4QUPA

Crystal structure of stachydrine demethylase with n-methyl proline from low x-ray dose composite datasets
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
415
structure length
414
Chain Sequence
GTENLYFQSMMTANPTSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPDPEVAGVQADGGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Monoxygenase; demethylase
publication title Tracking photoelectron induced in-crystallo enzyme catalysis
rcsb
source organism Sinorhizobium meliloti 1021
total genus 130
structure length 414
sequence length 415
ec nomenclature ec 1.-.-.-:
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4qupA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 4qupA01
1BCCE 4NBAA 2CKFA 2BMQA 2ZT9D 1O7PA 3GZXA 2XR8A 1BE3E 4QUQA 3CXHE 3VMIA 4QDDA 4HM8A 2ZYLA 3BCCE 4NBDD 2HMMA 2E74D 1UUWA 2HMKA 4U3FE 3GCFA 4NBEA 1PP9E 5KLIC 4NBBA 4HM5A 1NTZE 2DE6A 4NBFD 2DE5D 3H1IE 1O7NA 1SQXE 4HM4A 4H0LD 4NB9A 3GKQA 3GKEA 4QURA 1P84E 3VMGD 3GOBA 4HKVA 1NYKA 4NBAD 1SQPE 4HM2A 2YFJA 1SQQE 4PD4E 4NB8A 2YFLA 3VMID 5AEUA 3GZYA 3L75E 4QDFA 2BCCE 1G8JB 1VCKA 1NTKE 2IBZE 4H44D 4OGQD 1NTME 2A06E 3EQQA 2XRXA 2DE6D 2QPZA 5AEWA 4NBHA 1ZRTE 2BMOA 2YIUC 2E4QA 2HMLA 3GTSA 5KKZC 2XSOA 3L74E 2JZAA 3VCAA 4HJLA 1ULIA 2FYUE 3DQYA 1UUVA 3H1HE 1JM1A 1SQVE 2Q3WA 2YFIA 3GCEA 1KB9E 4NB8D 1NU1E 3FOUA 3CX5E 4PV1D 1EG9A 4QCKA 1Z02A 1VF5D 1WW9A 2DE7A 1FQTA 2XSHA 2NUMA 2QJKC 3L73E 1EZVE 1Q90C 3L70E 4NBHD 5CXMA 4NBCA 4NBED 2HMNA 4NBBD 3C0DA 4HM1A 3L71E 4NBDA 4AIVA 2HMJA 4HM0A 1Z03A 2QJYC 1RFSA 2GBXA 3VMHA 2JO6A 4NB9D 1SJGA 1O7MA 4NBGA 3L72E 2E75D 3EN1A 3H1LE 1Z01A 3D89A 1NDOA 2HMOA 3H1JE 1SQBE 4P1CH 4QUPA 2DE7D 4HM6A 2QJPC 1G8KB 2D2CD 3GTEA 4NBCD 4HM7A 2E4PA 2FYNC 3GL0A 2NWFA 1L0NE 4AAYB 4EMJB 3N0QA 3CWBE 3VMHD 1ULJA 2I7FA 2NUKA 2NVFA 1PPJE 4NBGD 4P1BH 2BMRA 3VCPA 2YVJB 5KLVE 2B1XA 1L0LE 2B24A 2GBWA 4HM3A 1O7WA 2NVEA 4NBFA 1WQLA 2DE5A 2NVGA 4QDCA 5BOKA 1VM9A 3TGUE 1KYOE 3GB4A 1O7HA 2E76D 1RIEA 3GL2A 3AZCA 4QDFB 4H13D 5HL4A 3VMGA 1O7GA 3H1KE
chains in the Genus database with same CATH superfamily
1BCCE 4NBAA 2CKFA 2BMQA 2ZT9D 1O7PA 3GZXA 2XR8A 1BE3E 4QUQA 3CXHE 3VMIA 4QDDA 4HM8A 2ZYLA 3BCCE 4NBDD 2HMMA 2E74D 1UUWA 2HMKA 4U3FE 3GCFA 4NBEA 1PP9E 5KLIC 4NBBA 4HM5A 1NTZE 2DE6A 4NBFD 2DE5D 3H1IE 1O7NA 1SQXE 4HM4A 4H0LD 4NB9A 3GKQA 3GKEA 4QURA 1P84E 3VMGD 3GOBA 4HKVA 1NYKA 4NBAD 1SQPE 4HM2A 2YFJA 1SQQE 4PD4E 4NB8A 2YFLA 3VMID 5AEUA 3GZYA 3L75E 4QDFA 2BCCE 1G8JB 1VCKA 1NTKE 2IBZE 4H44D 4OGQD 1NTME 2A06E 3EQQA 2XRXA 2DE6D 2QPZA 5AEWA 4NBHA 1ZRTE 2BMOA 2YIUC 2E4QA 2HMLA 3GTSA 5KKZC 2XSOA 3L74E 2JZAA 3VCAA 4HJLA 1ULIA 2FYUE 3DQYA 1UUVA 3H1HE 1JM1A 1SQVE 2Q3WA 2YFIA 3GCEA 1KB9E 4NB8D 1NU1E 3FOUA 3CX5E 4PV1D 1EG9A 4QCKA 1Z02A 1VF5D 1WW9A 2DE7A 1FQTA 2XSHA 2NUMA 2QJKC 3L73E 1EZVE 1Q90C 3L70E 4NBHD 5CXMA 4NBCA 4NBED 2HMNA 4NBBD 3C0DA 4HM1A 3L71E 4NBDA 4AIVA 2HMJA 4HM0A 1Z03A 2QJYC 1RFSA 2GBXA 3VMHA 2JO6A 4NB9D 1SJGA 1O7MA 4NBGA 3L72E 2E75D 3EN1A 3H1LE 1Z01A 3D89A 1NDOA 2HMOA 3H1JE 1SQBE 4P1CH 4QUPA 2DE7D 4HM6A 2QJPC 1G8KB 2D2CD 3GTEA 4NBCD 4HM7A 2E4PA 2FYNC 3GL0A 2NWFA 1L0NE 4AAYB 4EMJB 3N0QA 3CWBE 3VMHD 1ULJA 2I7FA 2NUKA 2NVFA 1PPJE 4NBGD 4P1BH 2BMRA 3VCPA 2YVJB 5KLVE 2B1XA 1L0LE 2B24A 2GBWA 4HM3A 1O7WA 2NVEA 4NBFA 1WQLA 2DE5A 2NVGA 4QDCA 5BOKA 1VM9A 3TGUE 1KYOE 3GB4A 1O7HA 2E76D 1RIEA 3GL2A 3AZCA 4QDFB 4H13D 5HL4A 3VMGA 1O7GA 3H1KE
chains in the Genus database with same CATH topology
1BCCE 4NBAA 2CKFA 2BMQA 2ZT9D 1O7PA 3GZXA 2XR8A 1BE3E 4QUQA 3CXHE 3VMIA 4QDDA 4HM8A 2ZYLA 3BCCE 4NBDD 2HMMA 2E74D 1UUWA 2HMKA 4U3FE 3GCFA 4NBEA 1PP9E 5KLIC 4NBBA 4HM5A 1NTZE 2DE6A 4NBFD 2DE5D 3H1IE 1O7NA 1SQXE 4HM4A 4H0LD 4NB9A 3GKQA 3GKEA 4QURA 1P84E 3VMGD 3GOBA 4HKVA 1NYKA 4NBAD 1SQPE 4HM2A 2YFJA 1SQQE 4PD4E 4NB8A 2YFLA 3VMID 5AEUA 3GZYA 3L75E 4QDFA 2BCCE 1G8JB 1VCKA 1NTKE 2IBZE 4H44D 4OGQD 1NTME 2A06E 3EQQA 2XRXA 2DE6D 2QPZA 5AEWA 4NBHA 1ZRTE 2BMOA 2YIUC 2E4QA 2HMLA 3GTSA 5KKZC 2XSOA 3L74E 2JZAA 3VCAA 4HJLA 1ULIA 2FYUE 3DQYA 1UUVA 3H1HE 1JM1A 1SQVE 2Q3WA 2YFIA 3GCEA 1KB9E 4NB8D 1NU1E 3FOUA 3CX5E 4PV1D 1EG9A 4QCKA 1Z02A 1VF5D 1WW9A 2DE7A 1FQTA 2XSHA 2NUMA 2QJKC 3L73E 1EZVE 1Q90C 3L70E 4NBHD 5CXMA 4NBCA 4NBED 2HMNA 4NBBD 3C0DA 4HM1A 3L71E 4NBDA 4AIVA 2HMJA 4HM0A 1Z03A 2QJYC 1RFSA 2GBXA 3VMHA 2JO6A 4NB9D 1SJGA 1O7MA 4NBGA 3L72E 2E75D 3EN1A 3H1LE 1Z01A 3D89A 1NDOA 2HMOA 3H1JE 1SQBE 4P1CH 4QUPA 2DE7D 4HM6A 2QJPC 1G8KB 2D2CD 3GTEA 4NBCD 4HM7A 2E4PA 2FYNC 3GL0A 2NWFA 1L0NE 4AAYB 4EMJB 3N0QA 3CWBE 3VMHD 1ULJA 2I7FA 2NUKA 2NVFA 1PPJE 4NBGD 4P1BH 2BMRA 3VCPA 2YVJB 5KLVE 2B1XA 1L0LE 2B24A 2GBWA 4HM3A 1O7WA 2NVEA 4NBFA 1WQLA 2DE5A 2NVGA 4QDCA 5BOKA 1VM9A 3TGUE 1KYOE 3GB4A 1O7HA 2E76D 1RIEA 3GL2A 3AZCA 4QDFB 4H13D 5HL4A 3VMGA 1O7GA 3H1KE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC E;  4NBA A;  2CKF A;  2BMQ A;  2ZT9 D;  1O7P A;  3GZX A;  2XR8 A;  1BE3 E;  4QUQ A;  3CXH E;  3VMI A;  4QDD A;  4HM8 A;  2ZYL A;  3BCC E;  4NBD D;  2HMM A;  2E74 D;  1UUW A;  2HMK A;  4U3F E;  3GCF A;  4NBE A;  1PP9 E;  5KLI C;  4NBB A;  4HM5 A;  1NTZ E;  2DE6 A;  4NBF D;  2DE5 D;  3H1I E;  1O7N A;  1SQX E;  4HM4 A;  4H0L D;  4NB9 A;  3GKQ A;  3GKE A;  4QUR A;  1P84 E;  3VMG D;  3GOB A;  4HKV A;  1NYK A;  4NBA D;  1SQP E;  4HM2 A;  2YFJ A;  1SQQ E;  4PD4 E;  4NB8 A;  2YFL A;  3VMI D;  5AEU A;  3GZY A;  3L75 E;  4QDF A;  2BCC E;  1G8J B;  1VCK A;  1NTK E;  2IBZ E;  4H44 D;  4OGQ D;  1NTM E;  2A06 E;  3EQQ A;  2XRX A;  2DE6 D;  2QPZ A;  5AEW A;  4NBH A;  1ZRT E;  2BMO A;  2YIU C;  2E4Q A;  2HML A;  3GTS A;  5KKZ C;  2XSO A;  3L74 E;  2JZA A;  3VCA A;  4HJL A;  1ULI A;  2FYU E;  3DQY A;  1UUV A;  3H1H E;  1JM1 A;  1SQV E;  2Q3W A;  2YFI A;  3GCE A;  1KB9 E;  4NB8 D;  1NU1 E;  3FOU A;  3CX5 E;  4PV1 D;  1EG9 A;  4QCK A;  1Z02 A;  1VF5 D;  1WW9 A;  2DE7 A;  1FQT A;  2XSH A;  2NUM A;  2QJK C;  3L73 E;  1EZV E;  1Q90 C;  3L70 E;  4NBH D;  5CXM A;  4NBC A;  4NBE D;  2HMN A;  4NBB D;  3C0D A;  4HM1 A;  3L71 E;  4NBD A;  4AIV A;  2HMJ A;  4HM0 A;  1Z03 A;  2QJY C;  1RFS A;  2GBX A;  3VMH A;  2JO6 A;  4NB9 D;  1SJG A;  1O7M A;  4NBG A;  3L72 E;  2E75 D;  3EN1 A;  3H1L E;  1Z01 A;  3D89 A;  1NDO A;  2HMO A;  3H1J E;  1SQB E;  4P1C H;  4QUP A;  2DE7 D;  4HM6 A;  2QJP C;  1G8K B;  2D2C D;  3GTE A;  4NBC D;  4HM7 A;  2E4P A;  2FYN C;  3GL0 A;  2NWF A;  1L0N E;  4AAY B;  4EMJ B;  3N0Q A;  3CWB E;  3VMH D;  1ULJ A;  2I7F A;  2NUK A;  2NVF A;  1PPJ E;  4NBG D;  4P1B H;  2BMR A;  3VCP A;  2YVJ B;  5KLV E;  2B1X A;  1L0L E;  2B24 A;  2GBW A;  4HM3 A;  1O7W A;  2NVE A;  4NBF A;  1WQL A;  2DE5 A;  2NVG A;  4QDC A;  5BOK A;  1VM9 A;  3TGU E;  1KYO E;  3GB4 A;  1O7H A;  2E76 D;  1RIE A;  3GL2 A;  3AZC A;  4QDF B;  4H13 D;  5HL4 A;  3VMG A;  1O7G A;  3H1K E; 
#chains in the Genus database with same CATH topology
 1BCC E;  4NBA A;  2CKF A;  2BMQ A;  2ZT9 D;  1O7P A;  3GZX A;  2XR8 A;  1BE3 E;  4QUQ A;  3CXH E;  3VMI A;  4QDD A;  4HM8 A;  2ZYL A;  3BCC E;  4NBD D;  2HMM A;  2E74 D;  1UUW A;  2HMK A;  4U3F E;  3GCF A;  4NBE A;  1PP9 E;  5KLI C;  4NBB A;  4HM5 A;  1NTZ E;  2DE6 A;  4NBF D;  2DE5 D;  3H1I E;  1O7N A;  1SQX E;  4HM4 A;  4H0L D;  4NB9 A;  3GKQ A;  3GKE A;  4QUR A;  1P84 E;  3VMG D;  3GOB A;  4HKV A;  1NYK A;  4NBA D;  1SQP E;  4HM2 A;  2YFJ A;  1SQQ E;  4PD4 E;  4NB8 A;  2YFL A;  3VMI D;  5AEU A;  3GZY A;  3L75 E;  4QDF A;  2BCC E;  1G8J B;  1VCK A;  1NTK E;  2IBZ E;  4H44 D;  4OGQ D;  1NTM E;  2A06 E;  3EQQ A;  2XRX A;  2DE6 D;  2QPZ A;  5AEW A;  4NBH A;  1ZRT E;  2BMO A;  2YIU C;  2E4Q A;  2HML A;  3GTS A;  5KKZ C;  2XSO A;  3L74 E;  2JZA A;  3VCA A;  4HJL A;  1ULI A;  2FYU E;  3DQY A;  1UUV A;  3H1H E;  1JM1 A;  1SQV E;  2Q3W A;  2YFI A;  3GCE A;  1KB9 E;  4NB8 D;  1NU1 E;  3FOU A;  3CX5 E;  4PV1 D;  1EG9 A;  4QCK A;  1Z02 A;  1VF5 D;  1WW9 A;  2DE7 A;  1FQT A;  2XSH A;  2NUM A;  2QJK C;  3L73 E;  1EZV E;  1Q90 C;  3L70 E;  4NBH D;  5CXM A;  4NBC A;  4NBE D;  2HMN A;  4NBB D;  3C0D A;  4HM1 A;  3L71 E;  4NBD A;  4AIV A;  2HMJ A;  4HM0 A;  1Z03 A;  2QJY C;  1RFS A;  2GBX A;  3VMH A;  2JO6 A;  4NB9 D;  1SJG A;  1O7M A;  4NBG A;  3L72 E;  2E75 D;  3EN1 A;  3H1L E;  1Z01 A;  3D89 A;  1NDO A;  2HMO A;  3H1J E;  1SQB E;  4P1C H;  4QUP A;  2DE7 D;  4HM6 A;  2QJP C;  1G8K B;  2D2C D;  3GTE A;  4NBC D;  4HM7 A;  2E4P A;  2FYN C;  3GL0 A;  2NWF A;  1L0N E;  4AAY B;  4EMJ B;  3N0Q A;  3CWB E;  3VMH D;  1ULJ A;  2I7F A;  2NUK A;  2NVF A;  1PPJ E;  4NBG D;  4P1B H;  2BMR A;  3VCP A;  2YVJ B;  5KLV E;  2B1X A;  1L0L E;  2B24 A;  2GBW A;  4HM3 A;  1O7W A;  2NVE A;  4NBF A;  1WQL A;  2DE5 A;  2NVG A;  4QDC A;  5BOK A;  1VM9 A;  3TGU E;  1KYO E;  3GB4 A;  1O7H A;  2E76 D;  1RIE A;  3GL2 A;  3AZC A;  4QDF B;  4H13 D;  5HL4 A;  3VMG A;  1O7G A;  3H1K E; 
#chains in the Genus database with same CATH homology
 1BCC E;  4NBA A;  2CKF A;  2BMQ A;  2ZT9 D;  1O7P A;  3GZX A;  2XR8 A;  1BE3 E;  4QUQ A;  3CXH E;  3VMI A;  4QDD A;  4HM8 A;  2ZYL A;  3BCC E;  4NBD D;  2HMM A;  2E74 D;  1UUW A;  2HMK A;  4U3F E;  3GCF A;  4NBE A;  1PP9 E;  5KLI C;  4NBB A;  4HM5 A;  1NTZ E;  2DE6 A;  4NBF D;  2DE5 D;  3H1I E;  1O7N A;  1SQX E;  4HM4 A;  4H0L D;  4NB9 A;  3GKQ A;  3GKE A;  4QUR A;  1P84 E;  3VMG D;  3GOB A;  4HKV A;  1NYK A;  4NBA D;  1SQP E;  4HM2 A;  2YFJ A;  1SQQ E;  4PD4 E;  4NB8 A;  2YFL A;  3VMI D;  5AEU A;  3GZY A;  3L75 E;  4QDF A;  2BCC E;  1G8J B;  1VCK A;  1NTK E;  2IBZ E;  4H44 D;  4OGQ D;  1NTM E;  2A06 E;  3EQQ A;  2XRX A;  2DE6 D;  2QPZ A;  5AEW A;  4NBH A;  1ZRT E;  2BMO A;  2YIU C;  2E4Q A;  2HML A;  3GTS A;  5KKZ C;  2XSO A;  3L74 E;  2JZA A;  3VCA A;  4HJL A;  1ULI A;  2FYU E;  3DQY A;  1UUV A;  3H1H E;  1JM1 A;  1SQV E;  2Q3W A;  2YFI A;  3GCE A;  1KB9 E;  4NB8 D;  1NU1 E;  3FOU A;  3CX5 E;  4PV1 D;  1EG9 A;  4QCK A;  1Z02 A;  1VF5 D;  1WW9 A;  2DE7 A;  1FQT A;  2XSH A;  2NUM A;  2QJK C;  3L73 E;  1EZV E;  1Q90 C;  3L70 E;  4NBH D;  5CXM A;  4NBC A;  4NBE D;  2HMN A;  4NBB D;  3C0D A;  4HM1 A;  3L71 E;  4NBD A;  4AIV A;  2HMJ A;  4HM0 A;  1Z03 A;  2QJY C;  1RFS A;  2GBX A;  3VMH A;  2JO6 A;  4NB9 D;  1SJG A;  1O7M A;  4NBG A;  3L72 E;  2E75 D;  3EN1 A;  3H1L E;  1Z01 A;  3D89 A;  1NDO A;  2HMO A;  3H1J E;  1SQB E;  4P1C H;  4QUP A;  2DE7 D;  4HM6 A;  2QJP C;  1G8K B;  2D2C D;  3GTE A;  4NBC D;  4HM7 A;  2E4P A;  2FYN C;  3GL0 A;  2NWF A;  1L0N E;  4AAY B;  4EMJ B;  3N0Q A;  3CWB E;  3VMH D;  1ULJ A;  2I7F A;  2NUK A;  2NVF A;  1PPJ E;  4NBG D;  4P1B H;  2BMR A;  3VCP A;  2YVJ B;  5KLV E;  2B1X A;  1L0L E;  2B24 A;  2GBW A;  4HM3 A;  1O7W A;  2NVE A;  4NBF A;  1WQL A;  2DE5 A;  2NVG A;  4QDC A;  5BOK A;  1VM9 A;  3TGU E;  1KYO E;  3GB4 A;  1O7H A;  2E76 D;  1RIE A;  3GL2 A;  3AZC A;  4QDF B;  4H13 D;  5HL4 A;  3VMG A;  1O7G A;  3H1K E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...