4QUPA

Crystal structure of stachydrine demethylase with n-methyl proline from low x-ray dose composite datasets
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
415
structure length
414
Chain Sequence
GTENLYFQSMMTANPTSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPDPEVAGVQADGGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking photoelectron induced in-crystallo enzyme catalysis
rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
molecule keywords Monoxygenase; demethylase
total genus 130
structure length 414
sequence length 415
ec nomenclature ec 1.-.-.-:
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4qupA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 4qupA01
1NDOA 2HMOA 1Z01A 1ZRTE 2XSOA 4AIVA 3VMGD 3CX5E 3L75E 1P84E 4NBCD 4QDFB 1G8JB 1O7HA 2BMQA 4HM4A 3H1JE 5KLIC 2DE6A 2HMMA 2XRXA 2E4PA 4HM0A 4H13D 2NVEA 1WW9A 3EN1A 1L0LE 1RIEA 4NB9A 4HJLA 4QUQA 3VMID 1SQPE 3CXHE 4NBED 2E4QA 2JO6A 1ULJA 1FQTA 3GL0A 3GL2A 4NBFA 2DE7D 1Z02A 2BMOA 2E74D 4NBFD 1SQXE 1VF5D 1RFSA 4NBEA 4HM7A 4OGQD 3VMIA 2GBWA 2NUKA 1Q90C 2YFJA 1NU1E 4NB9D 2NVGA 4HM2A 1UUWA 2XR8A 2YFLA 5BOKA 1NTZE 3VMGA 3GCEA 2NWFA 5KKZC 1BE3E 1O7GA 2BMRA 4NBHD 2Q3WA 2B1XA 2XSHA 3CWBE 3DQYA 3FOUA 5AEWA 2B24A 2HMJA 3H1IE 2A06E 4P1BH 1O7WA 3GZXA 2DE5D 4QCKA 2HMKA 1WQLA 1O7PA 3EQQA 3GB4A 4PV1D 2YIUC 4NBDD 3TGUE 4HKVA 4NBBD 4QUPA 1JM1A 2FYUE 3H1KE 2FYNC 4NBAD 3AZCA 3VMHD 4U3FE 3D89A 5AEUA 1SQBE 2HMLA 1SQQE 3GOBA 4QURA 4AAYB 3GTEA 3L70E 1O7NA 2I7FA 2NUMA 3GZYA 4NB8A 2ZYLA 3VCAA 4QDDA 2QJKC 3N0QA 1KB9E 1PP9E 3H1LE 4HM6A 2E75D 2E76D 4QDFA 4NBGD 1SQVE 4P1CH 3GKEA 1L0NE 4HM3A 2D2CD 3L72E 2IBZE 4QDCA 2GBXA 4PD4E 4NBGA 2YVJB 2BCCE 5HL4A 1Z03A 2CKFA 1EZVE 1NTME 4NB8D 2JZAA 1NYKA 1VCKA 2NVFA 1SJGA 5CXMA 3GCFA 3GKQA 1O7MA 2HMNA 4NBAA 3VMHA 2YFIA 2DE7A 2QJYC 4HM1A 1KYOE 1NTKE 3H1HE 1G8KB 4NBBA 3VCPA 3L74E 4NBDA 3GTSA 4HM5A 1ULIA 3L71E 4H0LD 4EMJB 1UUVA 2DE5A 1EG9A 1VM9A 1BCCE 3C0DA 2DE6D 2QPZA 5KLVE 1PPJE 2QJPC 4HM8A 4NBCA 4NBHA 3BCCE 4H44D 3L73E 2ZT9D
chains in the Genus database with same CATH superfamily
1NDOA 2HMOA 1Z01A 1ZRTE 2XSOA 4AIVA 3VMGD 3CX5E 3L75E 1P84E 4NBCD 4QDFB 1G8JB 1O7HA 2BMQA 4HM4A 3H1JE 5KLIC 2DE6A 2HMMA 2XRXA 2E4PA 4HM0A 4H13D 2NVEA 1WW9A 3EN1A 1L0LE 1RIEA 4NB9A 4HJLA 4QUQA 3VMID 1SQPE 3CXHE 4NBED 2E4QA 2JO6A 1ULJA 1FQTA 3GL0A 3GL2A 4NBFA 2DE7D 1Z02A 2BMOA 2E74D 4NBFD 1SQXE 1VF5D 1RFSA 4NBEA 4HM7A 4OGQD 3VMIA 2GBWA 2NUKA 1Q90C 2YFJA 1NU1E 4NB9D 2NVGA 4HM2A 1UUWA 2XR8A 2YFLA 5BOKA 1NTZE 3VMGA 3GCEA 2NWFA 5KKZC 1BE3E 1O7GA 2BMRA 4NBHD 2Q3WA 2B1XA 2XSHA 3CWBE 3DQYA 3FOUA 5AEWA 2B24A 2HMJA 3H1IE 2A06E 4P1BH 1O7WA 3GZXA 2DE5D 4QCKA 2HMKA 1WQLA 1O7PA 3EQQA 3GB4A 4PV1D 2YIUC 4NBDD 3TGUE 4HKVA 4NBBD 4QUPA 1JM1A 2FYUE 3H1KE 2FYNC 4NBAD 3AZCA 3VMHD 4U3FE 3D89A 5AEUA 1SQBE 2HMLA 1SQQE 3GOBA 4QURA 4AAYB 3GTEA 3L70E 1O7NA 2I7FA 2NUMA 3GZYA 4NB8A 2ZYLA 3VCAA 4QDDA 2QJKC 3N0QA 1KB9E 1PP9E 3H1LE 4HM6A 2E75D 2E76D 4QDFA 4NBGD 1SQVE 4P1CH 3GKEA 1L0NE 4HM3A 2D2CD 3L72E 2IBZE 4QDCA 2GBXA 4PD4E 4NBGA 2YVJB 2BCCE 5HL4A 1Z03A 2CKFA 1EZVE 1NTME 4NB8D 2JZAA 1NYKA 1VCKA 2NVFA 1SJGA 5CXMA 3GCFA 3GKQA 1O7MA 2HMNA 4NBAA 3VMHA 2YFIA 2DE7A 2QJYC 4HM1A 1KYOE 1NTKE 3H1HE 1G8KB 4NBBA 3VCPA 3L74E 4NBDA 3GTSA 4HM5A 1ULIA 3L71E 4H0LD 4EMJB 1UUVA 2DE5A 1EG9A 1VM9A 1BCCE 3C0DA 2DE6D 2QPZA 5KLVE 1PPJE 2QJPC 4HM8A 4NBCA 4NBHA 3BCCE 4H44D 3L73E 2ZT9D
chains in the Genus database with same CATH topology
1NDOA 2HMOA 1Z01A 1ZRTE 2XSOA 4AIVA 3VMGD 3CX5E 3L75E 1P84E 4NBCD 4QDFB 1G8JB 1O7HA 2BMQA 4HM4A 3H1JE 5KLIC 2DE6A 2HMMA 2XRXA 2E4PA 4HM0A 4H13D 2NVEA 1WW9A 3EN1A 1L0LE 1RIEA 4NB9A 4HJLA 4QUQA 3VMID 1SQPE 3CXHE 4NBED 2E4QA 2JO6A 1ULJA 1FQTA 3GL0A 3GL2A 4NBFA 2DE7D 1Z02A 2BMOA 2E74D 4NBFD 1SQXE 1VF5D 1RFSA 4NBEA 4HM7A 4OGQD 3VMIA 2GBWA 2NUKA 1Q90C 2YFJA 1NU1E 4NB9D 2NVGA 4HM2A 1UUWA 2XR8A 2YFLA 5BOKA 1NTZE 3VMGA 3GCEA 2NWFA 5KKZC 1BE3E 1O7GA 2BMRA 4NBHD 2Q3WA 2B1XA 2XSHA 3CWBE 3DQYA 3FOUA 5AEWA 2B24A 2HMJA 3H1IE 2A06E 4P1BH 1O7WA 3GZXA 2DE5D 4QCKA 2HMKA 1WQLA 1O7PA 3EQQA 3GB4A 4PV1D 2YIUC 4NBDD 3TGUE 4HKVA 4NBBD 4QUPA 1JM1A 2FYUE 3H1KE 2FYNC 4NBAD 3AZCA 3VMHD 4U3FE 3D89A 5AEUA 1SQBE 2HMLA 1SQQE 3GOBA 4QURA 4AAYB 3GTEA 3L70E 1O7NA 2I7FA 2NUMA 3GZYA 4NB8A 2ZYLA 3VCAA 4QDDA 2QJKC 3N0QA 1KB9E 1PP9E 3H1LE 4HM6A 2E75D 2E76D 4QDFA 4NBGD 1SQVE 4P1CH 3GKEA 1L0NE 4HM3A 2D2CD 3L72E 2IBZE 4QDCA 2GBXA 4PD4E 4NBGA 2YVJB 2BCCE 5HL4A 1Z03A 2CKFA 1EZVE 1NTME 4NB8D 2JZAA 1NYKA 1VCKA 2NVFA 1SJGA 5CXMA 3GCFA 3GKQA 1O7MA 2HMNA 4NBAA 3VMHA 2YFIA 2DE7A 2QJYC 4HM1A 1KYOE 1NTKE 3H1HE 1G8KB 4NBBA 3VCPA 3L74E 4NBDA 3GTSA 4HM5A 1ULIA 3L71E 4H0LD 4EMJB 1UUVA 2DE5A 1EG9A 1VM9A 1BCCE 3C0DA 2DE6D 2QPZA 5KLVE 1PPJE 2QJPC 4HM8A 4NBCA 4NBHA 3BCCE 4H44D 3L73E 2ZT9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDO A;  2HMO A;  1Z01 A;  1ZRT E;  2XSO A;  4AIV A;  3VMG D;  3CX5 E;  3L75 E;  1P84 E;  4NBC D;  4QDF B;  1G8J B;  1O7H A;  2BMQ A;  4HM4 A;  3H1J E;  5KLI C;  2DE6 A;  2HMM A;  2XRX A;  2E4P A;  4HM0 A;  4H13 D;  2NVE A;  1WW9 A;  3EN1 A;  1L0L E;  1RIE A;  4NB9 A;  4HJL A;  4QUQ A;  3VMI D;  1SQP E;  3CXH E;  4NBE D;  2E4Q A;  2JO6 A;  1ULJ A;  1FQT A;  3GL0 A;  3GL2 A;  4NBF A;  2DE7 D;  1Z02 A;  2BMO A;  2E74 D;  4NBF D;  1SQX E;  1VF5 D;  1RFS A;  4NBE A;  4HM7 A;  4OGQ D;  3VMI A;  2GBW A;  2NUK A;  1Q90 C;  2YFJ A;  1NU1 E;  4NB9 D;  2NVG A;  4HM2 A;  1UUW A;  2XR8 A;  2YFL A;  5BOK A;  1NTZ E;  3VMG A;  3GCE A;  2NWF A;  5KKZ C;  1BE3 E;  1O7G A;  2BMR A;  4NBH D;  2Q3W A;  2B1X A;  2XSH A;  3CWB E;  3DQY A;  3FOU A;  5AEW A;  2B24 A;  2HMJ A;  3H1I E;  2A06 E;  4P1B H;  1O7W A;  3GZX A;  2DE5 D;  4QCK A;  2HMK A;  1WQL A;  1O7P A;  3EQQ A;  3GB4 A;  4PV1 D;  2YIU C;  4NBD D;  3TGU E;  4HKV A;  4NBB D;  4QUP A;  1JM1 A;  2FYU E;  3H1K E;  2FYN C;  4NBA D;  3AZC A;  3VMH D;  4U3F E;  3D89 A;  5AEU A;  1SQB E;  2HML A;  1SQQ E;  3GOB A;  4QUR A;  4AAY B;  3GTE A;  3L70 E;  1O7N A;  2I7F A;  2NUM A;  3GZY A;  4NB8 A;  2ZYL A;  3VCA A;  4QDD A;  2QJK C;  3N0Q A;  1KB9 E;  1PP9 E;  3H1L E;  4HM6 A;  2E75 D;  2E76 D;  4QDF A;  4NBG D;  1SQV E;  4P1C H;  3GKE A;  1L0N E;  4HM3 A;  2D2C D;  3L72 E;  2IBZ E;  4QDC A;  2GBX A;  4PD4 E;  4NBG A;  2YVJ B;  2BCC E;  5HL4 A;  1Z03 A;  2CKF A;  1EZV E;  1NTM E;  4NB8 D;  2JZA A;  1NYK A;  1VCK A;  2NVF A;  1SJG A;  5CXM A;  3GCF A;  3GKQ A;  1O7M A;  2HMN A;  4NBA A;  3VMH A;  2YFI A;  2DE7 A;  2QJY C;  4HM1 A;  1KYO E;  1NTK E;  3H1H E;  1G8K B;  4NBB A;  3VCP A;  3L74 E;  4NBD A;  3GTS A;  4HM5 A;  1ULI A;  3L71 E;  4H0L D;  4EMJ B;  1UUV A;  2DE5 A;  1EG9 A;  1VM9 A;  1BCC E;  3C0D A;  2DE6 D;  2QPZ A;  5KLV E;  1PPJ E;  2QJP C;  4HM8 A;  4NBC A;  4NBH A;  3BCC E;  4H44 D;  3L73 E;  2ZT9 D; 
#chains in the Genus database with same CATH topology
 1NDO A;  2HMO A;  1Z01 A;  1ZRT E;  2XSO A;  4AIV A;  3VMG D;  3CX5 E;  3L75 E;  1P84 E;  4NBC D;  4QDF B;  1G8J B;  1O7H A;  2BMQ A;  4HM4 A;  3H1J E;  5KLI C;  2DE6 A;  2HMM A;  2XRX A;  2E4P A;  4HM0 A;  4H13 D;  2NVE A;  1WW9 A;  3EN1 A;  1L0L E;  1RIE A;  4NB9 A;  4HJL A;  4QUQ A;  3VMI D;  1SQP E;  3CXH E;  4NBE D;  2E4Q A;  2JO6 A;  1ULJ A;  1FQT A;  3GL0 A;  3GL2 A;  4NBF A;  2DE7 D;  1Z02 A;  2BMO A;  2E74 D;  4NBF D;  1SQX E;  1VF5 D;  1RFS A;  4NBE A;  4HM7 A;  4OGQ D;  3VMI A;  2GBW A;  2NUK A;  1Q90 C;  2YFJ A;  1NU1 E;  4NB9 D;  2NVG A;  4HM2 A;  1UUW A;  2XR8 A;  2YFL A;  5BOK A;  1NTZ E;  3VMG A;  3GCE A;  2NWF A;  5KKZ C;  1BE3 E;  1O7G A;  2BMR A;  4NBH D;  2Q3W A;  2B1X A;  2XSH A;  3CWB E;  3DQY A;  3FOU A;  5AEW A;  2B24 A;  2HMJ A;  3H1I E;  2A06 E;  4P1B H;  1O7W A;  3GZX A;  2DE5 D;  4QCK A;  2HMK A;  1WQL A;  1O7P A;  3EQQ A;  3GB4 A;  4PV1 D;  2YIU C;  4NBD D;  3TGU E;  4HKV A;  4NBB D;  4QUP A;  1JM1 A;  2FYU E;  3H1K E;  2FYN C;  4NBA D;  3AZC A;  3VMH D;  4U3F E;  3D89 A;  5AEU A;  1SQB E;  2HML A;  1SQQ E;  3GOB A;  4QUR A;  4AAY B;  3GTE A;  3L70 E;  1O7N A;  2I7F A;  2NUM A;  3GZY A;  4NB8 A;  2ZYL A;  3VCA A;  4QDD A;  2QJK C;  3N0Q A;  1KB9 E;  1PP9 E;  3H1L E;  4HM6 A;  2E75 D;  2E76 D;  4QDF A;  4NBG D;  1SQV E;  4P1C H;  3GKE A;  1L0N E;  4HM3 A;  2D2C D;  3L72 E;  2IBZ E;  4QDC A;  2GBX A;  4PD4 E;  4NBG A;  2YVJ B;  2BCC E;  5HL4 A;  1Z03 A;  2CKF A;  1EZV E;  1NTM E;  4NB8 D;  2JZA A;  1NYK A;  1VCK A;  2NVF A;  1SJG A;  5CXM A;  3GCF A;  3GKQ A;  1O7M A;  2HMN A;  4NBA A;  3VMH A;  2YFI A;  2DE7 A;  2QJY C;  4HM1 A;  1KYO E;  1NTK E;  3H1H E;  1G8K B;  4NBB A;  3VCP A;  3L74 E;  4NBD A;  3GTS A;  4HM5 A;  1ULI A;  3L71 E;  4H0L D;  4EMJ B;  1UUV A;  2DE5 A;  1EG9 A;  1VM9 A;  1BCC E;  3C0D A;  2DE6 D;  2QPZ A;  5KLV E;  1PPJ E;  2QJP C;  4HM8 A;  4NBC A;  4NBH A;  3BCC E;  4H44 D;  3L73 E;  2ZT9 D; 
#chains in the Genus database with same CATH homology
 1NDO A;  2HMO A;  1Z01 A;  1ZRT E;  2XSO A;  4AIV A;  3VMG D;  3CX5 E;  3L75 E;  1P84 E;  4NBC D;  4QDF B;  1G8J B;  1O7H A;  2BMQ A;  4HM4 A;  3H1J E;  5KLI C;  2DE6 A;  2HMM A;  2XRX A;  2E4P A;  4HM0 A;  4H13 D;  2NVE A;  1WW9 A;  3EN1 A;  1L0L E;  1RIE A;  4NB9 A;  4HJL A;  4QUQ A;  3VMI D;  1SQP E;  3CXH E;  4NBE D;  2E4Q A;  2JO6 A;  1ULJ A;  1FQT A;  3GL0 A;  3GL2 A;  4NBF A;  2DE7 D;  1Z02 A;  2BMO A;  2E74 D;  4NBF D;  1SQX E;  1VF5 D;  1RFS A;  4NBE A;  4HM7 A;  4OGQ D;  3VMI A;  2GBW A;  2NUK A;  1Q90 C;  2YFJ A;  1NU1 E;  4NB9 D;  2NVG A;  4HM2 A;  1UUW A;  2XR8 A;  2YFL A;  5BOK A;  1NTZ E;  3VMG A;  3GCE A;  2NWF A;  5KKZ C;  1BE3 E;  1O7G A;  2BMR A;  4NBH D;  2Q3W A;  2B1X A;  2XSH A;  3CWB E;  3DQY A;  3FOU A;  5AEW A;  2B24 A;  2HMJ A;  3H1I E;  2A06 E;  4P1B H;  1O7W A;  3GZX A;  2DE5 D;  4QCK A;  2HMK A;  1WQL A;  1O7P A;  3EQQ A;  3GB4 A;  4PV1 D;  2YIU C;  4NBD D;  3TGU E;  4HKV A;  4NBB D;  4QUP A;  1JM1 A;  2FYU E;  3H1K E;  2FYN C;  4NBA D;  3AZC A;  3VMH D;  4U3F E;  3D89 A;  5AEU A;  1SQB E;  2HML A;  1SQQ E;  3GOB A;  4QUR A;  4AAY B;  3GTE A;  3L70 E;  1O7N A;  2I7F A;  2NUM A;  3GZY A;  4NB8 A;  2ZYL A;  3VCA A;  4QDD A;  2QJK C;  3N0Q A;  1KB9 E;  1PP9 E;  3H1L E;  4HM6 A;  2E75 D;  2E76 D;  4QDF A;  4NBG D;  1SQV E;  4P1C H;  3GKE A;  1L0N E;  4HM3 A;  2D2C D;  3L72 E;  2IBZ E;  4QDC A;  2GBX A;  4PD4 E;  4NBG A;  2YVJ B;  2BCC E;  5HL4 A;  1Z03 A;  2CKF A;  1EZV E;  1NTM E;  4NB8 D;  2JZA A;  1NYK A;  1VCK A;  2NVF A;  1SJG A;  5CXM A;  3GCF A;  3GKQ A;  1O7M A;  2HMN A;  4NBA A;  3VMH A;  2YFI A;  2DE7 A;  2QJY C;  4HM1 A;  1KYO E;  1NTK E;  3H1H E;  1G8K B;  4NBB A;  3VCP A;  3L74 E;  4NBD A;  3GTS A;  4HM5 A;  1ULI A;  3L71 E;  4H0L D;  4EMJ B;  1UUV A;  2DE5 A;  1EG9 A;  1VM9 A;  1BCC E;  3C0D A;  2DE6 D;  2QPZ A;  5KLV E;  1PPJ E;  2QJP C;  4HM8 A;  4NBC A;  4NBH A;  3BCC E;  4H44 D;  3L73 E;  2ZT9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...