1KB9E

Yeast cytochrome bc1 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 47
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1kb9E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1kb9E02
2IBZE 2QPZA 4NBGD 3GOBA 3VCAA 2XR8A 1SQVE 1O7HA 2BCCE 3FOUA 1SQPE 2FYNC 2GBXA 5HL4A 4QDCA 2HMKA 1SJGA 2HMNA 2YFIA 1NDOA 2E4QA 1O7WA 4HM8A 5AEWA 3GKEA 5KKZC 4QDDA 4NBHD 1SQXE 1G8JB 4EMJB 1NU1E 3DQYA 1NTME 3GL2A 1SQBE 4PD4E 1O7PA 3L73E 4QUPA 2BMQA 4QCKA 5CXMA 4QDFB 3GZYA 2XSHA 4NBFD 1PPJE 2NUKA 4NBBD 3C0DA 4NBCD 2DE7D 1Q90C 5BOKA 4HM7A 2YFLA 4HM5A 3VMHD 4OGQD 2DE6D 1L0NE 2YIUC 3GCEA 4QURA 1KYOE 1KB9E 1VF5D 1NYKA 4H44D 1PP9E 4HJLA 2ZT9D 4HM3A 3CXHE 4NBAD 2NUMA 4HM6A 2FYUE 2B1XA 4NB8D 1BCCE 3GZXA 2HMOA 2I7FA 1NTKE 3GTEA 3GB4A 3GL0A 1P84E 1VM9A 2YVJB 2DE5D 2GBWA 2E76D 3H1HE 2HMMA 2BMOA 3GTSA 3L70E 4H13D 5KLIC 4AIVA 3L72E 2Q3WA 2QJKC 1SQQE 2JZAA 4P1CH 2XSOA 3CX5E 2HMLA 3VMID 2XRXA 1ULJA 1L0LE 4HM2A 4U3FE 1BE3E 3L74E 2NVGA 4PV1D 2QJPC 4HKVA 1WQLA 2JO6A 3VCPA 2A06E 1NTZE 1O7MA 3EN1A 5KLVE 1FQTA 3L75E 2E74D 2NWFA 2E75D 1JM1A 3N0QA 5AEUA 3AZCA 2CKFA 4NBED 4NBDD 1EZVE 1EG9A 4HM1A 3VMGD 1VCKA 1RFSA 2BMRA 4HM0A 4D6TE 3TGUE 1O7GA 1UUVA 3H1IE 4QDFA 3D89A 2YFJA 1RIEA 2HMJA 2QJYC 3EQQA 2E4PA 1ZRTE 4NB9D 2B24A 1G8KB 1O7NA 3CWBE 2NVFA 4H0LD 3BCCE 1ULIA 4AAYB 1BGYE 2NVEA 3H1JE 1UUWA 3H1KE 2ZYLA 2D2CD 4QUQA 4HM4A 4P1BH 3H1LE 3L71E
chains in the Genus database with same CATH superfamily
1DEEG 2IFMA 1M56D 4UB6E 1HBWA 3B8EB 5KAIE 1WT6A 1YITP 1O7WA 5KJ7C 2R3CA 1KFMA 1SQXE 1GW3A 2HFED 1NU1E 2YKPA 2M0BA 1JY2O 4GODA 5GTIE 4NPDA 2OYHC 4QDFB 5CXMA 3KPEA 2DW3A 1Q90C 4JQ0D 4JBZA 1NGMB 1BCCJ 1N7SA 2W83C 3GLMA 1PP9E 3LIEA 2M8RA 2QEXP 1PGQA 1PGPA 1JCDA 1EC5A 3MP7B 2JP3A 1VQLP 1HJ0A 1GTWA 2C0WA 1XTCC 2DE5D 1SQQD 4IFDK 1JM0A 2HMLA 1ULJA 1R5SA 1HUCA 3H6PA 2P7JA 1S1CX 1FQTA 3RL0B 4IL6X 1CZQA 2KS1B 5AEUA 4GOFA 4NBED 4DOJA 3SWYA 1SQBG 1S4XA 4HM0A 2PGDA 4PD4D 1KQSO 2H8PD 3L74G 1S9KE 2NVFA 1VQPP 1KD1Q 3H1KE 4QUQA 1LT9A 2IYPA 1P84I 1RH5B 2KI7B 2QPZA 3VMXA 2O01N 1A02J 1W2BO 1IFDA 3NFQA 3CX5D 3P8CD 3V2QA 1SJGA 1RE4C 4JYCA 4OWFA 1OFCX 4PD4H 1SQVD 4DJGA 3O8ZA 3KZIE 3FWLA 2LXCB 5DJTB 1KYOE 3RK3B 3L35A 1FZBA 2JR8A 3FWNA 2A06G 3CXHE 4NBAD 1T2KD 3C8VA 4NB8D 2CPSA 1L4AC 3GTEA 3KQGA 2GBWA 2JO1A 2HODA 1VL2A 1NTKK 2WPSA 5APXA 2Q3EA 2E5YA 4L74A 4HM2A 1USDA 2P1JA 1WMKA 1PFIA 1EDLA 1LTTC 3L75D 1JB0J 1AQ5A 1BGYD 3SWKA 2R5BA 3GF3A 1EZVE 4HM1A 1NTMG 1VCKA 1BGYJ 2NPSC 4GDOA 3EQQA 1LP1A 1QL2A 1G1IA 1G1JA 3B5NB 3BCCE 1PP9G 3E7KA 1BGYE 2HODB 2ZYLA 2Q6QA 2IBZI 2KSJA 1L4AB 3Q5RA 4U7JA 2YKOA 5CCGA 2ZYAA 2NPSB 1GL2A 5HL4A 3BCCD 2HMKA 5CMZA 3USSA 2H89C 4H13C 3GKEA 1P84D 1URQC 5KKZC 1Y8AA 1LWUB 3CD6P 1SQBE 3PTZA 2P10A 3A3YB 3AEEC 4TT3H 2QE7H 2J5UA 2ZT9C 1JTHA 1M90Q 1K73Q 1FZCA 3L71G 3SSUA 4U3FG 1ZOYC 2IZ1A 1LP1B 1GK4A 5B5EE 3CXHD 2WPRA 2B1XA 3EWKA 4PJ0H 3CPWO 1RE4A 1L0NG 2M3BA 3HE4B 3H1IG 4N3YB 2FYUG 3HTKB 2FBWC 1EQ7A 3VCPA 1FZFA 1NTZE 3L75E 5B5EH 3AE1C 1PV3A 3UIAA 4N78E 4WVZA 3AZCA 2Y0DA 5KLVK 2JDIH 3AE9C 4HYTB 1L0NJ 4WY4B 4D6TE 3Q5PA 2YO3A 1S72P 5CHXA 4WWIA 1ZRTE 3M0DA 1NU1K 2E74C 2C9NY 1NJIQ 1X22A 4EIJA 3M0DC 2QA4P 4IOIH 3RGUA 2W27A 4XFJA 2BEQD 4R4MA 3CX5H 3VMYA 3D6ZA 1RE3C 3A5TA 4HJGH 1PIXA 3HE5B 3KDPB 2V7QJ 3TNUA 1VF5B 3TYYA 1IK9A 4W7YA 2JWAA 1X8YA 3L72D 1T3UA 2IDBA 4ZMDA 2NUKA 4NBBD 1Q2NA 4OVNF 3VMHD 3G9RA 1EDKA 4KHXA 3GHGC 1ZLLA 3WU2H 4HJLA 1VQNP 2OGUA 3GMAA 3WMM0 1KQLA 3CCSP 3RK3E 3GB4A 2WZ7A 5APQA 3JSVC 5AW3B 2AXCA 3PHLA 2HMMA 3CWBG 1VQ9P 3L72E 4YPCA 1KILB 4WY4D 3RK3D 1MV8A 2E74D 3WUVA 3VYIA 1QL1A 4Z1MH 1T8ZA 1EG9A 3BRVB 4C7RA 2WSCH 2ZFCA 3CWBD 1KB9D 1FC2C 4GKGA 3CCQP 3MGNA 3A7OA 1UUWA 3RL0C 3ITKA 2QG4A 1HTLC 1RF1C 1M1JA 3H1LJ 2XU6A 4GOEA 3EQ2A 2WMMA 5C39A 1NTKD 3IFMA 2XDJA 2BCCD 1K05A 2GBXA 1AA0A 2IPPA 1FZGA 2Z5HA 1OVUA 3VMZA 2LKMA 1NTME 1EDIA 1Q86Q 4PD4E 2M5AB 1KQGB 3C9IA 5K5GB 1SQVK 3AEAC 3CL3D 3Q5SA 1M1JB 1FZEA 2QIWA 2IZ0A 4MN4C 3MUDA 2W90A 3T97B 1T6AA 1AJYA 2ZYGA 3GZXA 3RBXA 2GUSA 2J59M 3AEFC 2H88C 3A2AA 3H1LD 3PP5A 2QM7A 1KB9H 1SQQE 2B87B 3CX5E 5CBOA 1HJBA 1VDFA 2HLOA 2WITA 2KLVA 2A06E 2R5DA 2KYVA 3U59A 2LR2A 3AE8C 3M06A 1H0TB 1YYCA 2E76B 2M5AA 4IFFA 1EDJA 3T97A 2QJYC 2ZJSE 1KILE 1JMMA 2E4PA 2ZVNB 2B24A 1ZV8A 2Q3IA 1W5CE 1RHZB 3I55P 3L71E 2GM4A 3V5BA 2NRGA 2KZJA 2Y0EA 1GDTA 1PZQA 2QJYB 2HMNA 2V4HA 2E4QA 4XE5B 3GG2A 1CI6B 4Y99C 2KIKA 3L71D 4NBHD 1VQ5P 3K5BA 1SS1A 1LTJA 3L70G 2POHA 4H44C 1OW7A 2O1KA 1LJ2A 4U3FD 2DE7D 1JUNA 2N1TB 5AVSB 1E5WA 2YIUC 3D70A 2WSEJ 4IL6H 1AQTA 3AE4C 3L70D 1YJNP 3KXDA 2ZT9D 3H1HJ 1BSNA 2N9YB 3G3ZA 3JCUH 1M57D 3GL0A 5AVVB 2FYUK 3W67A 2OYIA 4R4LA 4LLHA 3VP9A 1H88A 1GW4A 3IF4A 3WUUA 1JEKA 4BWNA 1CSBA 1IC2A 1QX8A 2Y0CA 5CJ4A 1IO4A 4PD4I 1ZRTD 3M0AA 3WU2E 4D6TG 1H0TA 3TGUJ 1YHQP 5APTA 2ZXXA 1LT1A 1PP9J 3TGUD 3LIDA 1HH0A 1SQXG 1RIEA 2FFDB 3IR9A 4RJTA 2BEZF 3ZDMA 2NVEA 4GIFA 1MUUA 4P1BH 2IBZE 1KZUB 2XNDH 4ASVA 3V2RA 1YJ9P 4LC1A 2P2UA 5AEWA 2PP6A 5B66E 5E79H 2P58A 4Y99B 4QCKA 1USEA 2XZRA 4NBFD 1GL2D 1N7SB 1KYOH 1KILC 2C0XA 1VQ8P 3AE7C 1QGKB 4WY4C 5CBNA 2P67A 1S2EA 2Q9IA 4EYYQ 5APWA 1NTZG 4JYBA 3H1HG 3PLNA 5M1BA 1JO5A 3NTNA 1FAVA 2E75B 4AIVA 1VQ7P 4DT0A 3OA7A 2Q7CA 1OW6A 3L4FA 1MFTA 2ZXEB 2OARA 5AW1B 1URQA 1GU5A 3MUDC 3VMGD 3L75J 1U7JA 4Y28J 4L75A 3TK1A 1LTGC 1HGZA 2FYNB 3Q1MA 2FFDA 2KSEA 1LT9B 1PL5A 1LGHB 5DJUB 4CPGA 3BCCJ 5AVZB 3CCRP 2ZAEB 1IJDB 1L0ND 2D2CD 3SFEC 2CPBA 1NAFA 1JY3O 1SQVE 3A0HH 3HTKA 3U1AA 4HM8A 2Z5IA 4EMJB 3WUTA 2R3SA 3HE5A 1KV4A 4B86A 4UB8E 5H2FH 4EDFA 3GZYA 5CCHD 1S9KD 4NBCD 1URQB 1KFNA 2YFLA 2A06D 1DIPA 2AXTE 3H1LG 4H44D 2WT7B 4HM3A 1QLED 2XNXA 2I7FA 1N73C 4W7ZA 3N7NA 2KXPB 3H1HE 3G4SP 3GTSA 1EZVI 1GL2B 1Y9BA 2FKWB 5AW2B 3JCUE 1NVOA 5AW5B 1NYHA 2W6JH 1YI2P 4DZOA 1KQFB 3Q3DA 1SQPD 2E75D 3M9BA 5APSA 1Z56A 1S5LE 1R5LA 5KAIH 3GHGA 2KZIA 3H32B 2HMJA 4AYCA 1IFJA 2W6BA 2ITAA 1SQQK 4PJ0E 1SQPG 2ZYDA 3F89A 2KLUA 5AVWB 2QJPB 1QEXA 4NBGD 3GOBA 4NPEA 2YXRB 2YMYA 4I6MC 2BCCE 3FOUA 4XA4A 1BCCG 3CC2P 4I2LC 1CI6A 1SQQG 3B71A 5APYA 4QUPA 2BMQA 2O3JA 1JY3P 3P8CE 1PPJE 3OJAB 1SQVG 1NTMK 5CJ0A 3C1LA 1GL2C 2QJKB 1NYKA 1J1EB 1HGVA 1GZLA 1BCCE 2AEMA 2Y9YA 1M7LA 2W6AA 1RF0C 4NPFX 1VM9A 3L73J 2YVJB 2K9YA 1NAYA 1SQVJ 2MJZA 3BRTB 3CC7P 3D71A 2YIUB 4PV1C 2OTJP 1N7SD 3GW6A 2Q1KA 3M9HA 1KYOI 2R32A 2FYZA 1NTZD 3MZWB 1LWUA 4WY4A 2K37A 1PGOA 1JM1A 1BSHA 3N4XA 1EZVD 1NTMJ 1T2KC 3GHGB 3OW2O 5CCGC 2YFJA 4ZNCA 2B89A 4N6JA 4C7NA 5AW7B 4H0LD 2IX7C 3A0BH 3CXHH 1RY3A 2G8YA 2BCCG 3H1KJ 2D2CC 5AVRB 1IK7A 2LXBA 4QDCA 1IFNA 2OTLP 1JY2N 3M9QA 3TSIA 2PFXA 4BRYB 2RN0A 2I8DA 3L74J 1SQXJ 4D6TD 1O7PA 1KILA 2HYNA 2OYIC 1K04A 1N8RQ 1MKMA 1OVVA 1SFCD 4H13B 4HM7A 2FXOA 1FZCB 1LTJB 2IYOA 1S5LX 2QM8A 3VP8A 1OW8A 1VF5D 2QVAA 1HWTC 2K9JB 4C7NB 1M1KQ 2OYHA 3KHUA 4M3LA 1L0LD 2K1AA 2K88A 2L5GB 3B5NC 5APUA 3IN6A 2JEEA 1JNMA 2XKMA 5AW8B 1Y47A 3P32A 2B87A 1SQXD 4D6TJ 1L0LE 4OH8B 3CMEP 1JMBA 2YXQB 1KTMA 3S1KA 1FZAA 1ZW0A 2B88A 2ZVOB 3EFFK 3EN1A 1HVVA 2N1TD 5KKZB 5KLVG 1GU4A 2NPSD 3AE5C 1XTGB 4K3AA 4WB4A 1NU1J 1NOHA 4RO0A 1O7GA 1LTJC 3BASA 3L74D 1X0TA 1K8AQ 1U57A 1L4AD 1BE3G 3AECC 1ZR2A 3CWBE 1FS0E 1AVYA 4AAYB 3R4YA 1RF1B 4ZKUA 2PRRA 4YTPC 2FY8A 1D7MA 1FDIA 2FXMA 2QSIA 3H1KG 5L8RJ 4JF7A 1FZCC 2I1JA 2AEJA 3CI9A 2AXTH 1GK6A 2WPQA 2KOGA 2JKVA 1DX7A 1L0LJ 1KC8Q 1BE3J 2A45I 2JJLA 3H1JG 1OWAA 1NTMD 1SFCA 2QRXA 1ZMEC 5CCGD 1VF5C 2YMKA 1NTZJ 3RK2C 1KB9I 5AW6B 1NO4A 1KB9E 2M3EA 3H1IJ 1NKZB 3H1JJ 1HF9A 1IFMA 5AVTB 4HKZH 3S4RA 1AFOA 3AE3C 3PH0A 2I1KA 5KLIC 2Q3WA 2KNCB 2XV5A 4AUWA 3L71J 3M91A 4RESB 1DD3A 1YIJP 1GMJA 4H44B 2K3RA 2V7QH 5AW4B 1JCCA 3L37A 1PPJG 4DCKA 1SQPK 1M1JC 3O6QA 1KYOD 3V2PA 3OAKA 1BGYG 3D89A 2H7HA 2J58A 1DH3A 2MKVA 4TLFA 1PPJD 1SQBK 3BVHA 3B5NA 2FYUJ 2HG5D 5B66H 1LWUC 3AEDC 4HM4A 1NH4A 3H1LE 3HD7B 2WSFH 1MZ9A 1NTKG 2FYNC 4YXDC 1OX3A 1L0LG 2HPCB 1YQ3C 2E76C 4BXLA 3H1ID 2W8ZA 3SWFA 1SQPJ 2FFDC 1PGJA 5BOKA 2DE6D 2E75C 2WPVB 3V4WA 1LNQA 1NTZK 3G71P 1OZHA 1JOCA 4I7ZC 1KILD 4HM6A 2FYUE 1RE3A 2WT7A 4C46A 2Z4EA 1RF1A 2CK3H 2QJKC 3V6IA 4H0LB 3F5HA 4P1CH 3HE4A 3PRJA 3CCMP 5AW0B 4U3FE 3VTPC 2WSEH 1EXJA 3KYQA 1WQLA 4HKVA 2KB7P 1QVGO 5BU5A 4IL6E 3CCUP 1JTHB 2L91A 1T3JA 3TGUE 5CCHC 4QDFA 1VQMP 4UB6H 3L73G 3CX5I 1AVOA 3D6YA 1OIPA 1MFZA 3I56P 1VPCA 4OGQB 2UWJE 5EFWB 2RH0A 2XR8A 1E79H 1FOSE 3BATA 1L4AA 1FDMA 1NHLA 3CC4P 2KUBA 1NKNA 3P8MC 2Q5UA 1BDDA 1NWQA 4GT1A 2YNYA 3HUSA 3C0DA 2SPZA 3GF7A 3L72G 1N2DC 4OGQD 2RKLA 1N86A 3HRNA 1FU1A 3CCJP 3FX0A 3R2PA 1IZNB 1OXZA 1BCCD 4EI2A 1S5LH 2HMOA 3A0BE 3L36A 1LT9C 2IBZD 3L70E 3L72J 3P7KA 3RK3C 1YJWP 1RQVA 4EOTA 2JZAA 1OVRA 4ZKPA 2VRSA 2A45G 4UB8H 5KTBA 2IFNA 2JO6A 1LTBC 3CXHI 3FGAD 1J1DB 3TGUG 1Q81Q 2HPCA 2O1JA 2CKFA 1J2JB 3CLQA 1LTSC 3FXEA 1UUVA 2KP8A 4YXWH 1H8AA 4NB9D 2N1TC 2D2CB 3NXSA 1SQBJ 5GTIH 1ULIA 2Y9ZA 1A02F 1JY3N 3L70J 2RMZA 3I5CA 5TISH 3E1IA 3S9OA 5GTHH 3QWOC 3L73D 1FJPA 1YTZT 1O7HA 1S3JA 3QH9A 5CCHA 4QMAA 5KLVJ 3B5ND 3MIWA 2YFIA 1YBKA 2PAJA 1G8JB 3GL2A 1VQ4P 3L73E 1SFCB 3V2NA 1DD4A 2FXPA 1FJKA 5AVQB 3AE2C 2H43A 4HM5A 1RF0A 1L0NE 5AVUB 4PV1B 3H1HD 3IAOA 1VQKP 1TU3F 4WBAA 5E79E 1VQ6P 2GUVA 1H89A 1NTKE 1X9VA 1QVFO 4L73A 5KJ7D 3ABVC 1IFPA 2A45H 5AVYB 2AEFA 1R8EA 2NZ2A 1ZXGA 4H13D 2JWDA 1KORA 2XSOA 4HH2A 1DEBA 1G2CB 1LTAC 2C9LY 2BCCJ 4U3FJ 2WWWA 3CCEP 3RL0D 5BVZA 1PP9D 2E74B 4NBDD 1EXIA 5APVA 3H1IE 2B9BA 1YTZI 4ASWA 4KT0J 3AEGC 3HUSC 2K9JA 1G8KB 1NU1G 2YO2A 1N73B 1P84H 4OGQC 3VN0A 2NPSA 2N9BA 1AV1A 3MHVA 3TF5A 3VCAA 3VOPA 2FYUD 2G3AA 1SQPE 5KLIB 1Q7YQ 3TNUB 3V4QA 1NDOA 1RQUA 2WSFJ 3AEBC 4QDDA 2OQQA 3U1CA 3DQYA 4K35A 3B4SA 3E1RA 5TJHA 2XSHA 5BU8B 4I1LA 3JC22 2N1TA 1N73A 4RKUJ 1KMIZ 3KZIH 1SVFA 4JPZB 3GCEA 2OYOA 2O01H 3H32A 1BDCA 3CCLP 1KN7A 3RBZA 4L76A 3II6A 2WSSH 2OYHB 1W2EA 1FDOA 3HD7D 1X79B 2WSCJ 2E76D 1URQD 3H1JD 4W80A 3VMID 1IFIA 1L0NK 2YKQA 3BCCG 3A0HE 1BE3E 5AW9B 2QJPC 1EZVG 1O7MA 2E42A 2R44A 5KLVE 2E43A 3TDKA 4BRYA 3N0QA 1RFSA 4O9BA 2BMRA 3LW5J 2KK7A 1SQBD 1BE3D 1JY2P 1SQXK 3CCVP 3O6QB 4IFMA 5KJ7A 5TISE 3RL0g 3CWBJ 3H1JE 4AQRD 1FOSF 1NTKJ 1SLQA 3MTUE 3LW5H 1Q82Q 3PJSK 1J1EC 1WRGA 1FBMA 4A7PA 3NMDA 3L75G 1CW5A 1FE6A 4H0LC 2KNCA 1VQOP 5AVXB 3RK2B 1N7SC 2KS1A 3H25A 3CMAP 3HD7C 5H2FE 2O01J 1SQQJ 5GTHE 1YQ4C 3EFGA 1NU1D 1G2CA 4I7ZB 3HUSB 2BASA 5KAFH 4LGDE 2WVRA 4QURA 4N78D 1LTIC 3HD7A 1ZR4A 2NUMA 1OMIA 1SFCC 2IBZG 1UIIA 3SFDC 1P84E 2HR3A 1L0LK 2BMOA 1ZP0C 3G6EP 2XRXA 2OTKE 5KAFE 2ZT9B 1U7MA 3L74E 2NVGA 4PV1D 4KJMA 3Q2YA 1GD2E 5KLVD 1Q90D 1UIXA 2NWFA 2WTYA 3MD0A 3FXDA 1K9MQ 1L2PA 4HB1A 1SP4A 3AE6C 2WQYC 2E5TA 1O7NA 2GA1A 1M8OB 3RK2D 2OYIB 3W68A 1J1DC 1ZN5A 1N7LA 3H1KD 3VMAA
chains in the Genus database with same CATH topology
2IBZE 2QPZA 4NBGD 3GOBA 3VCAA 2XR8A 1SQVE 1O7HA 2BCCE 3FOUA 1SQPE 2FYNC 2GBXA 5HL4A 4QDCA 2HMKA 1SJGA 2HMNA 2YFIA 1NDOA 2E4QA 1O7WA 4HM8A 5AEWA 3GKEA 5KKZC 4QDDA 4NBHD 1SQXE 1G8JB 4EMJB 1NU1E 3DQYA 1NTME 3GL2A 1SQBE 4PD4E 1O7PA 3L73E 4QUPA 2BMQA 4QCKA 5CXMA 4QDFB 3GZYA 2XSHA 4NBFD 1PPJE 2NUKA 4NBBD 3C0DA 4NBCD 2DE7D 1Q90C 5BOKA 4HM7A 2YFLA 4HM5A 3VMHD 4OGQD 2DE6D 1L0NE 2YIUC 3GCEA 4QURA 1KYOE 1KB9E 1VF5D 1NYKA 4H44D 1PP9E 4HJLA 2ZT9D 4HM3A 3CXHE 4NBAD 2NUMA 4HM6A 2FYUE 2B1XA 4NB8D 1BCCE 3GZXA 2HMOA 2I7FA 1NTKE 3GTEA 3GB4A 3GL0A 1P84E 1VM9A 2YVJB 2DE5D 2GBWA 2E76D 3H1HE 2HMMA 2BMOA 3GTSA 3L70E 4H13D 5KLIC 4AIVA 3L72E 2Q3WA 2QJKC 1SQQE 2JZAA 4P1CH 2XSOA 3CX5E 2HMLA 3VMID 2XRXA 1ULJA 1L0LE 4HM2A 4U3FE 1BE3E 3L74E 2NVGA 4PV1D 2QJPC 4HKVA 1WQLA 2JO6A 3VCPA 2A06E 1NTZE 1O7MA 3EN1A 5KLVE 1FQTA 3L75E 2E74D 2NWFA 2E75D 1JM1A 3N0QA 5AEUA 3AZCA 2CKFA 4NBED 4NBDD 1EZVE 1EG9A 4HM1A 3VMGD 1VCKA 1RFSA 2BMRA 4HM0A 4D6TE 3TGUE 1O7GA 1UUVA 3H1IE 4QDFA 3D89A 2YFJA 1RIEA 2HMJA 2QJYC 3EQQA 2E4PA 1ZRTE 4NB9D 2B24A 1G8KB 1O7NA 3CWBE 2NVFA 4H0LD 3BCCE 1ULIA 4AAYB 1BGYE 2NVEA 3H1JE 1UUWA 3H1KE 2ZYLA 2D2CD 4QUQA 4HM4A 4P1BH 3H1LE 3L71E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBZ E;  2QPZ A;  4NBG D;  3GOB A;  3VCA A;  2XR8 A;  1SQV E;  1O7H A;  2BCC E;  3FOU A;  1SQP E;  2FYN C;  2GBX A;  5HL4 A;  4QDC A;  2HMK A;  1SJG A;  2HMN A;  2YFI A;  1NDO A;  2E4Q A;  1O7W A;  4HM8 A;  5AEW A;  3GKE A;  5KKZ C;  4QDD A;  4NBH D;  1SQX E;  1G8J B;  4EMJ B;  1NU1 E;  3DQY A;  1NTM E;  3GL2 A;  1SQB E;  4PD4 E;  1O7P A;  3L73 E;  4QUP A;  2BMQ A;  4QCK A;  5CXM A;  4QDF B;  3GZY A;  2XSH A;  4NBF D;  1PPJ E;  2NUK A;  4NBB D;  3C0D A;  4NBC D;  2DE7 D;  1Q90 C;  5BOK A;  4HM7 A;  2YFL A;  4HM5 A;  3VMH D;  4OGQ D;  2DE6 D;  1L0N E;  2YIU C;  3GCE A;  4QUR A;  1KYO E;  1KB9 E;  1VF5 D;  1NYK A;  4H44 D;  1PP9 E;  4HJL A;  2ZT9 D;  4HM3 A;  3CXH E;  4NBA D;  2NUM A;  4HM6 A;  2FYU E;  2B1X A;  4NB8 D;  1BCC E;  3GZX A;  2HMO A;  2I7F A;  1NTK E;  3GTE A;  3GB4 A;  3GL0 A;  1P84 E;  1VM9 A;  2YVJ B;  2DE5 D;  2GBW A;  2E76 D;  3H1H E;  2HMM A;  2BMO A;  3GTS A;  3L70 E;  4H13 D;  5KLI C;  4AIV A;  3L72 E;  2Q3W A;  2QJK C;  1SQQ E;  2JZA A;  4P1C H;  2XSO A;  3CX5 E;  2HML A;  3VMI D;  2XRX A;  1ULJ A;  1L0L E;  4HM2 A;  4U3F E;  1BE3 E;  3L74 E;  2NVG A;  4PV1 D;  2QJP C;  4HKV A;  1WQL A;  2JO6 A;  3VCP A;  2A06 E;  1NTZ E;  1O7M A;  3EN1 A;  5KLV E;  1FQT A;  3L75 E;  2E74 D;  2NWF A;  2E75 D;  1JM1 A;  3N0Q A;  5AEU A;  3AZC A;  2CKF A;  4NBE D;  4NBD D;  1EZV E;  1EG9 A;  4HM1 A;  3VMG D;  1VCK A;  1RFS A;  2BMR A;  4HM0 A;  4D6T E;  3TGU E;  1O7G A;  1UUV A;  3H1I E;  4QDF A;  3D89 A;  2YFJ A;  1RIE A;  2HMJ A;  2QJY C;  3EQQ A;  2E4P A;  1ZRT E;  4NB9 D;  2B24 A;  1G8K B;  1O7N A;  3CWB E;  2NVF A;  4H0L D;  3BCC E;  1ULI A;  4AAY B;  1BGY E;  2NVE A;  3H1J E;  1UUW A;  3H1K E;  2ZYL A;  2D2C D;  4QUQ A;  4HM4 A;  4P1B H;  3H1L E;  3L71 E; 
#chains in the Genus database with same CATH topology
 1DEE G;  2IFM A;  1M56 D;  4UB6 E;  1HBW A;  3B8E B;  5KAI E;  1WT6 A;  1YIT P;  1O7W A;  5KJ7 C;  2R3C A;  1KFM A;  1SQX E;  1GW3 A;  2HFE D;  1NU1 E;  2YKP A;  2M0B A;  1JY2 O;  4GOD A;  5GTI E;  4NPD A;  2OYH C;  4QDF B;  5CXM A;  3KPE A;  2DW3 A;  1Q90 C;  4JQ0 D;  4JBZ A;  1NGM B;  1BCC J;  1N7S A;  2W83 C;  3GLM A;  1PP9 E;  3LIE A;  2M8R A;  2QEX P;  1PGQ A;  1PGP A;  1JCD A;  1EC5 A;  3MP7 B;  2JP3 A;  1VQL P;  1HJ0 A;  1GTW A;  2C0W A;  1XTC C;  2DE5 D;  1SQQ D;  4IFD K;  1JM0 A;  2HML A;  1ULJ A;  1R5S A;  1HUC A;  3H6P A;  2P7J A;  1S1C X;  1FQT A;  3RL0 B;  4IL6 X;  1CZQ A;  2KS1 B;  5AEU A;  4GOF A;  4NBE D;  4DOJ A;  3SWY A;  1SQB G;  1S4X A;  4HM0 A;  2PGD A;  4PD4 D;  1KQS O;  2H8P D;  3L74 G;  1S9K E;  2NVF A;  1VQP P;  1KD1 Q;  3H1K E;  4QUQ A;  1LT9 A;  2IYP A;  1P84 I;  1RH5 B;  2KI7 B;  2QPZ A;  3VMX A;  2O01 N;  1A02 J;  1W2B O;  1IFD A;  3NFQ A;  3CX5 D;  3P8C D;  3V2Q A;  1SJG A;  1RE4 C;  4JYC A;  4OWF A;  1OFC X;  4PD4 H;  1SQV D;  4DJG A;  3O8Z A;  3KZI E;  3FWL A;  2LXC B;  5DJT B;  1KYO E;  3RK3 B;  3L35 A;  1FZB A;  2JR8 A;  3FWN A;  2A06 G;  3CXH E;  4NBA D;  1T2K D;  3C8V A;  4NB8 D;  2CPS A;  1L4A C;  3GTE A;  3KQG A;  2GBW A;  2JO1 A;  2HOD A;  1VL2 A;  1NTK K;  2WPS A;  5APX A;  2Q3E A;  2E5Y A;  4L74 A;  4HM2 A;  1USD A;  2P1J A;  1WMK A;  1PFI A;  1EDL A;  1LTT C;  3L75 D;  1JB0 J;  1AQ5 A;  1BGY D;  3SWK A;  2R5B A;  3GF3 A;  1EZV E;  4HM1 A;  1NTM G;  1VCK A;  1BGY J;  2NPS C;  4GDO A;  3EQQ A;  1LP1 A;  1QL2 A;  1G1I A;  1G1J A;  3B5N B;  3BCC E;  1PP9 G;  3E7K A;  1BGY E;  2HOD B;  2ZYL A;  2Q6Q A;  2IBZ I;  2KSJ A;  1L4A B;  3Q5R A;  4U7J A;  2YKO A;  5CCG A;  2ZYA A;  2NPS B;  1GL2 A;  5HL4 A;  3BCC D;  2HMK A;  5CMZ A;  3USS A;  2H89 C;  4H13 C;  3GKE A;  1P84 D;  1URQ C;  5KKZ C;  1Y8A A;  1LWU B;  3CD6 P;  1SQB E;  3PTZ A;  2P10 A;  3A3Y B;  3AEE C;  4TT3 H;  2QE7 H;  2J5U A;  2ZT9 C;  1JTH A;  1M90 Q;  1K73 Q;  1FZC A;  3L71 G;  3SSU A;  4U3F G;  1ZOY C;  2IZ1 A;  1LP1 B;  1GK4 A;  5B5E E;  3CXH D;  2WPR A;  2B1X A;  3EWK A;  4PJ0 H;  3CPW O;  1RE4 A;  1L0N G;  2M3B A;  3HE4 B;  3H1I G;  4N3Y B;  2FYU G;  3HTK B;  2FBW C;  1EQ7 A;  3VCP A;  1FZF A;  1NTZ E;  3L75 E;  5B5E H;  3AE1 C;  1PV3 A;  3UIA A;  4N78 E;  4WVZ A;  3AZC A;  2Y0D A;  5KLV K;  2JDI H;  3AE9 C;  4HYT B;  1L0N J;  4WY4 B;  4D6T E;  3Q5P A;  2YO3 A;  1S72 P;  5CHX A;  4WWI A;  1ZRT E;  3M0D A;  1NU1 K;  2E74 C;  2C9N Y;  1NJI Q;  1X22 A;  4EIJ A;  3M0D C;  2QA4 P;  4IOI H;  3RGU A;  2W27 A;  4XFJ A;  2BEQ D;  4R4M A;  3CX5 H;  3VMY A;  3D6Z A;  1RE3 C;  3A5T A;  4HJG H;  1PIX A;  3HE5 B;  3KDP B;  2V7Q J;  3TNU A;  1VF5 B;  3TYY A;  1IK9 A;  4W7Y A;  2JWA A;  1X8Y A;  3L72 D;  1T3U A;  2IDB A;  4ZMD A;  2NUK A;  4NBB D;  1Q2N A;  4OVN F;  3VMH D;  3G9R A;  1EDK A;  4KHX A;  3GHG C;  1ZLL A;  3WU2 H;  4HJL A;  1VQN P;  2OGU A;  3GMA A;  3WMM 0;  1KQL A;  3CCS P;  3RK3 E;  3GB4 A;  2WZ7 A;  5APQ A;  3JSV C;  5AW3 B;  2AXC A;  3PHL A;  2HMM A;  3CWB G;  1VQ9 P;  3L72 E;  4YPC A;  1KIL B;  4WY4 D;  3RK3 D;  1MV8 A;  2E74 D;  3WUV A;  3VYI A;  1QL1 A;  4Z1M H;  1T8Z A;  1EG9 A;  3BRV B;  4C7R A;  2WSC H;  2ZFC A;  3CWB D;  1KB9 D;  1FC2 C;  4GKG A;  3CCQ P;  3MGN A;  3A7O A;  1UUW A;  3RL0 C;  3ITK A;  2QG4 A;  1HTL C;  1RF1 C;  1M1J A;  3H1L J;  2XU6 A;  4GOE A;  3EQ2 A;  2WMM A;  5C39 A;  1NTK D;  3IFM A;  2XDJ A;  2BCC D;  1K05 A;  2GBX A;  1AA0 A;  2IPP A;  1FZG A;  2Z5H A;  1OVU A;  3VMZ A;  2LKM A;  1NTM E;  1EDI A;  1Q86 Q;  4PD4 E;  2M5A B;  1KQG B;  3C9I A;  5K5G B;  1SQV K;  3AEA C;  3CL3 D;  3Q5S A;  1M1J B;  1FZE A;  2QIW A;  2IZ0 A;  4MN4 C;  3MUD A;  2W90 A;  3T97 B;  1T6A A;  1AJY A;  2ZYG A;  3GZX A;  3RBX A;  2GUS A;  2J59 M;  3AEF C;  2H88 C;  3A2A A;  3H1L D;  3PP5 A;  2QM7 A;  1KB9 H;  1SQQ E;  2B87 B;  3CX5 E;  5CBO A;  1HJB A;  1VDF A;  2HLO A;  2WIT A;  2KLV A;  2A06 E;  2R5D A;  2KYV A;  3U59 A;  2LR2 A;  3AE8 C;  3M06 A;  1H0T B;  1YYC A;  2E76 B;  2M5A A;  4IFF A;  1EDJ A;  3T97 A;  2QJY C;  2ZJS E;  1KIL E;  1JMM A;  2E4P A;  2ZVN B;  2B24 A;  1ZV8 A;  2Q3I A;  1W5C E;  1RHZ B;  3I55 P;  3L71 E;  2GM4 A;  3V5B A;  2NRG A;  2KZJ A;  2Y0E A;  1GDT A;  1PZQ A;  2QJY B;  2HMN A;  2V4H A;  2E4Q A;  4XE5 B;  3GG2 A;  1CI6 B;  4Y99 C;  2KIK A;  3L71 D;  4NBH D;  1VQ5 P;  3K5B A;  1SS1 A;  1LTJ A;  3L70 G;  2POH A;  4H44 C;  1OW7 A;  2O1K A;  1LJ2 A;  4U3F D;  2DE7 D;  1JUN A;  2N1T B;  5AVS B;  1E5W A;  2YIU C;  3D70 A;  2WSE J;  4IL6 H;  1AQT A;  3AE4 C;  3L70 D;  1YJN P;  3KXD A;  2ZT9 D;  3H1H J;  1BSN A;  2N9Y B;  3G3Z A;  3JCU H;  1M57 D;  3GL0 A;  5AVV B;  2FYU K;  3W67 A;  2OYI A;  4R4L A;  4LLH A;  3VP9 A;  1H88 A;  1GW4 A;  3IF4 A;  3WUU A;  1JEK A;  4BWN A;  1CSB A;  1IC2 A;  1QX8 A;  2Y0C A;  5CJ4 A;  1IO4 A;  4PD4 I;  1ZRT D;  3M0A A;  3WU2 E;  4D6T G;  1H0T A;  3TGU J;  1YHQ P;  5APT A;  2ZXX A;  1LT1 A;  1PP9 J;  3TGU D;  3LID A;  1HH0 A;  1SQX G;  1RIE A;  2FFD B;  3IR9 A;  4RJT A;  2BEZ F;  3ZDM A;  2NVE A;  4GIF A;  1MUU A;  4P1B H;  2IBZ E;  1KZU B;  2XND H;  4ASV A;  3V2R A;  1YJ9 P;  4LC1 A;  2P2U A;  5AEW A;  2PP6 A;  5B66 E;  5E79 H;  2P58 A;  4Y99 B;  4QCK A;  1USE A;  2XZR A;  4NBF D;  1GL2 D;  1N7S B;  1KYO H;  1KIL C;  2C0X A;  1VQ8 P;  3AE7 C;  1QGK B;  4WY4 C;  5CBN A;  2P67 A;  1S2E A;  2Q9I A;  4EYY Q;  5APW A;  1NTZ G;  4JYB A;  3H1H G;  3PLN A;  5M1B A;  1JO5 A;  3NTN A;  1FAV A;  2E75 B;  4AIV A;  1VQ7 P;  4DT0 A;  3OA7 A;  2Q7C A;  1OW6 A;  3L4F A;  1MFT A;  2ZXE B;  2OAR A;  5AW1 B;  1URQ A;  1GU5 A;  3MUD C;  3VMG D;  3L75 J;  1U7J A;  4Y28 J;  4L75 A;  3TK1 A;  1LTG C;  1HGZ A;  2FYN B;  3Q1M A;  2FFD A;  2KSE A;  1LT9 B;  1PL5 A;  1LGH B;  5DJU B;  4CPG A;  3BCC J;  5AVZ B;  3CCR P;  2ZAE B;  1IJD B;  1L0N D;  2D2C D;  3SFE C;  2CPB A;  1NAF A;  1JY3 O;  1SQV E;  3A0H H;  3HTK A;  3U1A A;  4HM8 A;  2Z5I A;  4EMJ B;  3WUT A;  2R3S A;  3HE5 A;  1KV4 A;  4B86 A;  4UB8 E;  5H2F H;  4EDF A;  3GZY A;  5CCH D;  1S9K D;  4NBC D;  1URQ B;  1KFN A;  2YFL A;  2A06 D;  1DIP A;  2AXT E;  3H1L G;  4H44 D;  2WT7 B;  4HM3 A;  1QLE D;  2XNX A;  2I7F A;  1N73 C;  4W7Z A;  3N7N A;  2KXP B;  3H1H E;  3G4S P;  3GTS A;  1EZV I;  1GL2 B;  1Y9B A;  2FKW B;  5AW2 B;  3JCU E;  1NVO A;  5AW5 B;  1NYH A;  2W6J H;  1YI2 P;  4DZO A;  1KQF B;  3Q3D A;  1SQP D;  2E75 D;  3M9B A;  5APS A;  1Z56 A;  1S5L E;  1R5L A;  5KAI H;  3GHG A;  2KZI A;  3H32 B;  2HMJ A;  4AYC A;  1IFJ A;  2W6B A;  2ITA A;  1SQQ K;  4PJ0 E;  1SQP G;  2ZYD A;  3F89 A;  2KLU A;  5AVW B;  2QJP B;  1QEX A;  4NBG D;  3GOB A;  4NPE A;  2YXR B;  2YMY A;  4I6M C;  2BCC E;  3FOU A;  4XA4 A;  1BCC G;  3CC2 P;  4I2L C;  1CI6 A;  1SQQ G;  3B71 A;  5APY A;  4QUP A;  2BMQ A;  2O3J A;  1JY3 P;  3P8C E;  1PPJ E;  3OJA B;  1SQV G;  1NTM K;  5CJ0 A;  3C1L A;  1GL2 C;  2QJK B;  1NYK A;  1J1E B;  1HGV A;  1GZL A;  1BCC E;  2AEM A;  2Y9Y A;  1M7L A;  2W6A A;  1RF0 C;  4NPF X;  1VM9 A;  3L73 J;  2YVJ B;  2K9Y A;  1NAY A;  1SQV J;  2MJZ A;  3BRT B;  3CC7 P;  3D71 A;  2YIU B;  4PV1 C;  2OTJ P;  1N7S D;  3GW6 A;  2Q1K A;  3M9H A;  1KYO I;  2R32 A;  2FYZ A;  1NTZ D;  3MZW B;  1LWU A;  4WY4 A;  2K37 A;  1PGO A;  1JM1 A;  1BSH A;  3N4X A;  1EZV D;  1NTM J;  1T2K C;  3GHG B;  3OW2 O;  5CCG C;  2YFJ A;  4ZNC A;  2B89 A;  4N6J A;  4C7N A;  5AW7 B;  4H0L D;  2IX7 C;  3A0B H;  3CXH H;  1RY3 A;  2G8Y A;  2BCC G;  3H1K J;  2D2C C;  5AVR B;  1IK7 A;  2LXB A;  4QDC A;  1IFN A;  2OTL P;  1JY2 N;  3M9Q A;  3TSI A;  2PFX A;  4BRY B;  2RN0 A;  2I8D A;  3L74 J;  1SQX J;  4D6T D;  1O7P A;  1KIL A;  2HYN A;  2OYI C;  1K04 A;  1N8R Q;  1MKM A;  1OVV A;  1SFC D;  4H13 B;  4HM7 A;  2FXO A;  1FZC B;  1LTJ B;  2IYO A;  1S5L X;  2QM8 A;  3VP8 A;  1OW8 A;  1VF5 D;  2QVA A;  1HWT C;  2K9J B;  4C7N B;  1M1K Q;  2OYH A;  3KHU A;  4M3L A;  1L0L D;  2K1A A;  2K88 A;  2L5G B;  3B5N C;  5APU A;  3IN6 A;  2JEE A;  1JNM A;  2XKM A;  5AW8 B;  1Y47 A;  3P32 A;  2B87 A;  1SQX D;  4D6T J;  1L0L E;  4OH8 B;  3CME P;  1JMB A;  2YXQ B;  1KTM A;  3S1K A;  1FZA A;  1ZW0 A;  2B88 A;  2ZVO B;  3EFF K;  3EN1 A;  1HVV A;  2N1T D;  5KKZ B;  5KLV G;  1GU4 A;  2NPS D;  3AE5 C;  1XTG B;  4K3A A;  4WB4 A;  1NU1 J;  1NOH A;  4RO0 A;  1O7G A;  1LTJ C;  3BAS A;  3L74 D;  1X0T A;  1K8A Q;  1U57 A;  1L4A D;  1BE3 G;  3AEC C;  1ZR2 A;  3CWB E;  1FS0 E;  1AVY A;  4AAY B;  3R4Y A;  1RF1 B;  4ZKU A;  2PRR A;  4YTP C;  2FY8 A;  1D7M A;  1FDI A;  2FXM A;  2QSI A;  3H1K G;  5L8R J;  4JF7 A;  1FZC C;  2I1J A;  2AEJ A;  3CI9 A;  2AXT H;  1GK6 A;  2WPQ A;  2KOG A;  2JKV A;  1DX7 A;  1L0L J;  1KC8 Q;  1BE3 J;  2A45 I;  2JJL A;  3H1J G;  1OWA A;  1NTM D;  1SFC A;  2QRX A;  1ZME C;  5CCG D;  1VF5 C;  2YMK A;  1NTZ J;  3RK2 C;  1KB9 I;  5AW6 B;  1NO4 A;  1KB9 E;  2M3E A;  3H1I J;  1NKZ B;  3H1J J;  1HF9 A;  1IFM A;  5AVT B;  4HKZ H;  3S4R A;  1AFO A;  3AE3 C;  3PH0 A;  2I1K A;  5KLI C;  2Q3W A;  2KNC B;  2XV5 A;  4AUW A;  3L71 J;  3M91 A;  4RES B;  1DD3 A;  1YIJ P;  1GMJ A;  4H44 B;  2K3R A;  2V7Q H;  5AW4 B;  1JCC A;  3L37 A;  1PPJ G;  4DCK A;  1SQP K;  1M1J C;  3O6Q A;  1KYO D;  3V2P A;  3OAK A;  1BGY G;  3D89 A;  2H7H A;  2J58 A;  1DH3 A;  2MKV A;  4TLF A;  1PPJ D;  1SQB K;  3BVH A;  3B5N A;  2FYU J;  2HG5 D;  5B66 H;  1LWU C;  3AED C;  4HM4 A;  1NH4 A;  3H1L E;  3HD7 B;  2WSF H;  1MZ9 A;  1NTK G;  2FYN C;  4YXD C;  1OX3 A;  1L0L G;  2HPC B;  1YQ3 C;  2E76 C;  4BXL A;  3H1I D;  2W8Z A;  3SWF A;  1SQP J;  2FFD C;  1PGJ A;  5BOK A;  2DE6 D;  2E75 C;  2WPV B;  3V4W A;  1LNQ A;  1NTZ K;  3G71 P;  1OZH A;  1JOC A;  4I7Z C;  1KIL D;  4HM6 A;  2FYU E;  1RE3 A;  2WT7 A;  4C46 A;  2Z4E A;  1RF1 A;  2CK3 H;  2QJK C;  3V6I A;  4H0L B;  3F5H A;  4P1C H;  3HE4 A;  3PRJ A;  3CCM P;  5AW0 B;  4U3F E;  3VTP C;  2WSE H;  1EXJ A;  3KYQ A;  1WQL A;  4HKV A;  2KB7 P;  1QVG O;  5BU5 A;  4IL6 E;  3CCU P;  1JTH B;  2L91 A;  1T3J A;  3TGU E;  5CCH C;  4QDF A;  1VQM P;  4UB6 H;  3L73 G;  3CX5 I;  1AVO A;  3D6Y A;  1OIP A;  1MFZ A;  3I56 P;  1VPC A;  4OGQ B;  2UWJ E;  5EFW B;  2RH0 A;  2XR8 A;  1E79 H;  1FOS E;  3BAT A;  1L4A A;  1FDM A;  1NHL A;  3CC4 P;  2KUB A;  1NKN A;  3P8M C;  2Q5U A;  1BDD A;  1NWQ A;  4GT1 A;  2YNY A;  3HUS A;  3C0D A;  2SPZ A;  3GF7 A;  3L72 G;  1N2D C;  4OGQ D;  2RKL A;  1N86 A;  3HRN A;  1FU1 A;  3CCJ P;  3FX0 A;  3R2P A;  1IZN B;  1OXZ A;  1BCC D;  4EI2 A;  1S5L H;  2HMO A;  3A0B E;  3L36 A;  1LT9 C;  2IBZ D;  3L70 E;  3L72 J;  3P7K A;  3RK3 C;  1YJW P;  1RQV A;  4EOT A;  2JZA A;  1OVR A;  4ZKP A;  2VRS A;  2A45 G;  4UB8 H;  5KTB A;  2IFN A;  2JO6 A;  1LTB C;  3CXH I;  3FGA D;  1J1D B;  3TGU G;  1Q81 Q;  2HPC A;  2O1J A;  2CKF A;  1J2J B;  3CLQ A;  1LTS C;  3FXE A;  1UUV A;  2KP8 A;  4YXW H;  1H8A A;  4NB9 D;  2N1T C;  2D2C B;  3NXS A;  1SQB J;  5GTI H;  1ULI A;  2Y9Z A;  1A02 F;  1JY3 N;  3L70 J;  2RMZ A;  3I5C A;  5TIS H;  3E1I A;  3S9O A;  5GTH H;  3QWO C;  3L73 D;  1FJP A;  1YTZ T;  1O7H A;  1S3J A;  3QH9 A;  5CCH A;  4QMA A;  5KLV J;  3B5N D;  3MIW A;  2YFI A;  1YBK A;  2PAJ A;  1G8J B;  3GL2 A;  1VQ4 P;  3L73 E;  1SFC B;  3V2N A;  1DD4 A;  2FXP A;  1FJK A;  5AVQ B;  3AE2 C;  2H43 A;  4HM5 A;  1RF0 A;  1L0N E;  5AVU B;  4PV1 B;  3H1H D;  3IAO A;  1VQK P;  1TU3 F;  4WBA A;  5E79 E;  1VQ6 P;  2GUV A;  1H89 A;  1NTK E;  1X9V A;  1QVF O;  4L73 A;  5KJ7 D;  3ABV C;  1IFP A;  2A45 H;  5AVY B;  2AEF A;  1R8E A;  2NZ2 A;  1ZXG A;  4H13 D;  2JWD A;  1KOR A;  2XSO A;  4HH2 A;  1DEB A;  1G2C B;  1LTA C;  2C9L Y;  2BCC J;  4U3F J;  2WWW A;  3CCE P;  3RL0 D;  5BVZ A;  1PP9 D;  2E74 B;  4NBD D;  1EXI A;  5APV A;  3H1I E;  2B9B A;  1YTZ I;  4ASW A;  4KT0 J;  3AEG C;  3HUS C;  2K9J A;  1G8K B;  1NU1 G;  2YO2 A;  1N73 B;  1P84 H;  4OGQ C;  3VN0 A;  2NPS A;  2N9B A;  1AV1 A;  3MHV A;  3TF5 A;  3VCA A;  3VOP A;  2FYU D;  2G3A A;  1SQP E;  5KLI B;  1Q7Y Q;  3TNU B;  3V4Q A;  1NDO A;  1RQU A;  2WSF J;  3AEB C;  4QDD A;  2OQQ A;  3U1C A;  3DQY A;  4K35 A;  3B4S A;  3E1R A;  5TJH A;  2XSH A;  5BU8 B;  4I1L A;  3JC2 2;  2N1T A;  1N73 A;  4RKU J;  1KMI Z;  3KZI H;  1SVF A;  4JPZ B;  3GCE A;  2OYO A;  2O01 H;  3H32 A;  1BDC A;  3CCL P;  1KN7 A;  3RBZ A;  4L76 A;  3II6 A;  2WSS H;  2OYH B;  1W2E A;  1FDO A;  3HD7 D;  1X79 B;  2WSC J;  2E76 D;  1URQ D;  3H1J D;  4W80 A;  3VMI D;  1IFI A;  1L0N K;  2YKQ A;  3BCC G;  3A0H E;  1BE3 E;  5AW9 B;  2QJP C;  1EZV G;  1O7M A;  2E42 A;  2R44 A;  5KLV E;  2E43 A;  3TDK A;  4BRY A;  3N0Q A;  1RFS A;  4O9B A;  2BMR A;  3LW5 J;  2KK7 A;  1SQB D;  1BE3 D;  1JY2 P;  1SQX K;  3CCV P;  3O6Q B;  4IFM A;  5KJ7 A;  5TIS E;  3RL0 g;  3CWB J;  3H1J E;  4AQR D;  1FOS F;  1NTK J;  1SLQ A;  3MTU E;  3LW5 H;  1Q82 Q;  3PJS K;  1J1E C;  1WRG A;  1FBM A;  4A7P A;  3NMD A;  3L75 G;  1CW5 A;  1FE6 A;  4H0L C;  2KNC A;  1VQO P;  5AVX B;  3RK2 B;  1N7S C;  2KS1 A;  3H25 A;  3CMA P;  3HD7 C;  5H2F E;  2O01 J;  1SQQ J;  5GTH E;  1YQ4 C;  3EFG A;  1NU1 D;  1G2C A;  4I7Z B;  3HUS B;  2BAS A;  5KAF H;  4LGD E;  2WVR A;  4QUR A;  4N78 D;  1LTI C;  3HD7 A;  1ZR4 A;  2NUM A;  1OMI A;  1SFC C;  2IBZ G;  1UII A;  3SFD C;  1P84 E;  2HR3 A;  1L0L K;  2BMO A;  1ZP0 C;  3G6E P;  2XRX A;  2OTK E;  5KAF E;  2ZT9 B;  1U7M A;  3L74 E;  2NVG A;  4PV1 D;  4KJM A;  3Q2Y A;  1GD2 E;  5KLV D;  1Q90 D;  1UIX A;  2NWF A;  2WTY A;  3MD0 A;  3FXD A;  1K9M Q;  1L2P A;  4HB1 A;  1SP4 A;  3AE6 C;  2WQY C;  2E5T A;  1O7N A;  2GA1 A;  1M8O B;  3RK2 D;  2OYI B;  3W68 A;  1J1D C;  1ZN5 A;  1N7L A;  3H1K D;  3VMA A; 
#chains in the Genus database with same CATH homology
 2IBZ E;  2QPZ A;  4NBG D;  3GOB A;  3VCA A;  2XR8 A;  1SQV E;  1O7H A;  2BCC E;  3FOU A;  1SQP E;  2FYN C;  2GBX A;  5HL4 A;  4QDC A;  2HMK A;  1SJG A;  2HMN A;  2YFI A;  1NDO A;  2E4Q A;  1O7W A;  4HM8 A;  5AEW A;  3GKE A;  5KKZ C;  4QDD A;  4NBH D;  1SQX E;  1G8J B;  4EMJ B;  1NU1 E;  3DQY A;  1NTM E;  3GL2 A;  1SQB E;  4PD4 E;  1O7P A;  3L73 E;  4QUP A;  2BMQ A;  4QCK A;  5CXM A;  4QDF B;  3GZY A;  2XSH A;  4NBF D;  1PPJ E;  2NUK A;  4NBB D;  3C0D A;  4NBC D;  2DE7 D;  1Q90 C;  5BOK A;  4HM7 A;  2YFL A;  4HM5 A;  3VMH D;  4OGQ D;  2DE6 D;  1L0N E;  2YIU C;  3GCE A;  4QUR A;  1KYO E;  1KB9 E;  1VF5 D;  1NYK A;  4H44 D;  1PP9 E;  4HJL A;  2ZT9 D;  4HM3 A;  3CXH E;  4NBA D;  2NUM A;  4HM6 A;  2FYU E;  2B1X A;  4NB8 D;  1BCC E;  3GZX A;  2HMO A;  2I7F A;  1NTK E;  3GTE A;  3GB4 A;  3GL0 A;  1P84 E;  1VM9 A;  2YVJ B;  2DE5 D;  2GBW A;  2E76 D;  3H1H E;  2HMM A;  2BMO A;  3GTS A;  3L70 E;  4H13 D;  5KLI C;  4AIV A;  3L72 E;  2Q3W A;  2QJK C;  1SQQ E;  2JZA A;  4P1C H;  2XSO A;  3CX5 E;  2HML A;  3VMI D;  2XRX A;  1ULJ A;  1L0L E;  4HM2 A;  4U3F E;  1BE3 E;  3L74 E;  2NVG A;  4PV1 D;  2QJP C;  4HKV A;  1WQL A;  2JO6 A;  3VCP A;  2A06 E;  1NTZ E;  1O7M A;  3EN1 A;  5KLV E;  1FQT A;  3L75 E;  2E74 D;  2NWF A;  2E75 D;  1JM1 A;  3N0Q A;  5AEU A;  3AZC A;  2CKF A;  4NBE D;  4NBD D;  1EZV E;  1EG9 A;  4HM1 A;  3VMG D;  1VCK A;  1RFS A;  2BMR A;  4HM0 A;  4D6T E;  3TGU E;  1O7G A;  1UUV A;  3H1I E;  4QDF A;  3D89 A;  2YFJ A;  1RIE A;  2HMJ A;  2QJY C;  3EQQ A;  2E4P A;  1ZRT E;  4NB9 D;  2B24 A;  1G8K B;  1O7N A;  3CWB E;  2NVF A;  4H0L D;  3BCC E;  1ULI A;  4AAY B;  1BGY E;  2NVE A;  3H1J E;  1UUW A;  3H1K E;  2ZYL A;  2D2C D;  4QUQ A;  4HM4 A;  4P1B H;  3H1L E;  3L71 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...