2BCCE

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2bccE02
1O7NA 1UUWA 5KLVE 2FYUE 2BCCE 4AAYB 3CXHE 4PD4E 4AIVA 4D6TE 1EZVE 2ZYLA 3N0QA 1BCCE 1O7GA 4HJLA 3L70E 4HM3A 4PV1D 4QDFB 2DE5D 3TGUE 3GZXA 4QURA 4QDDA 1ULIA 4H0LD 4QDFA 2DE6D 2QJPC 1BE3E 2DE7D 1Q90C 4NB8D 2NWFA 4NBFD 1SQQE 4NBBD 2B24A 3VMHD 4NB9D 3H1JE 2HMNA 2E75D 1KB9E 1PPJE 1NTME 1O7MA 2GBXA 2QJYC 2YFLA 3BCCE 1NU1E 2HMJA 4HM8A 1NTZE 1O7PA 1SJGA 3H1HE 2HMLA 5CXMA 1PP9E 5KLIC 2JZAA 2HMKA 2NVGA 1SQVE 3GB4A 4HKVA 4HM5A 2B1XA 1KYOE 4QCKA 2CKFA 1L0NE 2NUMA 2NUKA 3VCAA 2JO6A 4QUQA 4HM0A 3CWBE 5KKZC 3GTSA 3L75E 1O7WA 4EMJB 3GCEA 2E4PA 1VM9A 3EN1A 1P84E 1UUVA 3DQYA 3GL2A 2IBZE 4HM2A 4NBDD 1VF5D 2YIUC 2XSHA 2XRXA 1RFSA 2HMOA 2HMMA 1JM1A 3AZCA 5BOKA 4HM7A 1NYKA 1ZRTE 2NVFA 3C0DA 3L71E 3GL0A 2ZT9D 4NBHD 5AEUA 3D89A 1WQLA 3L74E 4U3FE 3EQQA 2E74D 2QJKC 4HM6A 1O7HA 4NBED 4OGQD 2YFIA 2YFJA 3L72E 2GBWA 2FYNC 3GTEA 3H1KE 1NDOA 4NBGD 1SQBE 3H1IE 2YVJB 1ULJA 2NVEA 2BMQA 1L0LE 1SQPE 4NBAD 4QUPA 2BMRA 4H13D 2XR8A 3VMID 1VCKA 2A06E 1FQTA 3FOUA 4H44D 1EG9A 2E76D 1NTKE 2QPZA 3VMGD 1RIEA 4HM4A 2E4QA 3L73E 3GKEA 4NBCD 2Q3WA 4P1BH 2I7FA 3VCPA 5AEWA 4P1CH 5HL4A 2D2CD 1G8JB 3H1LE 3CX5E 1SQXE 4HM1A 2BMOA 3GOBA 1G8KB 1BGYE 3GZYA 4QDCA 2XSOA
chains in the Genus database with same CATH superfamily
4JF7A 4I7ZB 2YKPA 3CWBG 3N4XA 1RHZB 1NYHA 1T3JA 3S1KA 2W6BA 4QDFA 3CD6P 4NBFD 4N3YB 2P58A 5CCGA 2O1KA 3CLQA 3LW5H 3VMHD 1JMMA 1KB9H 1NTME 1NTMD 2OYIC 3Q3DA 1GK4A 4U3FG 5KLIC 3VP8A 1FDOA 2PFXA 3H1IG 4I6MC 4HM2A 2QJKB 3D71A 2JDIH 2E5YA 2HMMA 1DH3A 2XZRA 4HM7A 2JR8A 2ZT9D 1M56D 3H1HD 3G3ZA 2D2CC 3L4FA 3HE5A 2IDBA 1SQPJ 2C0XA 2CPBA 2E74D 4NBED 3H1LG 3N7NA 3GTEA 2P1JA 2C0WA 1K73Q 2FYUG 1KMIZ 3NTNA 1TU3F 2I1JA 2KXPB 1S2EA 3HTKA 2WSFJ 2RH0A 4WB4A 3L73E 3GKEA 4NBCD 2L91A 3L73D 4JYBA 3G9RA 1KTMA 1JY2P 5BU8B 4LGDE 2QIWA 2YNYA 1AV1A 1GL2B 5CCGD 4EYYQ 2RN0A 4AYCA 1SQVG 3L75J 1FDIA 2KZJA 1VF5C 2OYIA 2QJPC 2P67A 1P84H 2YKOA 1MFTA 1FJPA 4JPZB 2HMNA 2M5AB 2G3AA 1BDCA 2FXPA 2HPCB 1XTGB 3P8CE 2H7HA 1FZCB 3A0BH 2R3CA 3IN6A 4BXLA 1ZMEC 1KYOH 1KQLA 4YTPC 2NUMA 2JO6A 3AEBC 3RK2D 5APYA 3CCSP 2V7QJ 3V2RA 3EN1A 4WWIA 5AVRB 2E75B 2XRXA 1SS1A 3H1JD 2R5DA 4UB6H 1FOSF 2Q9IA 4WY4A 1S3JA 2M8RA 2QEXP 4HM6A 2BCCJ 3AE5C 3AEGC 3GF3A 1GU4A 3OAKA 4NBAD 1GW3A 1U7JA 2OTLP 4XE5B 4HH2A 2IYPA 2HLOA 3Q5PA 1GTWA 3SSUA 1JCDA 1SQXK 5HL4A 2W6AA 1JTHB 3RK3E 3HD7B 3RK3D 3H1HG 1FZFA 1NAYA 3GZYA 3B71A 1K8AQ 1O7NA 3RGUA 2C9LY 4AAYB 4AIVA 2FBWC 1EZVE 1EZVD 3KHUA 1BCCE 1O7GA 4YPCA 1CI6A 3H32B 3CC7P 3L37A 3GHGA 2W90A 1M1JB 1RF1B 4NBBD 1BDDA 3JCUH 3P8MC 1KB9E 4K3AA 2GBXA 3EFFK 1N7LA 3Q5RA 1HJ0A 2WSEJ 4UB8H 3B8EB 3C1LA 4WY4D 4QCKA 1L0NE 2WZ7A 1L0ND 2KLVA 1O7WA 1H89A 4AUWA 4GKGA 3G71P 4NBDD 3PLNA 3R2PA 2Z5IA 2YMKA 5KJ7C 3A7OA 1URQC 2BASA 1NTZD 1HH0A 2K37A 5E79E 5AEUA 1YJWP 3IAOA 3B5NB 2QJKC 2O3JA 3O8ZA 1LNQA 3L72E 4GT1A 5KAIE 1SQBE 1SQBD 3CX5H 1JEKA 3K5BA 5AW0B 4C7NB 2FKWB 1RE4C 1YI2P 1M57D 1JY3N 3BATA 1HGVA 2CK3H 1BE3G 4OGQB 3H1JG 5AEWA 2OYHC 3H1KD 3RL0g 2W27A 3EQ2A 2LXBA 5AVYB 4QMAA 2E76B 4BRYA 1KD1Q 1NKNA 2YIUB 3JSVC 1N2DC 4IFDK 3TNUB 3AE8C 4JBZA 1L4AB 1IFNA 1S5LH 5GTHE 1LJ2A 3L71J 2CPSA 5AVUB 1LP1B 3L74J 2XV5A 1NU1E 1EZVI 1NWQA 3V5BA 2A45G 2B1XA 4NPDA 1KYOE 2CKFA 2YO3A 3KDPB 4LC1A 3U1AA 1S9KD 1YHQP 1AQ5A 1AJYA 3CCQP 1VQNP 3CCJP 4I2LC 2K88A 4L76A 2Q3EA 3V4WA 4UB6E 1T2KC 5KTBA 3C0DA 2ZVOB 1SQXJ 1EDIA 2E75C 4ZKUA 1RE4A 2FYNC 1QLED 1RF0C 5KLVG 1RQVA 4PD4H 4B86A 3GF7A 3FOUA 2QPZA 4IFFA 3MD0A 3VCPA 1NOHA 4C46A 1Y9BA 1OW8A 1NTZG 4TT3H 2J59M 1LT1A 1GL2A 3EFGA 1BGYE 2OQQA 2I8DA 2KIKA 1SQPD 1E5WA 2Q7CA 5KAFH 3ZDMA 2JWDA 3LW5J 1FOSE 2J5UA 2AEFA 1R8EA 2M0BA 4K35A 5EFWB 1G2CB 2DE6D 5CCHA 1SQQE 1U57A 2NRGA 3JCUE 1Q82Q 2ZT9C 2B24A 4DJGA 1O7MA 3BCCE 2ZYDA 2HMJA 2M5AA 1ZW0A 4IL6H 2HPCA 1M1JC 1FZCA 4RKUJ 3H1KG 1HF9A 1OW7A 4QUQA 2OGUA 2ZXEB 5KKZC 2NPSC 3L75E 4EMJB 3NFQA 3L75D 5K5GB 3SWKA 3TF5A 1YTZI 2Q3IA 3L72J 3G4SP 1LTJB 2IX7C 5CCGC 3AEEC 1EC5A 1ZR4A 3AEFC 3BRTB 1NDOA 2R32A 1ULJA 3GW6A 1HTLC 1W2EA 2QM7A 1GL2D 2B89A 1JOCA 3L35A 3AEAC 3USSA 1LT9B 3FWLA 1S4XA 1RE3A 2MJZA 4RO0A 3TYYA 2O01N 1CZQA 4RJTA 1IFPA 2FYUK 2B9BA 1JTHA 3CMAP 3HD7A 1PP9G 2N1TB 1VDFA 4QDDA 2YXRB 3RK2C 1KQSO 1UUWA 2BCCE 1OWAA 2KNCB 3Q2YA 2BCCD 4HYTB 3VMAA 3L70E 2QSIA 4HM3A 3H32A 1AVYA 5AVQB 5AVXB 1S5LE 2HR3A 1M1JA 3KZIE 2AXCA 4H44C 1RF1A 2E75D 1SQVK 2NPSA 3MGNA 2WPQA 2H88C 1NAFA 1N8RQ 1WMKA 2KB7P 1JCCA 5AW8B 2NUKA 5H2FE 2HYNA 2A45H 1ZLLA 1L0LG 1SQPG 3WUUA 1YIJP 3IFMA 1IFJA 1LTAC 4GOEA 4GOFA 5AVSB 5BOKA 2HMOA 3CCLP 4CPGA 4RESB 2ZVNB 1K05A 2IFMA 3RK3C 1FZAA 3B5NA 2YFJA 3CL3D 2FFDB 2VRSA 1USEA 1EXJA 3AEDC 1IJDB 2M3BA 3HD7D 4C7NA 3TGUJ 1FQTA 1EXIA 2IZ1A 1OW6A 1OFCX 4P1BH 1BGYJ 3SWYA 2I7FA 1S1CX 4WY4C 1HVVA 4HM1A 2Q5UA 1Q7YQ 3CWBJ 2NPSD 3CXHE 1QGKB 1UIXA 5KAFE 4DCKA 1SQQJ 3EWKA 3BCCJ 1LTTC 3FWNA 3TNUA 4AQRD 3E7KA 4H13C 1L4AA 3WU2H 3F89A 1OIPA 3B4SA 3HE4B 5B5EE 3FXEA 2WPSA 2GM4A 4U3FJ 5L8RJ 1LP1A 2O01H 2ZJSE 1SJGA 3H1IJ 4IL6E 3BRVB 5C39A 1KILE 2DW3A 4PV1B 1CW5A 3KQGA 3B5ND 4ZKPA 1VQ8P 3V6IA 1QL2A 1JY3P 2Q1KA 4OWFA 2N9YB 4Y99B 3GHGC 1NTKG 3CCRP 1YQ4C 2Y0CA 4W7ZA 3RL0B 5TISH 3ABVC 1ZRTE 1J2JB 3L71E 4NBHD 1ZRTD 3P8CD 3H1LJ 3L71D 3L74E 2OTJP 1SLQA 3MZWB 3L74D 4OGQD 2FYUJ 3O6QB 2GBWA 1LGHB 3MTUE 4DOJA 5M1BA 4Y28J 3C9IA 1W2BO 3IF4A 1IK7A 2WVRA 2K1AA 4H44D 2E76D 2HG5D 2QJYB 3AE6C 1M8OB 3II6A 2K9JB 4OVNF 1PGPA 3VMZA 1GMJA 1L4AD 1NTMG 1LT9C 3SFDC 3VP9A 2WITA 4L74A 1SQXE 3L70J 2BMOA 1SQXD 2XSOA 2KS1B 1N73C 1R5LA 5APSA 2ZYLA 2AXTE 2BEZF 3KXDA 3N0QA 2YO2A 1FBMA 2DE5D 2HFED 1G2CA 3V2QA 4NB9D 3CXHI 1O7PA 1EDKA 2GUVA 2HMKA 4HKVA 3W67A 3D70A 1BCCD 4H0LB 4YXDC 1DEBA 3HRNA 4W80A 4I7ZC 3JC22 2JEEA 3WUVA 2PGDA 3WMM0 5CJ0A 3D6YA 1RFSA 1KV4A 1KB9D 2KSJA 5CJ4A 3L73G 2NVFA 1G1JA 1LWUB 3D89A 1LTJA 3S9OA 5BU5A 1JB0J 4HKZH 3T97B 5GTIH 1QVGO 1EDLA 3TK1A 1QEXA 1GD2E 2ZFCA 2R5BA 4H13D 1OVRA 1RH5B 3NMDA 1Z56A 1LT9A 1KILB 4JQ0D 5AW4B 2YXQB 1N73A 3H1HJ 2JKVA 3L72D 3Q1MA 1X9VA 4L75A 1JNMA 1G8JB 5KLVK 2YFLA 4D6TE 2KNCA 1N7SB 4W7YA 1D7MA 4TLFA 3PP5A 3WU2E 3CC2P 1NTZK 1OMIA 3C8VA 3KPEA 3WUTA 1PFIA 3GB4A 3BASA 1CSBA 1GL2C 1VQPP 1YJ9P 2E42A 1P84E 1UUVA 1KQGB 2IBZE 1KC8Q 5CMZA 1L2PA 1P84D 2XNDH 1JM1A 2Y0EA 4PJ0H 1NU1D 5CCHC 1DD3A 3A0BE 1WQLA 3TSIA 1KYOD 1YITP 4EIJA 2YFIA 1N86A 2FFDA 3RBZA 1FZCC 1KB9I 2BMQA 1EZVG 2LKMA 4QUPA 1BCCG 2BMRA 1BE3J 3VMID 1JMBA 2A06E 4GDOA 1Y47A 3H1JJ 2B87B 3M91A 5KLIB 2W6JH 5AW9B 3V2NA 1X8YA 3AE2C 3QH9A 1JY2O 4HM8A 1L0NG 3MHVA 1VQ6P 2FXMA 1IFIA 3TGUE 3CC4P 3GZXA 4QURA 3TGUD 3GG2A 1QL1A 2D2CB 1RE3C 3HE4A 2KP8A 1PPJE 5AW1B 1PPJD 1BGYD 2XU6A 2NVGA 3A5TA 3L72G 1FE6A 2QG4A 1GZLA 1SQBG 1H0TB 3HD7C 3R4YA 2C9NY 3CWBE 3CWBD 1SFCB 1DEEG 5AW6B 1VQ7P 1SQQD 4DT0A 4A7PA 3AZCA 1ZXGA 4L73A 3BCCD 4UB8E 4WBAA 3TDKA 1MUUA 1RF1C 1LTIC 4U3FE 1KFMA 5KLVJ 4U7JA 1E79H 1P84I 1L0LK 1SQPK 3H1IE 3O6QA 5GTIE 3H1ID 1VQ9P 5AVTB 1VF5B 3LIEA 2WPVB 3CCUP 3AE3C 2QJPB 3V4QA 2XR8A 1A02F 1KYOI 1NHLA 2QE7H 4ZNCA 2QVAA 1W5CE 2E4QA 2P7JA 3A0HH 1NTZJ 2K9JA 4GODA 1S5LX 2BEQD 1NU1G 4D6TJ 3H1LE 3CX5E 3H1LD 3GOBA 1G8KB 1OX3A 1FJKA 3B5NC 2FYUE 2FYUD 2KS1A 3KYQA 3LIDA 4PV1D 3VN0A 1HWTC 2WQYC 1ULIA 2O01J 1VQ4P 2NWFA 5CCHD 2KLUA 2AEJA 1HJBA 1PZQA 3PRJA 1KN7A 4WVZA 4OGQC 1MFZA 2HMLA 3RL0D 1SQVE 1LTGC 2ITAA 3FXDA 3L70D 3VOPA 3GTSA 1NO4A 1FU1A 1VM9A 3M9BA 2E76C 2YIUC 2XSHA 3H25A 3G6EP 3IR9A 4C7RA 4EI2A 1L4AC 2ZAEB 2P2UA 1IFDA 3PH0A 1VQLP 5APWA 3EQQA 1H88A 5AW3B 4NBGD 1ZN5A 5CHXA 1BGYG 2YVJB 3T97A 1M1KQ 1NH4A 4ASWA 4BRYB 1NTKK 3M0DC 2E43A 1JM0A 2Q6QA 1KILA 1SQQG 2H8PD 5AW2B 1SP4A 1PP9J 3BCCG 2MKVA 2WMMA 2YKQA 5DJTB 4PD4E 4R4LA 3RBXA 4IL6X 4PD4D 3L75G 1N7SA 1URQB 4H0LD 2DE7D 2SPZA 1MZ9A 1NTMK 4NB8D 3CX5I 1T8ZA 1JO5A 3H1HE 5E79H 5B66H 3CXHD 1ZV8A 1L0LJ 4NPFX 1FZBA 3VCAA 1WT6A 1LTSC 5KAIH 3W68A 1HBWA 1HGZA 2E4PA 3SFEC 1PL5A 4R4MA 2YMYA 2OYHB 1VPCA 1NYKA 2LR2A 2V4HA 1SFCC 2WSCH 3GL0A 2Z5HA 5TJHA 1KILD 2B88A 3I5CA 1SVFA 4Z1MH 1AA0A 3M0DA 2HODB 1EQ7A 2BCCG 4N6JA 2RMZA 1IK9A 2Y9YA 3CCMP 1J1DB 3L70G 2IYOA 1UIIA 3HUSB 1N7SD 1AQTA 2B87A 5GTHH 3GMAA 3A0HE 2R3SA 3PHLA 2Y9ZA 1LTJC 3VTPC 4GIFA 4IOIH 1X0TA 3OW2O 4QDCA 2XKMA 2WT7B 1USDA 1OVVA 1T6AA 2OARA 1BE3E 1ZR2A 1BE3D 1SQVJ 1AFOA 2E5TA 3H1JE 2G8YA 2FYNB 4PD4I 4MN4C 3H6PA 1FZEA 1J1EB 3CI9A 1MKMA 3NXSA 2PP6A 1H0TA 1YTZT 2KK7A 2N1TC 2ZXXA 3F5HA 3GCEA 1GU5A 1SFCA 3DQYA 3GL2A 1NTKJ 3E1RA 4I1LA 1M90Q 1YJNP 2L5GB 2XDJA 5CBOA 1WRGA 3V2PA 2K9YA 5APXA 2WSSH 1O7HA 4O9BA 5DJUB 4HJGH 1PGQA 3ITKA 1PV3A 3VMXA 1FS0E 4KHXA 1Q2NA 3I55P 2H89C 3S4RA 1ZP0C 1LTBC 2QRXA 2ZT9B 1QVFO 1VCKA 4LLHA 2POHA 2AEMA 1EG9A 1FAVA 2R44A 3A2AA 2W8ZA 2OYOA 2E74B 1NTMJ 2JJLA 4P1CH 3M06A 1KFNA 2WSFH 5CBNA 2D2CD 3AE1C 2KYVA 3CCVP 4ASVA 1Y8AA 3OJAB 2NPSB 5KKZB 1M7LA 2WTYA 5KLVE 5KLVD 4N78E 2FFDC 2IFNA 4N78D 5AVVB 1VL2A 4QDFB 1YYCA 1R5SA 2UWJE 1VQ5P 1GW4A 1SFCD 1YQ3C 1FDMA 3SWFA 3MUDC 2LXCB 3L71G 1JY2N 1NTZE 2N1TA 1DX7A 3P32A 1Q86Q 1L0NK 3L74G 5B66E 1NGMB 4D6TD 2PRRA 1HUCA 4HM0A 1NKZB 1U7MA 2ZYAA 2Z4EA 2FXOA 1VF5D 3L73J 4OH8B 1ZOYC 1QX8A 2V7QH 1PIXA 3HE5B 1MV8A 2ZYGA 1VQOP 3RK2B 1SQBK 4HB1A 1KQFB 3H1KE 3MP7B 1SQXG 3PJSK 4DZOA 2O1JA 2IBZD 4PV1C 3A3YB 2KZIA 1FC2C 5AVWB 2PAJA 4H44B 3HTKB 5TISE 2OTKE 4HM4A 2A45I 2RKLA 2M3EA 3AE4C 4Y99C 2W83C 1GK6A 3KZIH 1J1DC 2GUSA 3RL0C 1NJIQ 3OA7A 2IPPA 3HUSC 1IZNB 2N1TD 5APQA 5H2FH 3MUDA 3P7KA 4HJLA 1S9KE 2A06D 1H8AA 2OYIB 5KJ7A 5BVZA 1URQA 1Q90C 1NU1K 3RK3B 3I56P 3MIWA 3D6ZA 1T3UA 1PGJA 2QJYC 1EDJA 4YXWH 1A02J 3QWOC 2J58A 3CPWO 2NZ2A 1PP9E 2JZAA 1PP9D 2H43A 2WSEH 3U1CA 4IFMA 1J1EC 3PTZA 3FGAD 1IFMA 3E1IA 2P10A 1Q81Q 4JYCA 4WY4B 2OYHA 1JY3O 4NPEA 1JUNA 2KUBA 2N9BA 2IZ0A 1VQKP 5AW7B 1DD4A 2NVEA 3FX0A 1BCCJ 1L0LE 1SQPE 2HODA 1L0LD 4D6TG 2Y0DA 4H13B 2GA1A 3CXHH 4H0LC 3CMEP 1OVUA 1RQUA 3VMGD 1K9MQ 1BSHA 3BVHA 2WPRA 3HUSA 3UIAA 4ZMDA 2Q3WA 4EOTA 5KJ7D 4U3FD 1IC2A 1URQD 5B5EH 2IBZI 2FYZA 2KI7B 1L0NJ 1LWUC 4KT0J 1GDTA 4BWNA 2E74C 2KSEA 3VMYA 2KOGA 3GLMA 2WT7A 1CI6B 3GHGB 1SQQK 2IBZG 5APVA 3M9QA 4KJMA 2K3RA 1KILC 3CX5D 1VQMP 1DIPA 1SQBJ 1RF0A 5CXMA 5AW5B 3L36A 1PGOA 4HM5A 2JO1A 1KZUB 1OXZA 1XTCC 4XFJA 4M3LA 2WSCJ 2JP3A 1N7SC 3AECC 4EDFA 3AE7C 4XA4A 2A06G 3AE9C 1YBKA 3VYIA 3H1KJ 1X79B 2FY8A 1AVOA 2I1KA 1BSNA 2WWWA 1OZHA 1SQVD 2QM8A 1N73B 3U59A 3M0AA 3CCEP 5APTA 1NVOA 1G1IA 1K04A 1KORA 4PJ0E 1Q90D 2AXTH 3TGUG 2JWAA 1NTKE 1RIEA 2XNXA 1NTKD 1LWUA 1NU1J 1FZGA 1T2KD 1S72P 5AVZB 1PPJG 1RY3A 3M9HA 2QA4P 1IO4A 5APUA 1X22A 3Q5SA
chains in the Genus database with same CATH topology
1O7NA 1UUWA 5KLVE 2FYUE 2BCCE 4AAYB 3CXHE 4PD4E 4AIVA 4D6TE 1EZVE 2ZYLA 3N0QA 1BCCE 1O7GA 4HJLA 3L70E 4HM3A 4PV1D 4QDFB 2DE5D 3TGUE 3GZXA 4QURA 4QDDA 1ULIA 4H0LD 4QDFA 2DE6D 2QJPC 1BE3E 2DE7D 1Q90C 4NB8D 2NWFA 4NBFD 1SQQE 4NBBD 2B24A 3VMHD 4NB9D 3H1JE 2HMNA 2E75D 1KB9E 1PPJE 1NTME 1O7MA 2GBXA 2QJYC 2YFLA 3BCCE 1NU1E 2HMJA 4HM8A 1NTZE 1O7PA 1SJGA 3H1HE 2HMLA 5CXMA 1PP9E 5KLIC 2JZAA 2HMKA 2NVGA 1SQVE 3GB4A 4HKVA 4HM5A 2B1XA 1KYOE 4QCKA 2CKFA 1L0NE 2NUMA 2NUKA 3VCAA 2JO6A 4QUQA 4HM0A 3CWBE 5KKZC 3GTSA 3L75E 1O7WA 4EMJB 3GCEA 2E4PA 1VM9A 3EN1A 1P84E 1UUVA 3DQYA 3GL2A 2IBZE 4HM2A 4NBDD 1VF5D 2YIUC 2XSHA 2XRXA 1RFSA 2HMOA 2HMMA 1JM1A 3AZCA 5BOKA 4HM7A 1NYKA 1ZRTE 2NVFA 3C0DA 3L71E 3GL0A 2ZT9D 4NBHD 5AEUA 3D89A 1WQLA 3L74E 4U3FE 3EQQA 2E74D 2QJKC 4HM6A 1O7HA 4NBED 4OGQD 2YFIA 2YFJA 3L72E 2GBWA 2FYNC 3GTEA 3H1KE 1NDOA 4NBGD 1SQBE 3H1IE 2YVJB 1ULJA 2NVEA 2BMQA 1L0LE 1SQPE 4NBAD 4QUPA 2BMRA 4H13D 2XR8A 3VMID 1VCKA 2A06E 1FQTA 3FOUA 4H44D 1EG9A 2E76D 1NTKE 2QPZA 3VMGD 1RIEA 4HM4A 2E4QA 3L73E 3GKEA 4NBCD 2Q3WA 4P1BH 2I7FA 3VCPA 5AEWA 4P1CH 5HL4A 2D2CD 1G8JB 3H1LE 3CX5E 1SQXE 4HM1A 2BMOA 3GOBA 1G8KB 1BGYE 3GZYA 4QDCA 2XSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7N A;  1UUW A;  5KLV E;  2FYU E;  2BCC E;  4AAY B;  3CXH E;  4PD4 E;  4AIV A;  4D6T E;  1EZV E;  2ZYL A;  3N0Q A;  1BCC E;  1O7G A;  4HJL A;  3L70 E;  4HM3 A;  4PV1 D;  4QDF B;  2DE5 D;  3TGU E;  3GZX A;  4QUR A;  4QDD A;  1ULI A;  4H0L D;  4QDF A;  2DE6 D;  2QJP C;  1BE3 E;  2DE7 D;  1Q90 C;  4NB8 D;  2NWF A;  4NBF D;  1SQQ E;  4NBB D;  2B24 A;  3VMH D;  4NB9 D;  3H1J E;  2HMN A;  2E75 D;  1KB9 E;  1PPJ E;  1NTM E;  1O7M A;  2GBX A;  2QJY C;  2YFL A;  3BCC E;  1NU1 E;  2HMJ A;  4HM8 A;  1NTZ E;  1O7P A;  1SJG A;  3H1H E;  2HML A;  5CXM A;  1PP9 E;  5KLI C;  2JZA A;  2HMK A;  2NVG A;  1SQV E;  3GB4 A;  4HKV A;  4HM5 A;  2B1X A;  1KYO E;  4QCK A;  2CKF A;  1L0N E;  2NUM A;  2NUK A;  3VCA A;  2JO6 A;  4QUQ A;  4HM0 A;  3CWB E;  5KKZ C;  3GTS A;  3L75 E;  1O7W A;  4EMJ B;  3GCE A;  2E4P A;  1VM9 A;  3EN1 A;  1P84 E;  1UUV A;  3DQY A;  3GL2 A;  2IBZ E;  4HM2 A;  4NBD D;  1VF5 D;  2YIU C;  2XSH A;  2XRX A;  1RFS A;  2HMO A;  2HMM A;  1JM1 A;  3AZC A;  5BOK A;  4HM7 A;  1NYK A;  1ZRT E;  2NVF A;  3C0D A;  3L71 E;  3GL0 A;  2ZT9 D;  4NBH D;  5AEU A;  3D89 A;  1WQL A;  3L74 E;  4U3F E;  3EQQ A;  2E74 D;  2QJK C;  4HM6 A;  1O7H A;  4NBE D;  4OGQ D;  2YFI A;  2YFJ A;  3L72 E;  2GBW A;  2FYN C;  3GTE A;  3H1K E;  1NDO A;  4NBG D;  1SQB E;  3H1I E;  2YVJ B;  1ULJ A;  2NVE A;  2BMQ A;  1L0L E;  1SQP E;  4NBA D;  4QUP A;  2BMR A;  4H13 D;  2XR8 A;  3VMI D;  1VCK A;  2A06 E;  1FQT A;  3FOU A;  4H44 D;  1EG9 A;  2E76 D;  1NTK E;  2QPZ A;  3VMG D;  1RIE A;  4HM4 A;  2E4Q A;  3L73 E;  3GKE A;  4NBC D;  2Q3W A;  4P1B H;  2I7F A;  3VCP A;  5AEW A;  4P1C H;  5HL4 A;  2D2C D;  1G8J B;  3H1L E;  3CX5 E;  1SQX E;  4HM1 A;  2BMO A;  3GOB A;  1G8K B;  1BGY E;  3GZY A;  4QDC A;  2XSO A; 
#chains in the Genus database with same CATH topology
 4JF7 A;  4I7Z B;  2YKP A;  3CWB G;  3N4X A;  1RHZ B;  1NYH A;  1T3J A;  3S1K A;  2W6B A;  4QDF A;  3CD6 P;  4NBF D;  4N3Y B;  2P58 A;  5CCG A;  2O1K A;  3CLQ A;  3LW5 H;  3VMH D;  1JMM A;  1KB9 H;  1NTM E;  1NTM D;  2OYI C;  3Q3D A;  1GK4 A;  4U3F G;  5KLI C;  3VP8 A;  1FDO A;  2PFX A;  3H1I G;  4I6M C;  4HM2 A;  2QJK B;  3D71 A;  2JDI H;  2E5Y A;  2HMM A;  1DH3 A;  2XZR A;  4HM7 A;  2JR8 A;  2ZT9 D;  1M56 D;  3H1H D;  3G3Z A;  2D2C C;  3L4F A;  3HE5 A;  2IDB A;  1SQP J;  2C0X A;  2CPB A;  2E74 D;  4NBE D;  3H1L G;  3N7N A;  3GTE A;  2P1J A;  2C0W A;  1K73 Q;  2FYU G;  1KMI Z;  3NTN A;  1TU3 F;  2I1J A;  2KXP B;  1S2E A;  3HTK A;  2WSF J;  2RH0 A;  4WB4 A;  3L73 E;  3GKE A;  4NBC D;  2L91 A;  3L73 D;  4JYB A;  3G9R A;  1KTM A;  1JY2 P;  5BU8 B;  4LGD E;  2QIW A;  2YNY A;  1AV1 A;  1GL2 B;  5CCG D;  4EYY Q;  2RN0 A;  4AYC A;  1SQV G;  3L75 J;  1FDI A;  2KZJ A;  1VF5 C;  2OYI A;  2QJP C;  2P67 A;  1P84 H;  2YKO A;  1MFT A;  1FJP A;  4JPZ B;  2HMN A;  2M5A B;  2G3A A;  1BDC A;  2FXP A;  2HPC B;  1XTG B;  3P8C E;  2H7H A;  1FZC B;  3A0B H;  2R3C A;  3IN6 A;  4BXL A;  1ZME C;  1KYO H;  1KQL A;  4YTP C;  2NUM A;  2JO6 A;  3AEB C;  3RK2 D;  5APY A;  3CCS P;  2V7Q J;  3V2R A;  3EN1 A;  4WWI A;  5AVR B;  2E75 B;  2XRX A;  1SS1 A;  3H1J D;  2R5D A;  4UB6 H;  1FOS F;  2Q9I A;  4WY4 A;  1S3J A;  2M8R A;  2QEX P;  4HM6 A;  2BCC J;  3AE5 C;  3AEG C;  3GF3 A;  1GU4 A;  3OAK A;  4NBA D;  1GW3 A;  1U7J A;  2OTL P;  4XE5 B;  4HH2 A;  2IYP A;  2HLO A;  3Q5P A;  1GTW A;  3SSU A;  1JCD A;  1SQX K;  5HL4 A;  2W6A A;  1JTH B;  3RK3 E;  3HD7 B;  3RK3 D;  3H1H G;  1FZF A;  1NAY A;  3GZY A;  3B71 A;  1K8A Q;  1O7N A;  3RGU A;  2C9L Y;  4AAY B;  4AIV A;  2FBW C;  1EZV E;  1EZV D;  3KHU A;  1BCC E;  1O7G A;  4YPC A;  1CI6 A;  3H32 B;  3CC7 P;  3L37 A;  3GHG A;  2W90 A;  1M1J B;  1RF1 B;  4NBB D;  1BDD A;  3JCU H;  3P8M C;  1KB9 E;  4K3A A;  2GBX A;  3EFF K;  1N7L A;  3Q5R A;  1HJ0 A;  2WSE J;  4UB8 H;  3B8E B;  3C1L A;  4WY4 D;  4QCK A;  1L0N E;  2WZ7 A;  1L0N D;  2KLV A;  1O7W A;  1H89 A;  4AUW A;  4GKG A;  3G71 P;  4NBD D;  3PLN A;  3R2P A;  2Z5I A;  2YMK A;  5KJ7 C;  3A7O A;  1URQ C;  2BAS A;  1NTZ D;  1HH0 A;  2K37 A;  5E79 E;  5AEU A;  1YJW P;  3IAO A;  3B5N B;  2QJK C;  2O3J A;  3O8Z A;  1LNQ A;  3L72 E;  4GT1 A;  5KAI E;  1SQB E;  1SQB D;  3CX5 H;  1JEK A;  3K5B A;  5AW0 B;  4C7N B;  2FKW B;  1RE4 C;  1YI2 P;  1M57 D;  1JY3 N;  3BAT A;  1HGV A;  2CK3 H;  1BE3 G;  4OGQ B;  3H1J G;  5AEW A;  2OYH C;  3H1K D;  3RL0 g;  2W27 A;  3EQ2 A;  2LXB A;  5AVY B;  4QMA A;  2E76 B;  4BRY A;  1KD1 Q;  1NKN A;  2YIU B;  3JSV C;  1N2D C;  4IFD K;  3TNU B;  3AE8 C;  4JBZ A;  1L4A B;  1IFN A;  1S5L H;  5GTH E;  1LJ2 A;  3L71 J;  2CPS A;  5AVU B;  1LP1 B;  3L74 J;  2XV5 A;  1NU1 E;  1EZV I;  1NWQ A;  3V5B A;  2A45 G;  2B1X A;  4NPD A;  1KYO E;  2CKF A;  2YO3 A;  3KDP B;  4LC1 A;  3U1A A;  1S9K D;  1YHQ P;  1AQ5 A;  1AJY A;  3CCQ P;  1VQN P;  3CCJ P;  4I2L C;  2K88 A;  4L76 A;  2Q3E A;  3V4W A;  4UB6 E;  1T2K C;  5KTB A;  3C0D A;  2ZVO B;  1SQX J;  1EDI A;  2E75 C;  4ZKU A;  1RE4 A;  2FYN C;  1QLE D;  1RF0 C;  5KLV G;  1RQV A;  4PD4 H;  4B86 A;  3GF7 A;  3FOU A;  2QPZ A;  4IFF A;  3MD0 A;  3VCP A;  1NOH A;  4C46 A;  1Y9B A;  1OW8 A;  1NTZ G;  4TT3 H;  2J59 M;  1LT1 A;  1GL2 A;  3EFG A;  1BGY E;  2OQQ A;  2I8D A;  2KIK A;  1SQP D;  1E5W A;  2Q7C A;  5KAF H;  3ZDM A;  2JWD A;  3LW5 J;  1FOS E;  2J5U A;  2AEF A;  1R8E A;  2M0B A;  4K35 A;  5EFW B;  1G2C B;  2DE6 D;  5CCH A;  1SQQ E;  1U57 A;  2NRG A;  3JCU E;  1Q82 Q;  2ZT9 C;  2B24 A;  4DJG A;  1O7M A;  3BCC E;  2ZYD A;  2HMJ A;  2M5A A;  1ZW0 A;  4IL6 H;  2HPC A;  1M1J C;  1FZC A;  4RKU J;  3H1K G;  1HF9 A;  1OW7 A;  4QUQ A;  2OGU A;  2ZXE B;  5KKZ C;  2NPS C;  3L75 E;  4EMJ B;  3NFQ A;  3L75 D;  5K5G B;  3SWK A;  3TF5 A;  1YTZ I;  2Q3I A;  3L72 J;  3G4S P;  1LTJ B;  2IX7 C;  5CCG C;  3AEE C;  1EC5 A;  1ZR4 A;  3AEF C;  3BRT B;  1NDO A;  2R32 A;  1ULJ A;  3GW6 A;  1HTL C;  1W2E A;  2QM7 A;  1GL2 D;  2B89 A;  1JOC A;  3L35 A;  3AEA C;  3USS A;  1LT9 B;  3FWL A;  1S4X A;  1RE3 A;  2MJZ A;  4RO0 A;  3TYY A;  2O01 N;  1CZQ A;  4RJT A;  1IFP A;  2FYU K;  2B9B A;  1JTH A;  3CMA P;  3HD7 A;  1PP9 G;  2N1T B;  1VDF A;  4QDD A;  2YXR B;  3RK2 C;  1KQS O;  1UUW A;  2BCC E;  1OWA A;  2KNC B;  3Q2Y A;  2BCC D;  4HYT B;  3VMA A;  3L70 E;  2QSI A;  4HM3 A;  3H32 A;  1AVY A;  5AVQ B;  5AVX B;  1S5L E;  2HR3 A;  1M1J A;  3KZI E;  2AXC A;  4H44 C;  1RF1 A;  2E75 D;  1SQV K;  2NPS A;  3MGN A;  2WPQ A;  2H88 C;  1NAF A;  1N8R Q;  1WMK A;  2KB7 P;  1JCC A;  5AW8 B;  2NUK A;  5H2F E;  2HYN A;  2A45 H;  1ZLL A;  1L0L G;  1SQP G;  3WUU A;  1YIJ P;  3IFM A;  1IFJ A;  1LTA C;  4GOE A;  4GOF A;  5AVS B;  5BOK A;  2HMO A;  3CCL P;  4CPG A;  4RES B;  2ZVN B;  1K05 A;  2IFM A;  3RK3 C;  1FZA A;  3B5N A;  2YFJ A;  3CL3 D;  2FFD B;  2VRS A;  1USE A;  1EXJ A;  3AED C;  1IJD B;  2M3B A;  3HD7 D;  4C7N A;  3TGU J;  1FQT A;  1EXI A;  2IZ1 A;  1OW6 A;  1OFC X;  4P1B H;  1BGY J;  3SWY A;  2I7F A;  1S1C X;  4WY4 C;  1HVV A;  4HM1 A;  2Q5U A;  1Q7Y Q;  3CWB J;  2NPS D;  3CXH E;  1QGK B;  1UIX A;  5KAF E;  4DCK A;  1SQQ J;  3EWK A;  3BCC J;  1LTT C;  3FWN A;  3TNU A;  4AQR D;  3E7K A;  4H13 C;  1L4A A;  3WU2 H;  3F89 A;  1OIP A;  3B4S A;  3HE4 B;  5B5E E;  3FXE A;  2WPS A;  2GM4 A;  4U3F J;  5L8R J;  1LP1 A;  2O01 H;  2ZJS E;  1SJG A;  3H1I J;  4IL6 E;  3BRV B;  5C39 A;  1KIL E;  2DW3 A;  4PV1 B;  1CW5 A;  3KQG A;  3B5N D;  4ZKP A;  1VQ8 P;  3V6I A;  1QL2 A;  1JY3 P;  2Q1K A;  4OWF A;  2N9Y B;  4Y99 B;  3GHG C;  1NTK G;  3CCR P;  1YQ4 C;  2Y0C A;  4W7Z A;  3RL0 B;  5TIS H;  3ABV C;  1ZRT E;  1J2J B;  3L71 E;  4NBH D;  1ZRT D;  3P8C D;  3H1L J;  3L71 D;  3L74 E;  2OTJ P;  1SLQ A;  3MZW B;  3L74 D;  4OGQ D;  2FYU J;  3O6Q B;  2GBW A;  1LGH B;  3MTU E;  4DOJ A;  5M1B A;  4Y28 J;  3C9I A;  1W2B O;  3IF4 A;  1IK7 A;  2WVR A;  2K1A A;  4H44 D;  2E76 D;  2HG5 D;  2QJY B;  3AE6 C;  1M8O B;  3II6 A;  2K9J B;  4OVN F;  1PGP A;  3VMZ A;  1GMJ A;  1L4A D;  1NTM G;  1LT9 C;  3SFD C;  3VP9 A;  2WIT A;  4L74 A;  1SQX E;  3L70 J;  2BMO A;  1SQX D;  2XSO A;  2KS1 B;  1N73 C;  1R5L A;  5APS A;  2ZYL A;  2AXT E;  2BEZ F;  3KXD A;  3N0Q A;  2YO2 A;  1FBM A;  2DE5 D;  2HFE D;  1G2C A;  3V2Q A;  4NB9 D;  3CXH I;  1O7P A;  1EDK A;  2GUV A;  2HMK A;  4HKV A;  3W67 A;  3D70 A;  1BCC D;  4H0L B;  4YXD C;  1DEB A;  3HRN A;  4W80 A;  4I7Z C;  3JC2 2;  2JEE A;  3WUV A;  2PGD A;  3WMM 0;  5CJ0 A;  3D6Y A;  1RFS A;  1KV4 A;  1KB9 D;  2KSJ A;  5CJ4 A;  3L73 G;  2NVF A;  1G1J A;  1LWU B;  3D89 A;  1LTJ A;  3S9O A;  5BU5 A;  1JB0 J;  4HKZ H;  3T97 B;  5GTI H;  1QVG O;  1EDL A;  3TK1 A;  1QEX A;  1GD2 E;  2ZFC A;  2R5B A;  4H13 D;  1OVR A;  1RH5 B;  3NMD A;  1Z56 A;  1LT9 A;  1KIL B;  4JQ0 D;  5AW4 B;  2YXQ B;  1N73 A;  3H1H J;  2JKV A;  3L72 D;  3Q1M A;  1X9V A;  4L75 A;  1JNM A;  1G8J B;  5KLV K;  2YFL A;  4D6T E;  2KNC A;  1N7S B;  4W7Y A;  1D7M A;  4TLF A;  3PP5 A;  3WU2 E;  3CC2 P;  1NTZ K;  1OMI A;  3C8V A;  3KPE A;  3WUT A;  1PFI A;  3GB4 A;  3BAS A;  1CSB A;  1GL2 C;  1VQP P;  1YJ9 P;  2E42 A;  1P84 E;  1UUV A;  1KQG B;  2IBZ E;  1KC8 Q;  5CMZ A;  1L2P A;  1P84 D;  2XND H;  1JM1 A;  2Y0E A;  4PJ0 H;  1NU1 D;  5CCH C;  1DD3 A;  3A0B E;  1WQL A;  3TSI A;  1KYO D;  1YIT P;  4EIJ A;  2YFI A;  1N86 A;  2FFD A;  3RBZ A;  1FZC C;  1KB9 I;  2BMQ A;  1EZV G;  2LKM A;  4QUP A;  1BCC G;  2BMR A;  1BE3 J;  3VMI D;  1JMB A;  2A06 E;  4GDO A;  1Y47 A;  3H1J J;  2B87 B;  3M91 A;  5KLI B;  2W6J H;  5AW9 B;  3V2N A;  1X8Y A;  3AE2 C;  3QH9 A;  1JY2 O;  4HM8 A;  1L0N G;  3MHV A;  1VQ6 P;  2FXM A;  1IFI A;  3TGU E;  3CC4 P;  3GZX A;  4QUR A;  3TGU D;  3GG2 A;  1QL1 A;  2D2C B;  1RE3 C;  3HE4 A;  2KP8 A;  1PPJ E;  5AW1 B;  1PPJ D;  1BGY D;  2XU6 A;  2NVG A;  3A5T A;  3L72 G;  1FE6 A;  2QG4 A;  1GZL A;  1SQB G;  1H0T B;  3HD7 C;  3R4Y A;  2C9N Y;  3CWB E;  3CWB D;  1SFC B;  1DEE G;  5AW6 B;  1VQ7 P;  1SQQ D;  4DT0 A;  4A7P A;  3AZC A;  1ZXG A;  4L73 A;  3BCC D;  4UB8 E;  4WBA A;  3TDK A;  1MUU A;  1RF1 C;  1LTI C;  4U3F E;  1KFM A;  5KLV J;  4U7J A;  1E79 H;  1P84 I;  1L0L K;  1SQP K;  3H1I E;  3O6Q A;  5GTI E;  3H1I D;  1VQ9 P;  5AVT B;  1VF5 B;  3LIE A;  2WPV B;  3CCU P;  3AE3 C;  2QJP B;  3V4Q A;  2XR8 A;  1A02 F;  1KYO I;  1NHL A;  2QE7 H;  4ZNC A;  2QVA A;  1W5C E;  2E4Q A;  2P7J A;  3A0H H;  1NTZ J;  2K9J A;  4GOD A;  1S5L X;  2BEQ D;  1NU1 G;  4D6T J;  3H1L E;  3CX5 E;  3H1L D;  3GOB A;  1G8K B;  1OX3 A;  1FJK A;  3B5N C;  2FYU E;  2FYU D;  2KS1 A;  3KYQ A;  3LID A;  4PV1 D;  3VN0 A;  1HWT C;  2WQY C;  1ULI A;  2O01 J;  1VQ4 P;  2NWF A;  5CCH D;  2KLU A;  2AEJ A;  1HJB A;  1PZQ A;  3PRJ A;  1KN7 A;  4WVZ A;  4OGQ C;  1MFZ A;  2HML A;  3RL0 D;  1SQV E;  1LTG C;  2ITA A;  3FXD A;  3L70 D;  3VOP A;  3GTS A;  1NO4 A;  1FU1 A;  1VM9 A;  3M9B A;  2E76 C;  2YIU C;  2XSH A;  3H25 A;  3G6E P;  3IR9 A;  4C7R A;  4EI2 A;  1L4A C;  2ZAE B;  2P2U A;  1IFD A;  3PH0 A;  1VQL P;  5APW A;  3EQQ A;  1H88 A;  5AW3 B;  4NBG D;  1ZN5 A;  5CHX A;  1BGY G;  2YVJ B;  3T97 A;  1M1K Q;  1NH4 A;  4ASW A;  4BRY B;  1NTK K;  3M0D C;  2E43 A;  1JM0 A;  2Q6Q A;  1KIL A;  1SQQ G;  2H8P D;  5AW2 B;  1SP4 A;  1PP9 J;  3BCC G;  2MKV A;  2WMM A;  2YKQ A;  5DJT B;  4PD4 E;  4R4L A;  3RBX A;  4IL6 X;  4PD4 D;  3L75 G;  1N7S A;  1URQ B;  4H0L D;  2DE7 D;  2SPZ A;  1MZ9 A;  1NTM K;  4NB8 D;  3CX5 I;  1T8Z A;  1JO5 A;  3H1H E;  5E79 H;  5B66 H;  3CXH D;  1ZV8 A;  1L0L J;  4NPF X;  1FZB A;  3VCA A;  1WT6 A;  1LTS C;  5KAI H;  3W68 A;  1HBW A;  1HGZ A;  2E4P A;  3SFE C;  1PL5 A;  4R4M A;  2YMY A;  2OYH B;  1VPC A;  1NYK A;  2LR2 A;  2V4H A;  1SFC C;  2WSC H;  3GL0 A;  2Z5H A;  5TJH A;  1KIL D;  2B88 A;  3I5C A;  1SVF A;  4Z1M H;  1AA0 A;  3M0D A;  2HOD B;  1EQ7 A;  2BCC G;  4N6J A;  2RMZ A;  1IK9 A;  2Y9Y A;  3CCM P;  1J1D B;  3L70 G;  2IYO A;  1UII A;  3HUS B;  1N7S D;  1AQT A;  2B87 A;  5GTH H;  3GMA A;  3A0H E;  2R3S A;  3PHL A;  2Y9Z A;  1LTJ C;  3VTP C;  4GIF A;  4IOI H;  1X0T A;  3OW2 O;  4QDC A;  2XKM A;  2WT7 B;  1USD A;  1OVV A;  1T6A A;  2OAR A;  1BE3 E;  1ZR2 A;  1BE3 D;  1SQV J;  1AFO A;  2E5T A;  3H1J E;  2G8Y A;  2FYN B;  4PD4 I;  4MN4 C;  3H6P A;  1FZE A;  1J1E B;  3CI9 A;  1MKM A;  3NXS A;  2PP6 A;  1H0T A;  1YTZ T;  2KK7 A;  2N1T C;  2ZXX A;  3F5H A;  3GCE A;  1GU5 A;  1SFC A;  3DQY A;  3GL2 A;  1NTK J;  3E1R A;  4I1L A;  1M90 Q;  1YJN P;  2L5G B;  2XDJ A;  5CBO A;  1WRG A;  3V2P A;  2K9Y A;  5APX A;  2WSS H;  1O7H A;  4O9B A;  5DJU B;  4HJG H;  1PGQ A;  3ITK A;  1PV3 A;  3VMX A;  1FS0 E;  4KHX A;  1Q2N A;  3I55 P;  2H89 C;  3S4R A;  1ZP0 C;  1LTB C;  2QRX A;  2ZT9 B;  1QVF O;  1VCK A;  4LLH A;  2POH A;  2AEM A;  1EG9 A;  1FAV A;  2R44 A;  3A2A A;  2W8Z A;  2OYO A;  2E74 B;  1NTM J;  2JJL A;  4P1C H;  3M06 A;  1KFN A;  2WSF H;  5CBN A;  2D2C D;  3AE1 C;  2KYV A;  3CCV P;  4ASV A;  1Y8A A;  3OJA B;  2NPS B;  5KKZ B;  1M7L A;  2WTY A;  5KLV E;  5KLV D;  4N78 E;  2FFD C;  2IFN A;  4N78 D;  5AVV B;  1VL2 A;  4QDF B;  1YYC A;  1R5S A;  2UWJ E;  1VQ5 P;  1GW4 A;  1SFC D;  1YQ3 C;  1FDM A;  3SWF A;  3MUD C;  2LXC B;  3L71 G;  1JY2 N;  1NTZ E;  2N1T A;  1DX7 A;  3P32 A;  1Q86 Q;  1L0N K;  3L74 G;  5B66 E;  1NGM B;  4D6T D;  2PRR A;  1HUC A;  4HM0 A;  1NKZ B;  1U7M A;  2ZYA A;  2Z4E A;  2FXO A;  1VF5 D;  3L73 J;  4OH8 B;  1ZOY C;  1QX8 A;  2V7Q H;  1PIX A;  3HE5 B;  1MV8 A;  2ZYG A;  1VQO P;  3RK2 B;  1SQB K;  4HB1 A;  1KQF B;  3H1K E;  3MP7 B;  1SQX G;  3PJS K;  4DZO A;  2O1J A;  2IBZ D;  4PV1 C;  3A3Y B;  2KZI A;  1FC2 C;  5AVW B;  2PAJ A;  4H44 B;  3HTK B;  5TIS E;  2OTK E;  4HM4 A;  2A45 I;  2RKL A;  2M3E A;  3AE4 C;  4Y99 C;  2W83 C;  1GK6 A;  3KZI H;  1J1D C;  2GUS A;  3RL0 C;  1NJI Q;  3OA7 A;  2IPP A;  3HUS C;  1IZN B;  2N1T D;  5APQ A;  5H2F H;  3MUD A;  3P7K A;  4HJL A;  1S9K E;  2A06 D;  1H8A A;  2OYI B;  5KJ7 A;  5BVZ A;  1URQ A;  1Q90 C;  1NU1 K;  3RK3 B;  3I56 P;  3MIW A;  3D6Z A;  1T3U A;  1PGJ A;  2QJY C;  1EDJ A;  4YXW H;  1A02 J;  3QWO C;  2J58 A;  3CPW O;  2NZ2 A;  1PP9 E;  2JZA A;  1PP9 D;  2H43 A;  2WSE H;  3U1C A;  4IFM A;  1J1E C;  3PTZ A;  3FGA D;  1IFM A;  3E1I A;  2P10 A;  1Q81 Q;  4JYC A;  4WY4 B;  2OYH A;  1JY3 O;  4NPE A;  1JUN A;  2KUB A;  2N9B A;  2IZ0 A;  1VQK P;  5AW7 B;  1DD4 A;  2NVE A;  3FX0 A;  1BCC J;  1L0L E;  1SQP E;  2HOD A;  1L0L D;  4D6T G;  2Y0D A;  4H13 B;  2GA1 A;  3CXH H;  4H0L C;  3CME P;  1OVU A;  1RQU A;  3VMG D;  1K9M Q;  1BSH A;  3BVH A;  2WPR A;  3HUS A;  3UIA A;  4ZMD A;  2Q3W A;  4EOT A;  5KJ7 D;  4U3F D;  1IC2 A;  1URQ D;  5B5E H;  2IBZ I;  2FYZ A;  2KI7 B;  1L0N J;  1LWU C;  4KT0 J;  1GDT A;  4BWN A;  2E74 C;  2KSE A;  3VMY A;  2KOG A;  3GLM A;  2WT7 A;  1CI6 B;  3GHG B;  1SQQ K;  2IBZ G;  5APV A;  3M9Q A;  4KJM A;  2K3R A;  1KIL C;  3CX5 D;  1VQM P;  1DIP A;  1SQB J;  1RF0 A;  5CXM A;  5AW5 B;  3L36 A;  1PGO A;  4HM5 A;  2JO1 A;  1KZU B;  1OXZ A;  1XTC C;  4XFJ A;  4M3L A;  2WSC J;  2JP3 A;  1N7S C;  3AEC C;  4EDF A;  3AE7 C;  4XA4 A;  2A06 G;  3AE9 C;  1YBK A;  3VYI A;  3H1K J;  1X79 B;  2FY8 A;  1AVO A;  2I1K A;  1BSN A;  2WWW A;  1OZH A;  1SQV D;  2QM8 A;  1N73 B;  3U59 A;  3M0A A;  3CCE P;  5APT A;  1NVO A;  1G1I A;  1K04 A;  1KOR A;  4PJ0 E;  1Q90 D;  2AXT H;  3TGU G;  2JWA A;  1NTK E;  1RIE A;  2XNX A;  1NTK D;  1LWU A;  1NU1 J;  1FZG A;  1T2K D;  1S72 P;  5AVZ B;  1PPJ G;  1RY3 A;  3M9H A;  2QA4 P;  1IO4 A;  5APU A;  1X22 A;  3Q5S A; 
#chains in the Genus database with same CATH homology
 1O7N A;  1UUW A;  5KLV E;  2FYU E;  2BCC E;  4AAY B;  3CXH E;  4PD4 E;  4AIV A;  4D6T E;  1EZV E;  2ZYL A;  3N0Q A;  1BCC E;  1O7G A;  4HJL A;  3L70 E;  4HM3 A;  4PV1 D;  4QDF B;  2DE5 D;  3TGU E;  3GZX A;  4QUR A;  4QDD A;  1ULI A;  4H0L D;  4QDF A;  2DE6 D;  2QJP C;  1BE3 E;  2DE7 D;  1Q90 C;  4NB8 D;  2NWF A;  4NBF D;  1SQQ E;  4NBB D;  2B24 A;  3VMH D;  4NB9 D;  3H1J E;  2HMN A;  2E75 D;  1KB9 E;  1PPJ E;  1NTM E;  1O7M A;  2GBX A;  2QJY C;  2YFL A;  3BCC E;  1NU1 E;  2HMJ A;  4HM8 A;  1NTZ E;  1O7P A;  1SJG A;  3H1H E;  2HML A;  5CXM A;  1PP9 E;  5KLI C;  2JZA A;  2HMK A;  2NVG A;  1SQV E;  3GB4 A;  4HKV A;  4HM5 A;  2B1X A;  1KYO E;  4QCK A;  2CKF A;  1L0N E;  2NUM A;  2NUK A;  3VCA A;  2JO6 A;  4QUQ A;  4HM0 A;  3CWB E;  5KKZ C;  3GTS A;  3L75 E;  1O7W A;  4EMJ B;  3GCE A;  2E4P A;  1VM9 A;  3EN1 A;  1P84 E;  1UUV A;  3DQY A;  3GL2 A;  2IBZ E;  4HM2 A;  4NBD D;  1VF5 D;  2YIU C;  2XSH A;  2XRX A;  1RFS A;  2HMO A;  2HMM A;  1JM1 A;  3AZC A;  5BOK A;  4HM7 A;  1NYK A;  1ZRT E;  2NVF A;  3C0D A;  3L71 E;  3GL0 A;  2ZT9 D;  4NBH D;  5AEU A;  3D89 A;  1WQL A;  3L74 E;  4U3F E;  3EQQ A;  2E74 D;  2QJK C;  4HM6 A;  1O7H A;  4NBE D;  4OGQ D;  2YFI A;  2YFJ A;  3L72 E;  2GBW A;  2FYN C;  3GTE A;  3H1K E;  1NDO A;  4NBG D;  1SQB E;  3H1I E;  2YVJ B;  1ULJ A;  2NVE A;  2BMQ A;  1L0L E;  1SQP E;  4NBA D;  4QUP A;  2BMR A;  4H13 D;  2XR8 A;  3VMI D;  1VCK A;  2A06 E;  1FQT A;  3FOU A;  4H44 D;  1EG9 A;  2E76 D;  1NTK E;  2QPZ A;  3VMG D;  1RIE A;  4HM4 A;  2E4Q A;  3L73 E;  3GKE A;  4NBC D;  2Q3W A;  4P1B H;  2I7F A;  3VCP A;  5AEW A;  4P1C H;  5HL4 A;  2D2C D;  1G8J B;  3H1L E;  3CX5 E;  1SQX E;  4HM1 A;  2BMO A;  3GOB A;  1G8K B;  1BGY E;  3GZY A;  4QDC A;  2XSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...