGU E;  2YFI A;  2QPZ A;  2YFL A;  2NVE A;  3BCC E;  2E4P A;  4P1C H;  1G8J B;  1SQP E;  1L0L E;  2YIU C;  4PV1 D;  3GTE A;  4NBD D;  3VCP A;  2DE6 D;  3H1H E;  2FYN C;  3DQY A;  3H1J E;  1ULI A;  1KB9 E;  1NTM E;  3GCE A;  5HL4 A;  2JO6 A;  2I7F A;  4HM5 A;  2QJY C;  4QUP A;  2HMO A;  2YFJ A;  4QDC A;  3GL2 A;  1SJG A;  1BGY E;  4QUQ A;  3L74 E;  2NUM A;  3GTS A;  1VF5 D;  1O7G A;  2HML A;  4HM0 A;  4QDF A;  2DE5 D;  1EG9 A;  1NTZ E;  2NVF A;  2JZA A;  1NU1 E;  4NB9 D;  1NYK A;  3VMH D;  4AIV A;  4PD4 E;  3CWB E;  4U3F E;  3EN1 A;  3GZY A;  2ZYL A;  3L71 E;  3EQQ A;  4NBG D;  4HKV A;  3GB4 A;  3GKE A;  2HMN A;  1SQV E;  1VM9 A;  1PP9 E;  4NBH D;  2BCC E;  4HM2 A;  2XSO A;  5KLI C;  1WQL A;  4H44 D;  4OGQ D;  4D6T E;  1NDO A;  4HM6 A;  3VMG D;  3GZX A;  2XR8 A;  4AAY B;  1PPJ E;  3L75 E;  3CX5 E;  1KYO E;  1NTK E;  2IBZ E;  1G8K B;  2E76 D;  4H0L D;  1O7H A;  4NB8 D;  4NBE D;  1FQT A;  4QDD A;  4QUR A;  3N0Q A;  2GBX A;  4HM8 A;  5BOK A;  1P84 E;  1Q90 C;  1UUW A;  2A06 E;  3C0D A;  5KKZ C;  2XSH A;  2NWF A;  1EZV E;  4NBC D;  2D2C D;  2CKF A;  4HJL A;  3H1I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...