1KB9E

Yeast cytochrome bc1 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 47
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1kb9E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1kb9E02
1O7HA 2QJKC 4NB8D 3H1HE 4QUPA 4NBGD 3L74E 5CXMA 3TGUE 3H1KE 3L71E 2GBXA 1SQPE 3DQYA 3N0QA 2YFJA 4AAYB 2YVJB 3GTEA 2E4QA 2NUKA 2NVEA 4EMJB 4D6TE 4H13D 3VCAA 1P84E 1EG9A 2E4PA 2E74D 2FYNC 5BOKA 5HL4A 3CXHE 3L70E 1FQTA 2BMOA 2D2CD 2ZYLA 2ZT9D 2A06E 4QURA 4NBCD 1SQQE 2XSHA 2HMNA 1O7GA 2DE5D 1SQVE 1SJGA 4HM0A 5KKZC 1NTKE 3GTSA 4NBFD 2HMLA 4P1BH 3GL0A 2IBZE 2XR8A 1O7PA 1VF5D 1NYKA 3L75E 2QJPC 1Q90C 4NBHD 1VM9A 2I7FA 2BCCE 1ULJA 3VCPA 1BGYE 4QCKA 3GKEA 4HM1A 4QDCA 2CKFA 2NUMA 2B1XA 2XRXA 2YFIA 4NBAD 2E75D 4HM8A 4HM7A 4QUQA 3GZYA 4QDDA 2HMKA 4HKVA 3GL2A 1BE3E 1G8KB 1RIEA 1O7NA 2JZAA 1ULIA 1L0LE 5KLIC 1O7WA 4HM2A 5AEUA 3VMID 1EZVE 1UUWA 3GCEA 1ZRTE 4NBBD 1O7MA 1KB9E 3H1JE 1PPJE 2B24A 3D89A 4P1CH 4HM5A 3BCCE 3CWBE 2DE6D 3CX5E 4U3FE 1RFSA 4PD4E 3GOBA 4PV1D 1NTME 1BCCE 1SQXE 4HM4A 2NVFA 4HM3A 1PP9E 2FYUE 3H1IE 1UUVA 2GBWA 4AIVA 2Q3WA 2BMQA 1VCKA 2YIUC 3VMGD 2DE7D 2NWFA 4NBED 1SQBE 3GZXA 2HMJA 4QDFB 1NDOA 3AZCA 2HMMA 3GB4A 1WQLA 1L0NE 2QPZA 3EQQA 4NB9D 2QJYC 1NU1E 3EN1A 4QDFA 2E76D 2XSOA 4HJLA 3L72E 3L73E 1NTZE 2YFLA 3FOUA 4HM6A 3H1LE 5KLVE 1G8JB 5AEWA 2JO6A 4H0LD 1JM1A 2HMOA 3C0DA 4NBDD 3VMHD 4H44D 4OGQD 1KYOE 2BMRA 2NVGA
chains in the Genus database with same CATH superfamily
4U3FD 3N0QA 2NUKA 1PZQA 1HH0A 2LXCB 4EI2A 4WY4C 3L73J 1BCCG 1SQXG 1LTJA 2XU6A 4GDOA 1NTKE 4PV1C 1LT1A 1N7SD 2B87B 3GL0A 2IBZE 3L74D 1ULJA 3VCPA 2B87A 3TGUD 1ZXGA 2OQQA 5APYA 1OVVA 2NUMA 2XRXA 2P1JA 4NBAD 5KJ7A 3CX5H 3U59A 1LTIC 1QEXA 1VL2A 1IFIA 1NOHA 2W6BA 2K9JB 1L0LE 3L70D 1YYCA 4H13B 1N2DC 3AEAC 1NTZK 1EZVE 1QL2A 1SQVJ 2K9JA 3A5TA 4W7ZA 4HM5A 2H88C 2PRRA 5AVSB 4XFJA 1KB9H 2Y9ZA 2FYUE 1FS0E 1H89A 1NTKG 2NWFA 1MFZA 2ZFCA 1WQLA 2QJYC 1QX8A 1KQFB 3HUSB 4HJLA 3L72E 2Q6QA 4KJMA 1SP4A 3P8CD 1S5LE 3CWBJ 2BMRA 4I1LA 3GHGB 1JEKA 4OH8B 1L0LG 1YBKA 2DW3A 3CMEP 1NTMD 1R5SA 3L71E 1VQPP 1YI2P 2E75B 3TSIA 4TLFA 3N4XA 4Y99C 2YO2A 2E4PA 2WSEJ 5AVWB 2D2CD 2P7JA 1VQ5P 3G4SP 4BXLA 5KLVD 3M0DA 1JNMA 2FYUG 3H32B 1DIPA 1IK7A 3V2RA 4WBAA 1SQPG 3H32A 4ZNCA 1M7LA 3EFGA 3L72G 2BCCE 1BGYE 1D7MA 5M1BA 1MKMA 4QUQA 1FZGA 3HTKB 4EYYQ 3L71G 1SLQA 1T2KC 4Y28J 3D70A 2HG5D 4U3FE 3Q5SA 2H43A 1ZOYC 1Q81Q 3IN6A 4UB6E 5CCGA 2GBWA 3HD7C 1CW5A 1SQPK 1HBWA 2HMJA 2YMYA 4L74A 2MJZA 3RL0C 3H1JG 4AYCA 2BCCG 1BGYG 3CLQA 2JO6A 2GA1A 1SQQK 3B5NB 3BASA 3ZDMA 3GL2A 1ZN5A 5AVRB 3B5NA 1KMIZ 3A2AA 2YXRB 3L74E 3Q5PA 1FC2C 3TGUE 2JEEA 4C7NB 1PP9J 3FWNA 3KDPB 3H1ID 3AE2C 4C7NA 3AE8C 4L75A 3LW5H 4U3FG 3LIEA 5B5EE 3L70E 1LTGC 2ZYLA 2HMNA 3FWLA 2I1JA 2FKWB 5DJTB 2JWDA 2M3EA 3I5CA 2C0XA 1BSHA 1YTZT 2IX7C 1IFDA 1AV1A 4IL6X 2JJLA 3WUTA 1VF5D 1VQKP 3JCUE 2W90A 1AA0A 1LTJC 2RMZA 2QM8A 1X8YA 2ZVOB 3NXSA 4EIJA 1RF1B 3RK3D 4HM7A 4N6JA 4HKVA 1URQD 1RIEA 4QMAA 2E76B 1OFCX 1K9MQ 3L74G 1PL5A 2OYIB 2O01J 5KJ7C 1GD2E 3P8CE 3AE5C 2B24A 2OYIA 1L4AD 1JM0A 2B89A 3C8VA 3M9HA 3L70G 1NTME 2ZXXA 1SFCD 4H13C 2XV5A 2Q3WA 1WMKA 5AVTB 1VCKA 2BMQA 1OWAA 2OTKE 5AVXB 3AZCA 3O6QB 2W6JH 5KLVE 1NU1J 3KPEA 3O6QA 4H0LD 2E5TA 1SQVK 4EOTA 4NBDD 1NO4A 1FDIA 2NPSD 1JCCA 1O7HA 5B5EH 4NB8D 3SWYA 5CXMA 2JO1A 2J58A 4EMJB 3D71A 4L73A 1L0NJ 3AE1C 2SPZA 1HJBA 5APTA 4GKGA 1NTZD 3H1LJ 3IR9A 3AE3C 2PP6A 5APXA 4K3AA 1K05A 1U7MA 2V7QJ 4JQ0D 1FZEA 1Q90C 3M0DC 5CJ4A 5KLVG 3CC7P 1IFNA 3H6PA 1ZP0C 4AUWA 1G8KB 4I7ZB 5C39A 1O7NA 2JDIH 1FZAA 5AW7B 4O9BA 1RFSA 1EXJA 1HF9A 1KZUB 1GW3A 1PGQA 4IFMA 1GK6A 2ZAEB 4HM3A 2C9NY 3H1IE 4AIVA 2R5DA 1Y47A 3V2QA 1NJIQ 1GW4A 1BE3D 1GU4A 5CCGC 4W7YA 3WMM0 1FAVA 3EQ2A 1YIJP 4I2LC 3C0DA 4KHXA 1VQ9P 1G1IA 2W83C 3A0BE 1X9VA 3LIDA 1CI6A 3HE4B 4M3LA 4PD4I 4BRYB 3RGUA 3HE4A 3RK3E 1ZV8A 1SQBJ 3VP9A 4TT3H 4XA4A 1T3JA 3B5NC 3M9QA 4BRYA 1S5LX 3V6IA 1W2EA 4LC1A 1U7JA 1FQTA 3C1LA 4Y99B 1JMMA 2N1TD 1JO5A 3H1IG 1LTBC 3Q1MA 2HYNA 1FZCB 4RJTA 2R5BA 2ZVNB 3CCLP 3H1HD 1M1KQ 4IL6E 1FZCA 2K3RA 1HGZA 1SQPD 2CKFA 4D6TJ 1EDJA 2JZAA 1P84I 5AW4B 3MD0A 1JY2O 2MKVA 3L35A 3VMID 1SQQD 3GCEA 3I56P 4NBBD 4H44B 1G2CB 1VQOP 1KN7A 1G2CA 2HLOA 2NVFA 1VF5B 5AW8B 3L36A 2OYIC 4QDFB 1NDOA 1YTZI 3A0BH 4NB9D 4QDFA 1GL2B 5BU8B 1NTZE 3Q3DA 2LXBA 3M06A 2KI7B 5EFWB 1GL2A 3RL0B 1CSBA 1JM1A 2Y9YA 3VMHD 3H1JD 5L8RJ 2KP8A 2CPBA 1S72P 1S2EA 3AE6C 1L4AB 4LLHA 4DT0A 2K1AA 1L4AA 2WSFH 4RESB 2YVJB 4AAYB 1GDTA 3CCSP 5AVUB 1FZBA 4IL6H 3L73D 2KB7P 2XSHA 3BRTB 3WU2E 2WMMA 3R4YA 3HE5B 2Q9IA 1YQ4C 1NU1K 2ZYAA 3VYIA 2HMLA 3M0AA 4H0LB 2IZ1A 3HE5A 1KYOI 5AVZB 5B66E 1GZLA 4ZKUA 1NTZG 1Q82Q 2JR8A 1NYHA 3LW5J 1LTSC 2YFIA 1LTJB 1BE3E 4JPZB 1Q2NA 1VDFA 1L0NK 4YXDC 3KQGA 1E5WA 4GOEA 3H25A 3CXHI 3KZIE 2YIUB 1SQVD 4GODA 3AE9C 3EFFK 3L75J 4I7ZC 1FE6A 3KXDA 3KHUA 1VQMP 3EWKA 2VRSA 2D2CC 3ITKA 2QSIA 3CC2P 2ZYDA 3PLNA 2ZT9B 3FOUA 2JKVA 4HM6A 1KILE 5AW1B 1PGPA 3BCCJ 3CWBD 1KB9I 1BE3G 3II6A 3VN0A 5GTIE 3H1HE 1SQBG 2GBXA 3WU2H 1SQPE 2WSCH 4NPDA 3TYYA 3OA7A 1AVOA 3VCAA 3D6YA 3AEGC 2BMOA 1SQQE 4HM0A 3GTSA 2FFDB 3USSA 1OW7A 4HB1A 2WT7B 2FFDA 3OJAB 4WY4D 4YXWH 5BVZA 1VM9A 3H1KJ 4UB8E 4D6TG 3KZIH 2WT7A 3G71P 1OX3A 3GKEA 2O1JA 1FJKA 2KZIA 3B71A 1DD4A 4YTPC 3GZYA 4QDDA 1SQBK 3G3ZA 1ZLLA 1FZCC 3H1HG 5KLIC 1QVFO 1M57D 3H1JE 2N1TB 1KILB 3U1AA 1JY2P 2G8YA 2R3SA 2N1TA 1KILA 4ASWA 1YHQP 4WWIA 4HM4A 1T3UA 1SQQG 2A45G 1LJ2A 3Q2YA 3NTNA 3VMYA 4NBED 4H44C 4C7RA 3TNUB 2POHA 3V5BA 5GTIH 2QJKB 1M1JB 2E74B 1LTAC 3TNUA 4Z1MH 3L73E 1H88A 2PAJA 1M1JA 2A45I 2IFMA 1A02F 1AQTA 1VF5C 2Q1KA 1NWQA 5APQA 5AVQB 3FXEA 1W2BO 1S5LH 4PD4D 1GL2C 2P2UA 3I55P 1PP9D 1S9KD 3CL3D 3NFQA 1T8ZA 1YJ9P 3JSVC 3UIAA 1QLED 1AJYA 5HL4A 1L4AC 4QURA 1H8AA 2BEQD 2IPPA 1SQVE 1RE4A 1WRGA 4YPCA 2WPSA 5CCHD 2Z4EA 1ZMEC 1JMBA 2K37A 3V4QA 3L73G 2WZ7A 5AW2B 2R3CA 3AE7C 1AFOA 3VMXA 2RH0A 2W6AA 1RF0A 1P84D 4H0LC 1KQSO 3L37A 4MN4C 1NHLA 1NGMB 2A06D 5AW0B 1NKNA 2OYHC 2AXTE 4P1CH 1OW6A 1KQLA 3CWBE 1RE3A 3GG2A 1AVYA 1JOCA 4GT1A 3C9IA 1OVUA 1SQVG 1T2KD 2YIUC 5H2FE 3VMGD 2QG4A 2KK7A 2HFED 4UB6H 4IFFA 2R44A 1KD1Q 1JY2N 1G8JB 1NAYA 1N8RQ 2B88A 1OMIA 1NU1D 3MZWB 1J1DB 1N7SB 3JC22 4OGQD 2GM4A 1XTCC 2FYNB 1N7SA 4BWNA 3G9RA 4HJGH 2UWJE 2OTLP 4NBGD 2ZYGA 3VP8A 2ZT9C 1IFJA 3GF3A 1JB0J 4NPFX 1YJNP 4XE5B 1YQ3C 2WSSH 1DEEG 2NVEA 2O3JA 3CWBG 2H89C 1R5LA 3G6EP 1L0ND 1N7LA 4NBCD 3H1LD 3PH0A 4HYTB 2JP3A 3GW6A 2M3BA 1KYOD 3VTPC 1NYKA 3WUUA 1E79H 2H7HA 1GMJA 4QCKA 2K88A 2AXTH 3JCUH 2AEFA 4RKUJ 2Q5UA 2FFDC 2HMKA 3M91A 3CXHD 3CCMP 5DJUB 5BU5A 1Q7YQ 1USEA 5H2FH 2KIKA 2V4HA 2KLVA 1LNQA 3D89A 3BVHA 2WSEH 2KXPB 3E7KA 4PD4E 2AEJA 3K5BA 1S4XA 2M5AB 1PP9E 1S9KE 2K9YA 5E79E 1HJ0A 2HODB 1HWTC 2M5AA 3GZXA 2N1TC 1KILC 1EXIA 2HODA 3EQQA 2D2CB 2NRGA 2WQYC 2Q7CA 1NH4A 3V2PA 2FXMA 1KB9D 2BEZF 2QJKC 1M1JC 2E74C 4R4LA 1BCCJ 1SQXJ 2BASA 3MHVA 1S1CX 3RBXA 2E4QA 1AQ5A 1SQBD 1YJWP 1P84E 3E1IA 3CCQP 2P58A 2A06E 1Q86Q 1DH3A 1VQ8P 3A7OA 1CI6B 3W68A 1PP9G 3ABVC 2WSCJ 1W5CE 2XR8A 3U1CA 1Y9BA 2YKPA 5APUA 3OAKA 1RE4C 1UIXA 1Y8AA 3AEEC 3GF7A 2E75D 2Z5IA 1FDMA 1X79B 5CJ0A 4D6TD 1MV8A 1PV3A 4PD4H 3MP7B 1FOSE 4HM2A 3IFMA 1JCDA 5E79H 1NTKJ 5KLIB 1RF0C 3RK2D 3SWFA 1TU3F 2KOGA 3W67A 4ASVA 3CPWO 1N73B 2A06G 2FYZA 3T97B 1RE3C 1N73A 5CCHA 1IO4A 3T97A 2IZ0A 3GB4A 3L4FA 1L0NE 2QPZA 2GUSA 1KTMA 2KSJA 2N9BA 1L0LJ 4DCKA 1Z56A 4HH2A 4DJGA 1LGHB 3H1LE 5CMZA 4PJ0E 1PGJA 3AECC 1KYOE 2CK3H 1P84H 1USDA 4C46A 1RQVA 1MZ9A 3E1RA 3R2PA 5KKZB 2FYUJ 1NU1G 3RK3B 1J1DC 1N7SC 1URQB 1EG9A 3PTZA 2QJPB 2FYNC 4RO0A 3CXHE 3L72J 1URQA 2XKMA 1EDLA 2DE5D 1SJGA 3B4SA 2Y0EA 3BRVB 4CPGA 4P1BH 1L0NG 2E43A 1SFCB 2OTJP 3L71J 4JBZA 3H1LG 1NVOA 1SFCA 4HM8A 2JWAA 1RY3A 2FXPA 1IFMA 1CZQA 1H0TA 1KFNA 1KB9E 3MIWA 2NPSB 1OVRA 2ZXEB 3P7KA 2QVAA 2OYHB 1VQ4P 2NPSA 4ZKPA 3GOBA 3L75D 2BCCJ 1BGYJ 2OYHA 4PJ0H 1FJPA 1KYOH 1SQBE 2V7QH 5AW6B 3CCUP 1RH5B 2E76D 2Y0DA 4OVNF 2RKLA 3B8EB 1UIIA 3BCCD 4U3FJ 3BATA 3CXHH 3CX5I 1VQLP 3S1KA 3P32A 4K35A 1DD3A 2KSEA 1XTGB 2WVRA 1FZFA 4D6TE 1JY3O 2YMKA 2WITA 1R8EA 1J2JB 1M56D 3L74J 3AEFC 3VMAA 4JYBA 3TGUJ 4DOJA 3OW2O 2I7FA 3H1KD 4IFDK 2QIWA 1SQXK 4QDCA 5B66H 2OARA 4KT0J 1FDOA 3L70J 1O7WA 3TK1A 3VOPA 2IBZG 2LKMA 1RQUA 3SWKA 3GMAA 3PP5A 2DE6D 3HUSA 2W8ZA 3IF4A 2QM7A 5AVVB 4IOIH 4PV1D 1WT6A 2IBZI 1M8OB 3SFEC 1OW8A 1U57A 2YXQB 2XZRA 2Q3IA 3GHGA 2IDBA 1EZVG 2IYOA 2NZ2A 1N73C 5CCHC 1EDKA 1EZVI 1NTKK 1PPJD 3WUVA 4HKZH 1IZNB 5KAFE 2Q3EA 1DX7A 1SS1A 3CD6P 3RK2B 1NTMJ 3D6ZA 1RHZB 5CBNA 5BOKA 1BDDA 1L0LK 5KLVJ 4R4MA 5KKZC 4N78D 2Y0CA 3V2NA 1EC5A 3RK3C 4DZOA 1BDCA 2YKQA 2QEXP 3HTKA 3TF5A 2A45H 2WWWA 1OIPA 1GK4A 1URQC 3QH9A 2QJPC 3L75E 5KAIE 4NBHD 3GLMA 2M0BA 3Q5RA 2WPVB 2B1XA 2FYUK 4UB8H 3CCEP 1X0TA 4OGQC 1SFCC 2QRXA 2HPCB 1FOSF 3MUDC 3TDKA 5CBOA 2HPCA 3BCCE 1LWUB 1VQ7P 3CCVP 1ZW0A 1OXZA 1LWUA 1DEBA 1LT9B 2H8PD 2E5YA 3SSUA 3HRNA 4ZMDA 3S9OA 1LT9A 2KS1B 1PFIA 5KAFH 2NPSC 2J5UA 2KS1A 5TJHA 3L75G 1L2PA 1QGKB 1ZRTD 5AW9B 4H44D 4AQRD 1IC2A 4I6MC 5GTHE 5CHXA 2FXOA 1YITP 1J1EB 3H1KE 4LGDE 3DQYA 3H1IJ 3RL0g 1K04A 2HR3A 4EDFA 5APWA 2L5GB 2I1KA 3BCCG 1K73Q 2WTYA 2OGUA 2XDJA 4OWFA 5KAIH 1A02J 3HD7D 1GL2D 1RF1A 2N9YB 2XNXA 1M90Q 2KLUA 1JY3P 2ZJSE 3RL0D 3TGUG 2C0WA 3MGNA 2XNDH 1PIXA 3S4RA 2KUBA 1BSNA 2RN0A 2J59M 1G1JA 1HGVA 2FY8A 3AEBC 3CCJP 1JTHB 2WPRA 1IK9A 2P10A 3H1KG 1JTHA 3FX0A 2WSFJ 2O01N 2AXCA 1HUCA 1PPJE 1OZHA 2FBWC 3O8ZA 1LP1B 3M9BA 4N3YB 1LP1A 1UUVA 3HUSC 3N7NA 3RBZA 1KFMA 1N86A 4GOFA 5GTHH 2AEMA 3IAOA 3NMDA 5APVA 2E42A 3V4WA 3GHGC 4N78E 2HMOA 1NTMG 1GTWA 3CX5D 3A3YB 2I8DA 4WY4B 5KJ7D 2E75C 4B86A 2R32A 1BCCD 1SQXD 4WY4A 1FBMA 2YFJA 4PV1B 3GTEA 1VQNP 1PPJG 1SVFA 3FGAD 2ITAA 4H13D 2WPQA 5AVYB 4JYCA 3PHLA 1T6AA 3RK2C 1NTZJ 2ZT9D 2QE7H 5K5GB 2KNCB 1MFTA 1KQGB 3CMAP 1O7PA 2KNCA 4HM1A 1NTMK 5TISE 3QWOC 3A0HE 4JF7A 2PFXA 1JY3N 1ULIA 1NKZB 1UUWA 2O1KA 4NPEA 1ZRTE 5KLVK 1NTKD 1O7MA 2B9BA 2QJYB 2QA4P 2IBZD 5AW5B 1HVVA 2OYOA 1JUNA 3CCRP 3F89A 1PGOA 1ZR4A 4W80A 2DE7D 5AW3B 1Q90D 1NAFA 2G3AA 1BE3J 1LWUC 2W27A 1NU1E 2XSOA 3SFDC 1L0LD 2IFNA 3AEDC 2L91A 2YFLA 2CPSA 1LT9C 2IYPA 5AEWA 3P8MC 4L76A 1EZVD 4U7JA 1QVGO 1KILD 2NVGA 4A7PA 1LTTC 1S3JA 4QUPA 2LR2A 2KYVA 1QL1A 2YNYA 2FYUD 1EDIA 1GU5A 2E74D 3MTUE 3L72D 1EQ7A 1J1EC 3FXDA 1X22A 2YO3A 2YKOA 5TISH 1O7GA 4GIFA 4NBFD 3PJSK 5CCGD 3A0HH 2O01H 3AE4C 3H1HJ 1RF1C 1KORA 3PRJA 1KC8Q 1SQPJ 2GUVA 3L71D 3VMZA 2E76C 2Z5HA 1MUUA 1FU1A 1VPCA 3CC4P 1KV4A 5KTBA 1K8AQ 5AEUA 2P67A 3B5ND 1SQQJ 1VQ6P 2PGDA 3HD7B 2KZJA 4OGQB 3CX5E 3HD7A 2C9LY 3KYQA 3F5HA 1BCCE 1SQXE 2BCCD 1BGYD 3MUDA 4WVZA 1H0TB 3CI9A 2HMMA 1HTLC 3EN1A 5APSA 4WB4A 1ZR2A 1IJDB 1IFPA 3H1JJ 2M8RA
chains in the Genus database with same CATH topology
1O7HA 2QJKC 4NB8D 3H1HE 4QUPA 4NBGD 3L74E 5CXMA 3TGUE 3H1KE 3L71E 2GBXA 1SQPE 3DQYA 3N0QA 2YFJA 4AAYB 2YVJB 3GTEA 2E4QA 2NUKA 2NVEA 4EMJB 4D6TE 4H13D 3VCAA 1P84E 1EG9A 2E4PA 2E74D 2FYNC 5BOKA 5HL4A 3CXHE 3L70E 1FQTA 2BMOA 2D2CD 2ZYLA 2ZT9D 2A06E 4QURA 4NBCD 1SQQE 2XSHA 2HMNA 1O7GA 2DE5D 1SQVE 1SJGA 4HM0A 5KKZC 1NTKE 3GTSA 4NBFD 2HMLA 4P1BH 3GL0A 2IBZE 2XR8A 1O7PA 1VF5D 1NYKA 3L75E 2QJPC 1Q90C 4NBHD 1VM9A 2I7FA 2BCCE 1ULJA 3VCPA 1BGYE 4QCKA 3GKEA 4HM1A 4QDCA 2CKFA 2NUMA 2B1XA 2XRXA 2YFIA 4NBAD 2E75D 4HM8A 4HM7A 4QUQA 3GZYA 4QDDA 2HMKA 4HKVA 3GL2A 1BE3E 1G8KB 1RIEA 1O7NA 2JZAA 1ULIA 1L0LE 5KLIC 1O7WA 4HM2A 5AEUA 3VMID 1EZVE 1UUWA 3GCEA 1ZRTE 4NBBD 1O7MA 1KB9E 3H1JE 1PPJE 2B24A 3D89A 4P1CH 4HM5A 3BCCE 3CWBE 2DE6D 3CX5E 4U3FE 1RFSA 4PD4E 3GOBA 4PV1D 1NTME 1BCCE 1SQXE 4HM4A 2NVFA 4HM3A 1PP9E 2FYUE 3H1IE 1UUVA 2GBWA 4AIVA 2Q3WA 2BMQA 1VCKA 2YIUC 3VMGD 2DE7D 2NWFA 4NBED 1SQBE 3GZXA 2HMJA 4QDFB 1NDOA 3AZCA 2HMMA 3GB4A 1WQLA 1L0NE 2QPZA 3EQQA 4NB9D 2QJYC 1NU1E 3EN1A 4QDFA 2E76D 2XSOA 4HJLA 3L72E 3L73E 1NTZE 2YFLA 3FOUA 4HM6A 3H1LE 5KLVE 1G8JB 5AEWA 2JO6A 4H0LD 1JM1A 2HMOA 3C0DA 4NBDD 3VMHD 4H44D 4OGQD 1KYOE 2BMRA 2NVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7H A;  2QJK C;  4NB8 D;  3H1H E;  4QUP A;  4NBG D;  3L74 E;  5CXM A;  3TGU E;  3H1K E;  3L71 E;  2GBX A;  1SQP E;  3DQY A;  3N0Q A;  2YFJ A;  4AAY B;  2YVJ B;  3GTE A;  2E4Q A;  2NUK A;  2NVE A;  4EMJ B;  4D6T E;  4H13 D;  3VCA A;  1P84 E;  1EG9 A;  2E4P A;  2E74 D;  2FYN C;  5BOK A;  5HL4 A;  3CXH E;  3L70 E;  1FQT A;  2BMO A;  2D2C D;  2ZYL A;  2ZT9 D;  2A06 E;  4QUR A;  4NBC D;  1SQQ E;  2XSH A;  2HMN A;  1O7G A;  2DE5 D;  1SQV E;  1SJG A;  4HM0 A;  5KKZ C;  1NTK E;  3GTS A;  4NBF D;  2HML A;  4P1B H;  3GL0 A;  2IBZ E;  2XR8 A;  1O7P A;  1VF5 D;  1NYK A;  3L75 E;  2QJP C;  1Q90 C;  4NBH D;  1VM9 A;  2I7F A;  2BCC E;  1ULJ A;  3VCP A;  1BGY E;  4QCK A;  3GKE A;  4HM1 A;  4QDC A;  2CKF A;  2NUM A;  2B1X A;  2XRX A;  2YFI A;  4NBA D;  2E75 D;  4HM8 A;  4HM7 A;  4QUQ A;  3GZY A;  4QDD A;  2HMK A;  4HKV A;  3GL2 A;  1BE3 E;  1G8K B;  1RIE A;  1O7N A;  2JZA A;  1ULI A;  1L0L E;  5KLI C;  1O7W A;  4HM2 A;  5AEU A;  3VMI D;  1EZV E;  1UUW A;  3GCE A;  1ZRT E;  4NBB D;  1O7M A;  1KB9 E;  3H1J E;  1PPJ E;  2B24 A;  3D89 A;  4P1C H;  4HM5 A;  3BCC E;  3CWB E;  2DE6 D;  3CX5 E;  4U3F E;  1RFS A;  4PD4 E;  3GOB A;  4PV1 D;  1NTM E;  1BCC E;  1SQX E;  4HM4 A;  2NVF A;  4HM3 A;  1PP9 E;  2FYU E;  3H1I E;  1UUV A;  2GBW A;  4AIV A;  2Q3W A;  2BMQ A;  1VCK A;  2YIU C;  3VMG D;  2DE7 D;  2NWF A;  4NBE D;  1SQB E;  3GZX A;  2HMJ A;  4QDF B;  1NDO A;  3AZC A;  2HMM A;  3GB4 A;  1WQL A;  1L0N E;  2QPZ A;  3EQQ A;  4NB9 D;  2QJY C;  1NU1 E;  3EN1 A;  4QDF A;  2E76 D;  2XSO A;  4HJL A;  3L72 E;  3L73 E;  1NTZ E;  2YFL A;  3FOU A;  4HM6 A;  3H1L E;  5KLV E;  1G8J B;  5AEW A;  2JO6 A;  4H0L D;  1JM1 A;  2HMO A;  3C0D A;  4NBD D;  3VMH D;  4H44 D;  4OGQ D;  1KYO E;  2BMR A;  2NVG A; 
#chains in the Genus database with same CATH topology
 4U3F D;  3N0Q A;  2NUK A;  1PZQ A;  1HH0 A;  2LXC B;  4EI2 A;  4WY4 C;  3L73 J;  1BCC G;  1SQX G;  1LTJ A;  2XU6 A;  4GDO A;  1NTK E;  4PV1 C;  1LT1 A;  1N7S D;  2B87 B;  3GL0 A;  2IBZ E;  3L74 D;  1ULJ A;  3VCP A;  2B87 A;  3TGU D;  1ZXG A;  2OQQ A;  5APY A;  1OVV A;  2NUM A;  2XRX A;  2P1J A;  4NBA D;  5KJ7 A;  3CX5 H;  3U59 A;  1LTI C;  1QEX A;  1VL2 A;  1IFI A;  1NOH A;  2W6B A;  2K9J B;  1L0L E;  3L70 D;  1YYC A;  4H13 B;  1N2D C;  3AEA C;  1NTZ K;  1EZV E;  1QL2 A;  1SQV J;  2K9J A;  3A5T A;  4W7Z A;  4HM5 A;  2H88 C;  2PRR A;  5AVS B;  4XFJ A;  1KB9 H;  2Y9Z A;  2FYU E;  1FS0 E;  1H89 A;  1NTK G;  2NWF A;  1MFZ A;  2ZFC A;  1WQL A;  2QJY C;  1QX8 A;  1KQF B;  3HUS B;  4HJL A;  3L72 E;  2Q6Q A;  4KJM A;  1SP4 A;  3P8C D;  1S5L E;  3CWB J;  2BMR A;  4I1L A;  3GHG B;  1JEK A;  4OH8 B;  1L0L G;  1YBK A;  2DW3 A;  3CME P;  1NTM D;  1R5S A;  3L71 E;  1VQP P;  1YI2 P;  2E75 B;  3TSI A;  4TLF A;  3N4X A;  4Y99 C;  2YO2 A;  2E4P A;  2WSE J;  5AVW B;  2D2C D;  2P7J A;  1VQ5 P;  3G4S P;  4BXL A;  5KLV D;  3M0D A;  1JNM A;  2FYU G;  3H32 B;  1DIP A;  1IK7 A;  3V2R A;  4WBA A;  1SQP G;  3H32 A;  4ZNC A;  1M7L A;  3EFG A;  3L72 G;  2BCC E;  1BGY E;  1D7M A;  5M1B A;  1MKM A;  4QUQ A;  1FZG A;  3HTK B;  4EYY Q;  3L71 G;  1SLQ A;  1T2K C;  4Y28 J;  3D70 A;  2HG5 D;  4U3F E;  3Q5S A;  2H43 A;  1ZOY C;  1Q81 Q;  3IN6 A;  4UB6 E;  5CCG A;  2GBW A;  3HD7 C;  1CW5 A;  1SQP K;  1HBW A;  2HMJ A;  2YMY A;  4L74 A;  2MJZ A;  3RL0 C;  3H1J G;  4AYC A;  2BCC G;  1BGY G;  3CLQ A;  2JO6 A;  2GA1 A;  1SQQ K;  3B5N B;  3BAS A;  3ZDM A;  3GL2 A;  1ZN5 A;  5AVR B;  3B5N A;  1KMI Z;  3A2A A;  2YXR B;  3L74 E;  3Q5P A;  1FC2 C;  3TGU E;  2JEE A;  4C7N B;  1PP9 J;  3FWN A;  3KDP B;  3H1I D;  3AE2 C;  4C7N A;  3AE8 C;  4L75 A;  3LW5 H;  4U3F G;  3LIE A;  5B5E E;  3L70 E;  1LTG C;  2ZYL A;  2HMN A;  3FWL A;  2I1J A;  2FKW B;  5DJT B;  2JWD A;  2M3E A;  3I5C A;  2C0X A;  1BSH A;  1YTZ T;  2IX7 C;  1IFD A;  1AV1 A;  4IL6 X;  2JJL A;  3WUT A;  1VF5 D;  1VQK P;  3JCU E;  2W90 A;  1AA0 A;  1LTJ C;  2RMZ A;  2QM8 A;  1X8Y A;  2ZVO B;  3NXS A;  4EIJ A;  1RF1 B;  3RK3 D;  4HM7 A;  4N6J A;  4HKV A;  1URQ D;  1RIE A;  4QMA A;  2E76 B;  1OFC X;  1K9M Q;  3L74 G;  1PL5 A;  2OYI B;  2O01 J;  5KJ7 C;  1GD2 E;  3P8C E;  3AE5 C;  2B24 A;  2OYI A;  1L4A D;  1JM0 A;  2B89 A;  3C8V A;  3M9H A;  3L70 G;  1NTM E;  2ZXX A;  1SFC D;  4H13 C;  2XV5 A;  2Q3W A;  1WMK A;  5AVT B;  1VCK A;  2BMQ A;  1OWA A;  2OTK E;  5AVX B;  3AZC A;  3O6Q B;  2W6J H;  5KLV E;  1NU1 J;  3KPE A;  3O6Q A;  4H0L D;  2E5T A;  1SQV K;  4EOT A;  4NBD D;  1NO4 A;  1FDI A;  2NPS D;  1JCC A;  1O7H A;  5B5E H;  4NB8 D;  3SWY A;  5CXM A;  2JO1 A;  2J58 A;  4EMJ B;  3D71 A;  4L73 A;  1L0N J;  3AE1 C;  2SPZ A;  1HJB A;  5APT A;  4GKG A;  1NTZ D;  3H1L J;  3IR9 A;  3AE3 C;  2PP6 A;  5APX A;  4K3A A;  1K05 A;  1U7M A;  2V7Q J;  4JQ0 D;  1FZE A;  1Q90 C;  3M0D C;  5CJ4 A;  5KLV G;  3CC7 P;  1IFN A;  3H6P A;  1ZP0 C;  4AUW A;  1G8K B;  4I7Z B;  5C39 A;  1O7N A;  2JDI H;  1FZA A;  5AW7 B;  4O9B A;  1RFS A;  1EXJ A;  1HF9 A;  1KZU B;  1GW3 A;  1PGQ A;  4IFM A;  1GK6 A;  2ZAE B;  4HM3 A;  2C9N Y;  3H1I E;  4AIV A;  2R5D A;  1Y47 A;  3V2Q A;  1NJI Q;  1GW4 A;  1BE3 D;  1GU4 A;  5CCG C;  4W7Y A;  3WMM 0;  1FAV A;  3EQ2 A;  1YIJ P;  4I2L C;  3C0D A;  4KHX A;  1VQ9 P;  1G1I A;  2W83 C;  3A0B E;  1X9V A;  3LID A;  1CI6 A;  3HE4 B;  4M3L A;  4PD4 I;  4BRY B;  3RGU A;  3HE4 A;  3RK3 E;  1ZV8 A;  1SQB J;  3VP9 A;  4TT3 H;  4XA4 A;  1T3J A;  3B5N C;  3M9Q A;  4BRY A;  1S5L X;  3V6I A;  1W2E A;  4LC1 A;  1U7J A;  1FQT A;  3C1L A;  4Y99 B;  1JMM A;  2N1T D;  1JO5 A;  3H1I G;  1LTB C;  3Q1M A;  2HYN A;  1FZC B;  4RJT A;  2R5B A;  2ZVN B;  3CCL P;  3H1H D;  1M1K Q;  4IL6 E;  1FZC A;  2K3R A;  1HGZ A;  1SQP D;  2CKF A;  4D6T J;  1EDJ A;  2JZA A;  1P84 I;  5AW4 B;  3MD0 A;  1JY2 O;  2MKV A;  3L35 A;  3VMI D;  1SQQ D;  3GCE A;  3I56 P;  4NBB D;  4H44 B;  1G2C B;  1VQO P;  1KN7 A;  1G2C A;  2HLO A;  2NVF A;  1VF5 B;  5AW8 B;  3L36 A;  2OYI C;  4QDF B;  1NDO A;  1YTZ I;  3A0B H;  4NB9 D;  4QDF A;  1GL2 B;  5BU8 B;  1NTZ E;  3Q3D A;  2LXB A;  3M06 A;  2KI7 B;  5EFW B;  1GL2 A;  3RL0 B;  1CSB A;  1JM1 A;  2Y9Y A;  3VMH D;  3H1J D;  5L8R J;  2KP8 A;  2CPB A;  1S72 P;  1S2E A;  3AE6 C;  1L4A B;  4LLH A;  4DT0 A;  2K1A A;  1L4A A;  2WSF H;  4RES B;  2YVJ B;  4AAY B;  1GDT A;  3CCS P;  5AVU B;  1FZB A;  4IL6 H;  3L73 D;  2KB7 P;  2XSH A;  3BRT B;  3WU2 E;  2WMM A;  3R4Y A;  3HE5 B;  2Q9I A;  1YQ4 C;  1NU1 K;  2ZYA A;  3VYI A;  2HML A;  3M0A A;  4H0L B;  2IZ1 A;  3HE5 A;  1KYO I;  5AVZ B;  5B66 E;  1GZL A;  4ZKU A;  1NTZ G;  1Q82 Q;  2JR8 A;  1NYH A;  3LW5 J;  1LTS C;  2YFI A;  1LTJ B;  1BE3 E;  4JPZ B;  1Q2N A;  1VDF A;  1L0N K;  4YXD C;  3KQG A;  1E5W A;  4GOE A;  3H25 A;  3CXH I;  3KZI E;  2YIU B;  1SQV D;  4GOD A;  3AE9 C;  3EFF K;  3L75 J;  4I7Z C;  1FE6 A;  3KXD A;  3KHU A;  1VQM P;  3EWK A;  2VRS A;  2D2C C;  3ITK A;  2QSI A;  3CC2 P;  2ZYD A;  3PLN A;  2ZT9 B;  3FOU A;  2JKV A;  4HM6 A;  1KIL E;  5AW1 B;  1PGP A;  3BCC J;  3CWB D;  1KB9 I;  1BE3 G;  3II6 A;  3VN0 A;  5GTI E;  3H1H E;  1SQB G;  2GBX A;  3WU2 H;  1SQP E;  2WSC H;  4NPD A;  3TYY A;  3OA7 A;  1AVO A;  3VCA A;  3D6Y A;  3AEG C;  2BMO A;  1SQQ E;  4HM0 A;  3GTS A;  2FFD B;  3USS A;  1OW7 A;  4HB1 A;  2WT7 B;  2FFD A;  3OJA B;  4WY4 D;  4YXW H;  5BVZ A;  1VM9 A;  3H1K J;  4UB8 E;  4D6T G;  3KZI H;  2WT7 A;  3G71 P;  1OX3 A;  3GKE A;  2O1J A;  1FJK A;  2KZI A;  3B71 A;  1DD4 A;  4YTP C;  3GZY A;  4QDD A;  1SQB K;  3G3Z A;  1ZLL A;  1FZC C;  3H1H G;  5KLI C;  1QVF O;  1M57 D;  3H1J E;  2N1T B;  1KIL B;  3U1A A;  1JY2 P;  2G8Y A;  2R3S A;  2N1T A;  1KIL A;  4ASW A;  1YHQ P;  4WWI A;  4HM4 A;  1T3U A;  1SQQ G;  2A45 G;  1LJ2 A;  3Q2Y A;  3NTN A;  3VMY A;  4NBE D;  4H44 C;  4C7R A;  3TNU B;  2POH A;  3V5B A;  5GTI H;  2QJK B;  1M1J B;  2E74 B;  1LTA C;  3TNU A;  4Z1M H;  3L73 E;  1H88 A;  2PAJ A;  1M1J A;  2A45 I;  2IFM A;  1A02 F;  1AQT A;  1VF5 C;  2Q1K A;  1NWQ A;  5APQ A;  5AVQ B;  3FXE A;  1W2B O;  1S5L H;  4PD4 D;  1GL2 C;  2P2U A;  3I55 P;  1PP9 D;  1S9K D;  3CL3 D;  3NFQ A;  1T8Z A;  1YJ9 P;  3JSV C;  3UIA A;  1QLE D;  1AJY A;  5HL4 A;  1L4A C;  4QUR A;  1H8A A;  2BEQ D;  2IPP A;  1SQV E;  1RE4 A;  1WRG A;  4YPC A;  2WPS A;  5CCH D;  2Z4E A;  1ZME C;  1JMB A;  2K37 A;  3V4Q A;  3L73 G;  2WZ7 A;  5AW2 B;  2R3C A;  3AE7 C;  1AFO A;  3VMX A;  2RH0 A;  2W6A A;  1RF0 A;  1P84 D;  4H0L C;  1KQS O;  3L37 A;  4MN4 C;  1NHL A;  1NGM B;  2A06 D;  5AW0 B;  1NKN A;  2OYH C;  2AXT E;  4P1C H;  1OW6 A;  1KQL A;  3CWB E;  1RE3 A;  3GG2 A;  1AVY A;  1JOC A;  4GT1 A;  3C9I A;  1OVU A;  1SQV G;  1T2K D;  2YIU C;  5H2F E;  3VMG D;  2QG4 A;  2KK7 A;  2HFE D;  4UB6 H;  4IFF A;  2R44 A;  1KD1 Q;  1JY2 N;  1G8J B;  1NAY A;  1N8R Q;  2B88 A;  1OMI A;  1NU1 D;  3MZW B;  1J1D B;  1N7S B;  3JC2 2;  4OGQ D;  2GM4 A;  1XTC C;  2FYN B;  1N7S A;  4BWN A;  3G9R A;  4HJG H;  2UWJ E;  2OTL P;  4NBG D;  2ZYG A;  3VP8 A;  2ZT9 C;  1IFJ A;  3GF3 A;  1JB0 J;  4NPF X;  1YJN P;  4XE5 B;  1YQ3 C;  2WSS H;  1DEE G;  2NVE A;  2O3J A;  3CWB G;  2H89 C;  1R5L A;  3G6E P;  1L0N D;  1N7L A;  4NBC D;  3H1L D;  3PH0 A;  4HYT B;  2JP3 A;  3GW6 A;  2M3B A;  1KYO D;  3VTP C;  1NYK A;  3WUU A;  1E79 H;  2H7H A;  1GMJ A;  4QCK A;  2K88 A;  2AXT H;  3JCU H;  2AEF A;  4RKU J;  2Q5U A;  2FFD C;  2HMK A;  3M91 A;  3CXH D;  3CCM P;  5DJU B;  5BU5 A;  1Q7Y Q;  1USE A;  5H2F H;  2KIK A;  2V4H A;  2KLV A;  1LNQ A;  3D89 A;  3BVH A;  2WSE H;  2KXP B;  3E7K A;  4PD4 E;  2AEJ A;  3K5B A;  1S4X A;  2M5A B;  1PP9 E;  1S9K E;  2K9Y A;  5E79 E;  1HJ0 A;  2HOD B;  1HWT C;  2M5A A;  3GZX A;  2N1T C;  1KIL C;  1EXI A;  2HOD A;  3EQQ A;  2D2C B;  2NRG A;  2WQY C;  2Q7C A;  1NH4 A;  3V2P A;  2FXM A;  1KB9 D;  2BEZ F;  2QJK C;  1M1J C;  2E74 C;  4R4L A;  1BCC J;  1SQX J;  2BAS A;  3MHV A;  1S1C X;  3RBX A;  2E4Q A;  1AQ5 A;  1SQB D;  1YJW P;  1P84 E;  3E1I A;  3CCQ P;  2P58 A;  2A06 E;  1Q86 Q;  1DH3 A;  1VQ8 P;  3A7O A;  1CI6 B;  3W68 A;  1PP9 G;  3ABV C;  2WSC J;  1W5C E;  2XR8 A;  3U1C A;  1Y9B A;  2YKP A;  5APU A;  3OAK A;  1RE4 C;  1UIX A;  1Y8A A;  3AEE C;  3GF7 A;  2E75 D;  2Z5I A;  1FDM A;  1X79 B;  5CJ0 A;  4D6T D;  1MV8 A;  1PV3 A;  4PD4 H;  3MP7 B;  1FOS E;  4HM2 A;  3IFM A;  1JCD A;  5E79 H;  1NTK J;  5KLI B;  1RF0 C;  3RK2 D;  3SWF A;  1TU3 F;  2KOG A;  3W67 A;  4ASV A;  3CPW O;  1N73 B;  2A06 G;  2FYZ A;  3T97 B;  1RE3 C;  1N73 A;  5CCH A;  1IO4 A;  3T97 A;  2IZ0 A;  3GB4 A;  3L4F A;  1L0N E;  2QPZ A;  2GUS A;  1KTM A;  2KSJ A;  2N9B A;  1L0L J;  4DCK A;  1Z56 A;  4HH2 A;  4DJG A;  1LGH B;  3H1L E;  5CMZ A;  4PJ0 E;  1PGJ A;  3AEC C;  1KYO E;  2CK3 H;  1P84 H;  1USD A;  4C46 A;  1RQV A;  1MZ9 A;  3E1R A;  3R2P A;  5KKZ B;  2FYU J;  1NU1 G;  3RK3 B;  1J1D C;  1N7S C;  1URQ B;  1EG9 A;  3PTZ A;  2QJP B;  2FYN C;  4RO0 A;  3CXH E;  3L72 J;  1URQ A;  2XKM A;  1EDL A;  2DE5 D;  1SJG A;  3B4S A;  2Y0E A;  3BRV B;  4CPG A;  4P1B H;  1L0N G;  2E43 A;  1SFC B;  2OTJ P;  3L71 J;  4JBZ A;  3H1L G;  1NVO A;  1SFC A;  4HM8 A;  2JWA A;  1RY3 A;  2FXP A;  1IFM A;  1CZQ A;  1H0T A;  1KFN A;  1KB9 E;  3MIW A;  2NPS B;  1OVR A;  2ZXE B;  3P7K A;  2QVA A;  2OYH B;  1VQ4 P;  2NPS A;  4ZKP A;  3GOB A;  3L75 D;  2BCC J;  1BGY J;  2OYH A;  4PJ0 H;  1FJP A;  1KYO H;  1SQB E;  2V7Q H;  5AW6 B;  3CCU P;  1RH5 B;  2E76 D;  2Y0D A;  4OVN F;  2RKL A;  3B8E B;  1UII A;  3BCC D;  4U3F J;  3BAT A;  3CXH H;  3CX5 I;  1VQL P;  3S1K A;  3P32 A;  4K35 A;  1DD3 A;  2KSE A;  1XTG B;  2WVR A;  1FZF A;  4D6T E;  1JY3 O;  2YMK A;  2WIT A;  1R8E A;  1J2J B;  1M56 D;  3L74 J;  3AEF C;  3VMA A;  4JYB A;  3TGU J;  4DOJ A;  3OW2 O;  2I7F A;  3H1K D;  4IFD K;  2QIW A;  1SQX K;  4QDC A;  5B66 H;  2OAR A;  4KT0 J;  1FDO A;  3L70 J;  1O7W A;  3TK1 A;  3VOP A;  2IBZ G;  2LKM A;  1RQU A;  3SWK A;  3GMA A;  3PP5 A;  2DE6 D;  3HUS A;  2W8Z A;  3IF4 A;  2QM7 A;  5AVV B;  4IOI H;  4PV1 D;  1WT6 A;  2IBZ I;  1M8O B;  3SFE C;  1OW8 A;  1U57 A;  2YXQ B;  2XZR A;  2Q3I A;  3GHG A;  2IDB A;  1EZV G;  2IYO A;  2NZ2 A;  1N73 C;  5CCH C;  1EDK A;  1EZV I;  1NTK K;  1PPJ D;  3WUV A;  4HKZ H;  1IZN B;  5KAF E;  2Q3E A;  1DX7 A;  1SS1 A;  3CD6 P;  3RK2 B;  1NTM J;  3D6Z A;  1RHZ B;  5CBN A;  5BOK A;  1BDD A;  1L0L K;  5KLV J;  4R4M A;  5KKZ C;  4N78 D;  2Y0C A;  3V2N A;  1EC5 A;  3RK3 C;  4DZO A;  1BDC A;  2YKQ A;  2QEX P;  3HTK A;  3TF5 A;  2A45 H;  2WWW A;  1OIP A;  1GK4 A;  1URQ C;  3QH9 A;  2QJP C;  3L75 E;  5KAI E;  4NBH D;  3GLM A;  2M0B A;  3Q5R A;  2WPV B;  2B1X A;  2FYU K;  4UB8 H;  3CCE P;  1X0T A;  4OGQ C;  1SFC C;  2QRX A;  2HPC B;  1FOS F;  3MUD C;  3TDK A;  5CBO A;  2HPC A;  3BCC E;  1LWU B;  1VQ7 P;  3CCV P;  1ZW0 A;  1OXZ A;  1LWU A;  1DEB A;  1LT9 B;  2H8P D;  2E5Y A;  3SSU A;  3HRN A;  4ZMD A;  3S9O A;  1LT9 A;  2KS1 B;  1PFI A;  5KAF H;  2NPS C;  2J5U A;  2KS1 A;  5TJH A;  3L75 G;  1L2P A;  1QGK B;  1ZRT D;  5AW9 B;  4H44 D;  4AQR D;  1IC2 A;  4I6M C;  5GTH E;  5CHX A;  2FXO A;  1YIT P;  1J1E B;  3H1K E;  4LGD E;  3DQY A;  3H1I J;  3RL0 g;  1K04 A;  2HR3 A;  4EDF A;  5APW A;  2L5G B;  2I1K A;  3BCC G;  1K73 Q;  2WTY A;  2OGU A;  2XDJ A;  4OWF A;  5KAI H;  1A02 J;  3HD7 D;  1GL2 D;  1RF1 A;  2N9Y B;  2XNX A;  1M90 Q;  2KLU A;  1JY3 P;  2ZJS E;  3RL0 D;  3TGU G;  2C0W A;  3MGN A;  2XND H;  1PIX A;  3S4R A;  2KUB A;  1BSN A;  2RN0 A;  2J59 M;  1G1J A;  1HGV A;  2FY8 A;  3AEB C;  3CCJ P;  1JTH B;  2WPR A;  1IK9 A;  2P10 A;  3H1K G;  1JTH A;  3FX0 A;  2WSF J;  2O01 N;  2AXC A;  1HUC A;  1PPJ E;  1OZH A;  2FBW C;  3O8Z A;  1LP1 B;  3M9B A;  4N3Y B;  1LP1 A;  1UUV A;  3HUS C;  3N7N A;  3RBZ A;  1KFM A;  1N86 A;  4GOF A;  5GTH H;  2AEM A;  3IAO A;  3NMD A;  5APV A;  2E42 A;  3V4W A;  3GHG C;  4N78 E;  2HMO A;  1NTM G;  1GTW A;  3CX5 D;  3A3Y B;  2I8D A;  4WY4 B;  5KJ7 D;  2E75 C;  4B86 A;  2R32 A;  1BCC D;  1SQX D;  4WY4 A;  1FBM A;  2YFJ A;  4PV1 B;  3GTE A;  1VQN P;  1PPJ G;  1SVF A;  3FGA D;  2ITA A;  4H13 D;  2WPQ A;  5AVY B;  4JYC A;  3PHL A;  1T6A A;  3RK2 C;  1NTZ J;  2ZT9 D;  2QE7 H;  5K5G B;  2KNC B;  1MFT A;  1KQG B;  3CMA P;  1O7P A;  2KNC A;  4HM1 A;  1NTM K;  5TIS E;  3QWO C;  3A0H E;  4JF7 A;  2PFX A;  1JY3 N;  1ULI A;  1NKZ B;  1UUW A;  2O1K A;  4NPE A;  1ZRT E;  5KLV K;  1NTK D;  1O7M A;  2B9B A;  2QJY B;  2QA4 P;  2IBZ D;  5AW5 B;  1HVV A;  2OYO A;  1JUN A;  3CCR P;  3F89 A;  1PGO A;  1ZR4 A;  4W80 A;  2DE7 D;  5AW3 B;  1Q90 D;  1NAF A;  2G3A A;  1BE3 J;  1LWU C;  2W27 A;  1NU1 E;  2XSO A;  3SFD C;  1L0L D;  2IFN A;  3AED C;  2L91 A;  2YFL A;  2CPS A;  1LT9 C;  2IYP A;  5AEW A;  3P8M C;  4L76 A;  1EZV D;  4U7J A;  1QVG O;  1KIL D;  2NVG A;  4A7P A;  1LTT C;  1S3J A;  4QUP A;  2LR2 A;  2KYV A;  1QL1 A;  2YNY A;  2FYU D;  1EDI A;  1GU5 A;  2E74 D;  3MTU E;  3L72 D;  1EQ7 A;  1J1E C;  3FXD A;  1X22 A;  2YO3 A;  2YKO A;  5TIS H;  1O7G A;  4GIF A;  4NBF D;  3PJS K;  5CCG D;  3A0H H;  2O01 H;  3AE4 C;  3H1H J;  1RF1 C;  1KOR A;  3PRJ A;  1KC8 Q;  1SQP J;  2GUV A;  3L71 D;  3VMZ A;  2E76 C;  2Z5H A;  1MUU A;  1FU1 A;  1VPC A;  3CC4 P;  1KV4 A;  5KTB A;  1K8A Q;  5AEU A;  2P67 A;  3B5N D;  1SQQ J;  1VQ6 P;  2PGD A;  3HD7 B;  2KZJ A;  4OGQ B;  3CX5 E;  3HD7 A;  2C9L Y;  3KYQ A;  3F5H A;  1BCC E;  1SQX E;  2BCC D;  1BGY D;  3MUD A;  4WVZ A;  1H0T B;  3CI9 A;  2HMM A;  1HTL C;  3EN1 A;  5APS A;  4WB4 A;  1ZR2 A;  1IJD B;  1IFP A;  3H1J J;  2M8R A; 
#chains in the Genus database with same CATH homology
 1O7H A;  2QJK C;  4NB8 D;  3H1H E;  4QUP A;  4NBG D;  3L74 E;  5CXM A;  3TGU E;  3H1K E;  3L71 E;  2GBX A;  1SQP E;  3DQY A;  3N0Q A;  2YFJ A;  4AAY B;  2YVJ B;  3GTE A;  2E4Q A;  2NUK A;  2NVE A;  4EMJ B;  4D6T E;  4H13 D;  3VCA A;  1P84 E;  1EG9 A;  2E4P A;  2E74 D;  2FYN C;  5BOK A;  5HL4 A;  3CXH E;  3L70 E;  1FQT A;  2BMO A;  2D2C D;  2ZYL A;  2ZT9 D;  2A06 E;  4QUR A;  4NBC D;  1SQQ E;  2XSH A;  2HMN A;  1O7G A;  2DE5 D;  1SQV E;  1SJG A;  4HM0 A;  5KKZ C;  1NTK E;  3GTS A;  4NBF D;  2HML A;  4P1B H;  3GL0 A;  2IBZ E;  2XR8 A;  1O7P A;  1VF5 D;  1NYK A;  3L75 E;  2QJP C;  1Q90 C;  4NBH D;  1VM9 A;  2I7F A;  2BCC E;  1ULJ A;  3VCP A;  1BGY E;  4QCK A;  3GKE A;  4HM1 A;  4QDC A;  2CKF A;  2NUM A;  2B1X A;  2XRX A;  2YFI A;  4NBA D;  2E75 D;  4HM8 A;  4HM7 A;  4QUQ A;  3GZY A;  4QDD A;  2HMK A;  4HKV A;  3GL2 A;  1BE3 E;  1G8K B;  1RIE A;  1O7N A;  2JZA A;  1ULI A;  1L0L E;  5KLI C;  1O7W A;  4HM2 A;  5AEU A;  3VMI D;  1EZV E;  1UUW A;  3GCE A;  1ZRT E;  4NBB D;  1O7M A;  1KB9 E;  3H1J E;  1PPJ E;  2B24 A;  3D89 A;  4P1C H;  4HM5 A;  3BCC E;  3CWB E;  2DE6 D;  3CX5 E;  4U3F E;  1RFS A;  4PD4 E;  3GOB A;  4PV1 D;  1NTM E;  1BCC E;  1SQX E;  4HM4 A;  2NVF A;  4HM3 A;  1PP9 E;  2FYU E;  3H1I E;  1UUV A;  2GBW A;  4AIV A;  2Q3W A;  2BMQ A;  1VCK A;  2YIU C;  3VMG D;  2DE7 D;  2NWF A;  4NBE D;  1SQB E;  3GZX A;  2HMJ A;  4QDF B;  1NDO A;  3AZC A;  2HMM A;  3GB4 A;  1WQL A;  1L0N E;  2QPZ A;  3EQQ A;  4NB9 D;  2QJY C;  1NU1 E;  3EN1 A;  4QDF A;  2E76 D;  2XSO A;  4HJL A;  3L72 E;  3L73 E;  1NTZ E;  2YFL A;  3FOU A;  4HM6 A;  3H1L E;  5KLV E;  1G8J B;  5AEW A;  2JO6 A;  4H0L D;  1JM1 A;  2HMO A;  3C0D A;  4NBD D;  3VMH D;  4H44 D;  4OGQ D;  1KYO E;  2BMR A;  2NVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...