2BCCE

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
total genus 41
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2bccE02
4H13D 3L74E 1UUVA 3H1JE 3GL2A 3H1HE 2HMNA 1P84E 3GTEA 2D2CD 3EQQA 1NTZE 4NBDD 3DQYA 1UUWA 2QPZA 4HM1A 3GZYA 4NBED 1VM9A 2HMKA 2HMOA 1VCKA 2I7FA 2XR8A 2E4PA 3VMHD 3FOUA 1RIEA 2NUKA 1G8JB 2YFLA 1L0LE 1BCCE 1O7PA 4HM8A 3GL0A 1ULIA 1SQVE 2ZYLA 4HM3A 3GOBA 2GBWA 2FYNC 2QJPC 3CXHE 2QJYC 1L0NE 4NBHD 1SQPE 1NTKE 2NWFA 2YFJA 2HMLA 4HM0A 4NBFD 1SQBE 1O7GA 2XSOA 2E74D 2CKFA 4HM5A 1EZVE 2YVJB 4P1BH 3AZCA 4HKVA 4QUPA 4NBAD 4H0LD 5KKZC 1PPJE 1SQQE 1BGYE 4PD4E 1EG9A 4NBCD 4QDFB 2IBZE 4NBGD 3GZXA 4EMJB 3D89A 3GTSA 4U3FE 2E4QA 3CX5E 3C0DA 1KB9E 3EN1A 2B1XA 2DE6D 1O7NA 2Q3WA 4AAYB 1O7HA 2BMRA 4P1CH 2XRXA 1SJGA 1Q90C 3L71E 2NUMA 5CXMA 1SQXE 3VMGD 4HJLA 4OGQD 5AEUA 1G8KB 5KLVE 3BCCE 4AIVA 4QDFA 3H1LE 3N0QA 2JZAA 4HM6A 2BMQA 2JO6A 1NDOA 1NYKA 4D6TE 3H1IE 1O7MA 3GKEA 2ZT9D 3VMID 4HM4A 1NU1E 1BE3E 2NVFA 3TGUE 3L75E 2E75D 5KLIC 1VF5D 1KYOE 2NVEA 2GBXA 5AEWA 4NB8D 2BCCE 3H1KE 3VCAA 1WQLA 1PP9E 5HL4A 2DE7D 2NVGA 1O7WA 1ULJA 3CWBE 2YIUC 4QDCA 4PV1D 2A06E 3GB4A 1FQTA 4NB9D 4HM7A 2QJKC 3VCPA 2YFIA 1RFSA 4QURA 2B24A 1ZRTE 2BMOA 2XSHA 4QCKA 1NTME 4H44D 2DE5D 4QDDA 4NBBD 2HMMA 4HM2A 3L70E 2E76D 2HMJA 3GCEA 3L72E 3L73E 4QUQA 5BOKA 2FYUE 1JM1A
chains in the Genus database with same CATH superfamily
3CMEP 1SQQJ 3PLNA 2P58A 3HUSC 1IFJA 4U3FJ 4PJ0H 2JO1A 1SFCA 1NTKG 5AVXB 1HVVA 1FBMA 3BRVB 3N7NA 2LXBA 2ZYLA 4PJ0E 3D71A 1Y9BA 1EZVG 3H1LJ 2KXPB 1URQB 2YO2A 2P1JA 2ZJSE 3CPWO 2KUBA 3AE8C 3RK2C 3BCCD 2YKPA 1NTKK 1YYCA 1S2EA 3Q5SA 2AEFA 2IBZE 1L4AB 1S4XA 1KILB 2AXTH 3D89A 1M1JC 1URQA 3H1KD 3C0DA 2FXOA 5EFWB 1SLQA 3FX0A 3GG2A 2KI7B 1P84I 2AXTE 3GMAA 1PV3A 1Q90C 5APUA 1H8AA 5AVZB 1M8OB 3N0QA 1SQVD 1KILA 2BMQA 4H13B 2RN0A 2HR3A 2H8PD 1RHZB 5KLVD 1H88A 3IR9A 3CC4P 2BCCE 4AUWA 2Z5IA 1GL2B 5B5EH 1L4AD 1FJPA 2KIKA 4GODA 3IFMA 5L8RJ 2K9YA 3V6IA 1JB0J 4NBBD 3CXHD 1UIXA 5B66E 1GL2A 1YHQP 2Y0DA 3WUUA 1RY3A 4H13D 1UUVA 3JSVC 3GL2A 1FZAA 3IF4A 3DQYA 4RESB 1VQ6P 1GL2D 1LWUB 1M1JB 1BGYD 1LTJC 2H88C 3R4YA 1XTGB 2Q6QA 4DT0A 2QJYC 3BCCJ 3B5NB 1NTKE 3LW5J 3RL0C 1NOHA 2HYNA 2NWFA 1IFDA 3E1RA 1SQQG 1LWUA 1EZVE 1M1JA 3I56P 4U3FG 1OWAA 4WBAA 3HE4B 4HKVA 4QUPA 5KKZC 1JY2N 2E76C 3B5NA 3CXHI 2R3SA 5C39A 1JY3O 1FOSF 1RE4A 1U7JA 3H1LG 1SQQK 1JUNA 3B5ND 3HE4A 2WSFH 3VP8A 5KLVJ 1KB9H 2JZAA 1GMJA 3D6YA 1HBWA 3L72D 5CCHC 1FDMA 3L4FA 4B86A 2JR8A 2QJKC 1MUUA 4XFJA 2AXCA 3TSIA 2B24A 1LNQA 1BCCD 3II6A 3T97B 4IL6X 1T2KC 2HMMA 3GCEA 3ITKA 3L73E 1IFMA 1N7SC 2XU6A 3AE4C 3H32B 1BGYJ 2R32A 3EWKA 2WITA 3M0AA 3T97A 3V2NA 1K05A 2WSEH 1EDIA 1N2DC 1SQBJ 3H32A 1X79B 4OGQB 1OW8A 3G4SP 4HB1A 2ZT9B 3BVHA 2CKFA 3H6PA 1EDLA 4O9BA 4U7JA 2PAJA 1SQQE 5AVUB 4YPCA 1G2CB 1OZHA 1LT9C 2O01N 4PV1B 4U3FE 4BWNA 2QA4P 3CD6P 2OQQA 3BCCG 1IK7A 2QJKB 1R8EA 1FOSE 2BMRA 4GIFA 1FS0E 3OA7A 1RF0A 2Y9YA 3Q2YA 2HLOA 1S5LX 3L72J 2KLUA 4OGQD 4DZOA 2FYUG 1G2CA 3H1LE 3H1KG 5APYA 3HE5B 3GKEA 2ZT9D 2Z5HA 3AE2C 1KQSO 3RBZA 3VCAA 1RF1C 1BCCJ 2M0BA 4PV1D 1SQVG 1PGPA 1YJNP 3HE5A 5KLVG 3CCVP 2ZYAA 1RE3C 2IBZI 1YQ3C 4CPGA 4XE5B 3VMXA 3V4QA 1QL2A 2MJZA 3A0BE 4LC1A 3MUDC 2IPPA 2BASA 5AW1B 2ZYDA 5KLVK 2W83C 2NUKA 5KAFH 1BSHA 3L71G 3CX5D 1NKNA 1P84H 2FYNC 4RO0A 3W67A 1MFTA 1JY2O 5KAFE 3KQGA 1N73C 1FZCB 1BGYG 1VDFA 2BEZF 2PFXA 5AW5B 3SFEC 3H1ID 1EG9A 2E75C 1GD2E 3AEDC 2JP3A 3GZXA 3L74D 2HG5D 1FZCA 2O1JA 4WY4C 4EIJA 1M56D 5CXMA 4HJLA 2QVAA 4I1LA 1L2PA 3BCCE 4AIVA 2XNDH 3W68A 1RF1A 1JO5A 3A5TA 5AW0B 2XV5A 2NVEA 1Q81Q 1N7LA 4IFFA 3H1KE 4QDCA 3CCSP 2IYOA 3L72G 2VRSA 1L0LD 3VMYA 3CCQP 2OARA 3CL3D 2N1TB 1SQPD 3FWNA 2HMJA 1CI6B 5KLVE 1NJIQ 3GLMA 1BCCG 4Y99C 3H25A 5DJUB 4H0LC 2QRXA 2XR8A 2N1TA 1LP1B 1CI6A 2GBWA 2GUVA 4C7RA 3CXHE 3RGUA 1ZR2A 4NBHD 1VQ4P 3H1IJ 4L74A 4H44B 1OVUA 1SP4A 2W90A 3MTUE 2P2UA 1LP1A 4NBAD 2POHA 1BGYE 1Q7YQ 1VF5C 2FXMA 3HD7B 2R5DA 3USSA 2NPSB 1S3JA 4DJGA 4W80A 5GTHH 3WUTA 1T3JA 4L75A 3PTZA 1KC8Q 2G8YA 1ZRTD 4YXDC 3HD7A 3CC2P 3L70D 4HM4A 2NPSA 2R5BA 1L0LJ 2OYHB 2ZAEB 4EI2A 4LGDE 2B89A 2E42A 2NPSD 1SQPJ 4EOTA 4HKZH 2E5TA 1ZMEC 3GW6A 2W6AA 3EQ2A 3L72E 1YIJP 3G6EP 3M9HA 1EXJA 1X9VA 1PPJG 2E74C 4NBDD 1DEEG 5APSA 1VM9A 2HMOA 3P32A 2QJPB 1IFPA 1BCCE 3MHVA 1O7PA 2KZIA 3M9QA 2WSSH 2WPSA 2IYPA 4P1BH 3Q1MA 2RKLA 5AVSB 1ZN5A 3OAKA 1FZFA 4D6TD 1OXZA 3JCUH 1X0TA 4DOJA 3RK3B 1J1EB 2DE6D 2JWAA 2O01H 3JCUE 1SFCD 2KSJA 3H1IG 1OMIA 2CK3H 1Q2NA 3BASA 3L74G 1CW5A 4HM6A 2JO6A 2N9BA 5H2FH 2J58A 2YXRB 2NVFA 5AVQB 3B71A 2FYUD 2UWJE 5APVA 1KQGB 2Q3IA 3V2PA 2IFNA 4NB8D 2V4HA 5HL4A 5KJ7A 5H2FE 1HWTC 3RK3D 1CSBA 2Z4EA 3QH9A 1X22A 2WPVB 1FQTA 3AEGC 1URQD 5KJ7D 1YTZT 2GM4A 2I8DA 3S4RA 2P10A 2BEQD 1FDIA 1Q86Q 1FZBA 3C8VA 3HUSB 1JM1A 1KILD 1L0LG 1YI2P 2Q9IA 2JWDA 4NBED 5B66H 1SQPG 4PD4D 5APTA 1OIPA 4IL6E 2M5AB 3L36A 3WUVA 4AQRD 3BRTB 4K3AA 3HUSA 3PRJA 3RK2B 1J1DC 5CJ0A 3L71D 4D6TJ 1M7LA 4NPFX 3CCUP 2YXQB 4I7ZC 1L0LK 1ZXGA 1SQPK 4W7ZA 2M5AA 3S9OA 2B9BA 3A3YB 3TGUD 3L75D 2FYZA 3BATA 3CX5E 3EN1A 3VP9A 2Y0EA 4NPDA 1O7HA 2Y0CA 3P7KA 3VMGD 1S72P 2FYUJ 3RK2D 3H1KJ 4PD4I 2ZVOB 5AW4B 3H1IE 3TK1A 1LGHB 5M1BA 3H1HD 1MV8A 1EC5A 1SQVJ 1S5LE 1Q90D 3WU2H 2R44A 3A0HH 3L70G 2IDBA 2V7QJ 1FZEA 4L73A 1AFOA 1HF9A 1DD4A 2W8ZA 1VL2A 3AE1C 3WU2E 3A0HE 3MIWA 4WB4A 2QSIA 3B4SA 3OW2O 2WQYC 1AV1A 1HUCA 3GTEA 4GKGA 1LTJB 2HFED 1Z56A 1VCKA 1U57A 2QJYB 1RIEA 3L71J 1L0LE 3RL0B 2WSCJ 1U7MA 1OX3A 1SQPE 1KQFB 2C9LY 5AW8B 1XTCC 2FKWB 1KV4A 1LTJA 4HM0A 4I2LC 3TGUJ 3L75J 1O7GA 3SWYA 5KKZB 1WRGA 2OTJP 2E76B 3P8MC 1JCCA 3AE9C 1NU1D 4GT1A 1KQLA 4EMJB 4MN4C 2Q3WA 5GTIE 3RL0D 4C7NB 2RH0A 4D6TG 1IZNB 2C9NY 1EQ7A 1W2EA 2WPRA 3ABVC 1IC2A 3H1HJ 2J5UA 3GHGC 4TLFA 1LTGC 3AEFC 3B8EB 1WQLA 4C7NA 1VQ9P 3V5BA 4HM7A 5CCHA 4Y28J 3VYIA 1ZRTE 3O6QB 1N7SB 3V2QA 3L70E 1Q82Q 5CCHD 4ZKUA 1DIPA 3TDKA 1E5WA 1ZW0A 1LTTC 3TNUB 3O6QA 2KLVA 1N7SA 3GZYA 2B87B 1PPJD 2FYUK 1HGZA 3A0BH 1T2KD 2ZYGA 5CMZA 1N7SD 4JF7A 3CMAP 3TNUA 5K5GB 4HM5A 2B87A 1SQVK 5AW3B 2FFDC 1LT9B 3O8ZA 3VTPC 4QDFB 3A7OA 5AVRB 1PP9D 5APQA 5CCGC 1FE6A 2QIWA 3TGUG 3L75G 1LT9A 1LTSC 5TJHA 4QDFA 5CHXA 4D6TE 1N86A 3CCJP 1K9MQ 1RF1B 3JC22 3RL0g 2G3AA 1HH0A 2KYVA 1ZLLA 2NVGA 2D2CC 3LW5H 2KS1B 1KN7A 2YIUC 4DCKA 2O1KA 2I1JA 2QM8A 1VQKP 3FGAD 5E79E 2YFIA 3AEBC 4N3YB 2K1AA 2O3JA 1YQ4C 3R2PA 4JYBA 3I55P 3H1HG 1GTWA 1L0ND 3CX5I 3HTKB 1EDJA 5APXA 3MZWB 3P8CD 2FYUE 2XDJA 2KS1A 1JMMA 2IX7C 3NFQA 1RE3A 2KP8A 3QWOC 3RK3E 3VMAA 1R5SA 1VQ5P 4HM1A 2HMKA 2LKMA 2FYNB 2V7QH 4WWIA 3HTKA 3MUDA 1Y8AA 3FXDA 1SQVE 1EDKA 1KB9D 5AVVB 3CCRP 1N73B 1QGKB 1FZGA 3C1LA 1SQXD 4PD4H 2NZ2A 2GUSA 2PGDA 4XA4A 1KILE 2E75B 1PP9J 3CXHH 3I5CA 4PD4E 5AVWB 3M0DC 1N73A 1BDDA 1RH5B 3L73D 4NBGD 1T8ZA 1Y47A 4WY4B 1W5CE 2E4QA 2WSCH 4BXLA 4A7PA 2A45G 3S1KA 1D7MA 3CWBD 4P1CH 2A06D 2XKMA 3AECC 3L71E 1MFZA 2NUMA 1JEKA 2N1TD 1NU1G 2QM7A 3L74J 2KB7P 3Q5RA 1VQ7P 4WY4A 1GK4A 2E75D 1KORA 3L75E 3TGUE 3RBXA 4ZMDA 5CBNA 4EDFA 3WMM0 3H1JD 1ZOYC 4WY4D 1JM0A 1NHLA 1GW3A 1NU1K 2I1KA 3NXSA 1VQMP 1GDTA 2KOGA 1K04A 2YNYA 4QCKA 4H44D 4QDDA 4HM2A 1SFCC 4Y99B 3E7KA 2JKVA 3H1HE 3HD7D 4H0LB 2SPZA 2OYIC 3EQQA 3GF7A 2OTKE 1GU5A 3E1IA 2Q3EA 1SQXJ 1VQLP 2QEXP 3AEAC 1A02F 1M57D 2K9JB 4AYCA 2JEEA 4NBFD 1URQC 1JTHB 4GOEA 1VF5B 3KHUA 4H0LD 1AVOA 3CWBJ 1BE3D 5TISH 5DJTB 1IFNA 4C46A 2K9JA 3CC7P 1L4AC 1KILC 5TISE 1JTHA 3UIAA 2KSEA 1FC2C 1G1JA 1LT1A 2WWWA 1BDCA 5BU5A 3AE7C 1T3UA 1EXIA 1K8AQ 3H1JJ 1PP9G 2IZ0A 3U59A 1NYKA 1NU1E 2DW3A 2YKQA 1VF5D 2K88A 2GBXA 5AW7B 5AEWA 1KFMA 4HJGH 4H13C 2OYIB 2E43A 2NRGA 2HODB 1P84D 1O7WA 2WMMA 1FDOA 2C0XA 1NTZD 3GB4A 1ZP0C 4W7YA 1GL2C 4NB9D 3L70J 3VCPA 5AW6B 2FBWC 2Q7CA 2H43A 1GU4A 3U1CA 4TT3H 2OYIA 2JJLA 2HODA 2E74B 2M3EA 3CCMP 3KDPB 2AEMA 1SVFA 3G3ZA 3CI9A 2QPZA 2P67A 1L0NG 4KT0J 2L5GB 3VMHD 3EFFK 1G8JB 2MKVA 1LWUC 1YITP 3GOBA 2N9YB 4KJMA 1NVOA 1GW4A 3AE3C 3B5NC 1BE3J 2E74D 4IL6H 1KMIZ 2YVJB 3NMDA 1E79H 1RE4C 1L0NK 1L4AA 1LTBC 1PPJE 2HPCB 2IZ1A 4GDOA 1KYOD 2K3RA 1SQXG 4IFMA 2B1XA 1O7NA 2WTYA 1S9KD 2XRXA 3CCLP 1SJGA 3Q3DA 5AEUA 3L73G 5B5EE 1FAVA 2HPCA 1VPCA 3CX5H 3TYYA 3PP5A 1MKMA 1KTMA 3CWBG 1NTZJ 1SQXK 2A06G 2Q5UA 1IO4A 4QMAA 4IFDK 1PP9E 2OYOA 2FY8A 4WVZA 1ULJA 3AE5C 1N8RQ 1JY3P 1JNMA 1GZLA 3H1JG 3M91A 1KYOI 5AVYB 3PHLA 1QX8A 1S5LH 1ZV8A 2Q1KA 3L74E 1SQBD 3SFDC 3VN0A 1YBKA 1AVYA 1HGVA 4OH8B 2XNXA 2WZ7A 4N6JA 2YFLA 1J1DB 3Q5PA 1AQTA 1L0NE 4I7ZB 3P8CE 2P7JA 1NAYA 4Z1MH 4OGQC 2WT7B 2ZXEB 3L35A 3F5HA 1R5LA 1NAFA 3MGNA 2ZT9C 1RF0C 3KYQA 1HTLC 1NO4A 4R4LA 1PFIA 1KB9E 2KK7A 3C9IA 2WT7A 4PV1C 1SQXE 1QVFO 2YO3A 3V2RA 5CJ4A 1BE3G 3G71P 1KD1Q 3FWLA 2R3CA 3LIEA 3SWFA 1NTMD 4N78D 1JCDA 1RQUA 4ZKPA 5GTIH 3VMID 4K35A 5AVTB 2H89C 1QVGO 2DE7D 4ASVA 3CWBE 2QG4A 3CCEP 3FXEA 4YXWH 3ZDMA 2A06E 2W27A 2Y9ZA 4I6MC 1OVRA 1NYHA 3PJSK 3V4WA 1VQNP 1MZ9A 3SWKA 1M90Q 2DE5D 3TF5A 2E76D 1NTZG 4JQ0D 1OVVA 3A2AA 3H1JE 1ZR4A 2CPBA 1IFIA 2A45I 4JBZA 3D70A 1X8YA 4RKUJ 3FOUA 3F89A 2IBZD 4RJTA 4JPZB 3M9BA 4HM3A 2J59M 1NTZK 2ITAA 5KTBA 2WPQA 1CZQA 2QE7H 4UB6H 3OJAB 1FZCC 2FXPA 1LJ2A 1PGQA 2ZVNB 1NWQA 4YTPC 4UB6E 3GTSA 2BCCD 2ZXXA 2H7HA 2C0WA 1WT6A 1NTMJ 4EYYQ 1BSNA 1NU1J 1JY2P 5CBOA 2YKOA 3GHGB 3IAOA 3VOPA 2JDIH 1BE3E 1H0TB 1NGMB 1K73Q 2CPSA 2KNCB 1AA0A 4HH2A 1VQOP 3GHGA 4NPEA 2BMOA 1H0TA 4BRYB 2O01J 1YJ9P 1NTKD 4QUQA 5E79H 2LR2A 2KNCA 1TU3F 2N1TC 4OWFA 1QLED 5BVZA 1P84E 1EZVD 2K37A 1NTZE 4JYCA 1M1KQ 1DD3A 1A02J 2PRRA 3IN6A 1KZUB 4BRYA 1JOCA 2L91A 3LIDA 4IOIH 1SQBG 3MD0A 1PZQA 1QEXA 5BU8B 2YFJA 2HMLA 2W6JH 1FU1A 2XZRA 2FFDB 1OFCX 3KPEA 1T6AA 1GK6A 2BCCJ 2M3BA 1LTIC 1W2BO 4H44C 3AZCA 2E5YA 2PP6A 3SSUA 1SQBK 1LTAC 1AQ5A 3HD7C 2B88A 4AAYB 2FFDA 5AW9B 4M3LA 1EZVI 1DH3A 2NPSC 1G8KB 1KYOH 1OW6A 5CCGA 1NDOA 4KHXA 1O7MA 1G1IA 5KLIC 1KYOE 2D2CB 4ASWA 2YIUB 2IFMA 4LLHA 3HRNA 1VQ8P 5CCGD 1S9KE 1NTMG 1AJYA 1WMKA 1IJDB 1NTKJ 3CLQA 4ZNCA 2OYHC 3G9RA 2AEJA 1UIIA 1USEA 1NKZB 3NTNA 1KB9I 4R4MA 5BOKA 4L76A 3K5BA 2OTLP 1HJ0A 2HMNA 2W6BA 1NTMK 2D2CD 5AW2B 1SS1A 1UUWA 1L0NJ 1SQQD 2I7FA 2E4PA 1H89A 3D6ZA 4HM8A 4U3FD 1ULIA 3GL0A 1S1CX 1OW7A 2QJPC 2KZJA 1KFNA 2GA1A 1SQBE 1PGOA 2XSOA 2WSFJ 1DX7A 2IBZG 3U1AA 5KLIB 3H1LD 1RQVA 4UB8H 5GTHE 1JMBA 3VMZA 2YMKA 1DEBA 4GOFA 2YMYA 3M06A 4NBCD 2RMZA 1USDA 2WVRA 4HYTB 2M8RA 4UB8E 2LXCB 3RK3C 1PGJA 3M0DA 3AEEC 1J1EC 1YTZI 5APWA 3L73J 3EFGA 1YJWP 5KJ7C 2BCCG 3N4XA 1VQPP 1JY3N 3PH0A 1NH4A 1PL5A 1FJKA 4OVNF 2OYHA 2A45H 5KAIH 1IK9A 1PIXA 2ZFCA 3KXDA 1J2JB 3AE6C 3GF3A 1QL1A 3L37A 1HJBA 3KZIH 1RFSA 5KAIE 4QURA 2WSEJ 2OGUA 1SFCB 2XSHA 1NTME 4N78E 3KZIE 3MP7B
chains in the Genus database with same CATH topology
4H13D 3L74E 1UUVA 3H1JE 3GL2A 3H1HE 2HMNA 1P84E 3GTEA 2D2CD 3EQQA 1NTZE 4NBDD 3DQYA 1UUWA 2QPZA 4HM1A 3GZYA 4NBED 1VM9A 2HMKA 2HMOA 1VCKA 2I7FA 2XR8A 2E4PA 3VMHD 3FOUA 1RIEA 2NUKA 1G8JB 2YFLA 1L0LE 1BCCE 1O7PA 4HM8A 3GL0A 1ULIA 1SQVE 2ZYLA 4HM3A 3GOBA 2GBWA 2FYNC 2QJPC 3CXHE 2QJYC 1L0NE 4NBHD 1SQPE 1NTKE 2NWFA 2YFJA 2HMLA 4HM0A 4NBFD 1SQBE 1O7GA 2XSOA 2E74D 2CKFA 4HM5A 1EZVE 2YVJB 4P1BH 3AZCA 4HKVA 4QUPA 4NBAD 4H0LD 5KKZC 1PPJE 1SQQE 1BGYE 4PD4E 1EG9A 4NBCD 4QDFB 2IBZE 4NBGD 3GZXA 4EMJB 3D89A 3GTSA 4U3FE 2E4QA 3CX5E 3C0DA 1KB9E 3EN1A 2B1XA 2DE6D 1O7NA 2Q3WA 4AAYB 1O7HA 2BMRA 4P1CH 2XRXA 1SJGA 1Q90C 3L71E 2NUMA 5CXMA 1SQXE 3VMGD 4HJLA 4OGQD 5AEUA 1G8KB 5KLVE 3BCCE 4AIVA 4QDFA 3H1LE 3N0QA 2JZAA 4HM6A 2BMQA 2JO6A 1NDOA 1NYKA 4D6TE 3H1IE 1O7MA 3GKEA 2ZT9D 3VMID 4HM4A 1NU1E 1BE3E 2NVFA 3TGUE 3L75E 2E75D 5KLIC 1VF5D 1KYOE 2NVEA 2GBXA 5AEWA 4NB8D 2BCCE 3H1KE 3VCAA 1WQLA 1PP9E 5HL4A 2DE7D 2NVGA 1O7WA 1ULJA 3CWBE 2YIUC 4QDCA 4PV1D 2A06E 3GB4A 1FQTA 4NB9D 4HM7A 2QJKC 3VCPA 2YFIA 1RFSA 4QURA 2B24A 1ZRTE 2BMOA 2XSHA 4QCKA 1NTME 4H44D 2DE5D 4QDDA 4NBBD 2HMMA 4HM2A 3L70E 2E76D 2HMJA 3GCEA 3L72E 3L73E 4QUQA 5BOKA 2FYUE 1JM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H13 D;  3L74 E;  1UUV A;  3H1J E;  3GL2 A;  3H1H E;  2HMN A;  1P84 E;  3GTE A;  2D2C D;  3EQQ A;  1NTZ E;  4NBD D;  3DQY A;  1UUW A;  2QPZ A;  4HM1 A;  3GZY A;  4NBE D;  1VM9 A;  2HMK A;  2HMO A;  1VCK A;  2I7F A;  2XR8 A;  2E4P A;  3VMH D;  3FOU A;  1RIE A;  2NUK A;  1G8J B;  2YFL A;  1L0L E;  1BCC E;  1O7P A;  4HM8 A;  3GL0 A;  1ULI A;  1SQV E;  2ZYL A;  4HM3 A;  3GOB A;  2GBW A;  2FYN C;  2QJP C;  3CXH E;  2QJY C;  1L0N E;  4NBH D;  1SQP E;  1NTK E;  2NWF A;  2YFJ A;  2HML A;  4HM0 A;  4NBF D;  1SQB E;  1O7G A;  2XSO A;  2E74 D;  2CKF A;  4HM5 A;  1EZV E;  2YVJ B;  4P1B H;  3AZC A;  4HKV A;  4QUP A;  4NBA D;  4H0L D;  5KKZ C;  1PPJ E;  1SQQ E;  1BGY E;  4PD4 E;  1EG9 A;  4NBC D;  4QDF B;  2IBZ E;  4NBG D;  3GZX A;  4EMJ B;  3D89 A;  3GTS A;  4U3F E;  2E4Q A;  3CX5 E;  3C0D A;  1KB9 E;  3EN1 A;  2B1X A;  2DE6 D;  1O7N A;  2Q3W A;  4AAY B;  1O7H A;  2BMR A;  4P1C H;  2XRX A;  1SJG A;  1Q90 C;  3L71 E;  2NUM A;  5CXM A;  1SQX E;  3VMG D;  4HJL A;  4OGQ D;  5AEU A;  1G8K B;  5KLV E;  3BCC E;  4AIV A;  4QDF A;  3H1L E;  3N0Q A;  2JZA A;  4HM6 A;  2BMQ A;  2JO6 A;  1NDO A;  1NYK A;  4D6T E;  3H1I E;  1O7M A;  3GKE A;  2ZT9 D;  3VMI D;  4HM4 A;  1NU1 E;  1BE3 E;  2NVF A;  3TGU E;  3L75 E;  2E75 D;  5KLI C;  1VF5 D;  1KYO E;  2NVE A;  2GBX A;  5AEW A;  4NB8 D;  2BCC E;  3H1K E;  3VCA A;  1WQL A;  1PP9 E;  5HL4 A;  2DE7 D;  2NVG A;  1O7W A;  1ULJ A;  3CWB E;  2YIU C;  4QDC A;  4PV1 D;  2A06 E;  3GB4 A;  1FQT A;  4NB9 D;  4HM7 A;  2QJK C;  3VCP A;  2YFI A;  1RFS A;  4QUR A;  2B24 A;  1ZRT E;  2BMO A;  2XSH A;  4QCK A;  1NTM E;  4H44 D;  2DE5 D;  4QDD A;  4NBB D;  2HMM A;  4HM2 A;  3L70 E;  2E76 D;  2HMJ A;  3GCE A;  3L72 E;  3L73 E;  4QUQ A;  5BOK A;  2FYU E;  1JM1 A; 
#chains in the Genus database with same CATH topology
 3CME P;  1SQQ J;  3PLN A;  2P58 A;  3HUS C;  1IFJ A;  4U3F J;  4PJ0 H;  2JO1 A;  1SFC A;  1NTK G;  5AVX B;  1HVV A;  1FBM A;  3BRV B;  3N7N A;  2LXB A;  2ZYL A;  4PJ0 E;  3D71 A;  1Y9B A;  1EZV G;  3H1L J;  2KXP B;  1URQ B;  2YO2 A;  2P1J A;  2ZJS E;  3CPW O;  2KUB A;  3AE8 C;  3RK2 C;  3BCC D;  2YKP A;  1NTK K;  1YYC A;  1S2E A;  3Q5S A;  2AEF A;  2IBZ E;  1L4A B;  1S4X A;  1KIL B;  2AXT H;  3D89 A;  1M1J C;  1URQ A;  3H1K D;  3C0D A;  2FXO A;  5EFW B;  1SLQ A;  3FX0 A;  3GG2 A;  2KI7 B;  1P84 I;  2AXT E;  3GMA A;  1PV3 A;  1Q90 C;  5APU A;  1H8A A;  5AVZ B;  1M8O B;  3N0Q A;  1SQV D;  1KIL A;  2BMQ A;  4H13 B;  2RN0 A;  2HR3 A;  2H8P D;  1RHZ B;  5KLV D;  1H88 A;  3IR9 A;  3CC4 P;  2BCC E;  4AUW A;  2Z5I A;  1GL2 B;  5B5E H;  1L4A D;  1FJP A;  2KIK A;  4GOD A;  3IFM A;  5L8R J;  2K9Y A;  3V6I A;  1JB0 J;  4NBB D;  3CXH D;  1UIX A;  5B66 E;  1GL2 A;  1YHQ P;  2Y0D A;  3WUU A;  1RY3 A;  4H13 D;  1UUV A;  3JSV C;  3GL2 A;  1FZA A;  3IF4 A;  3DQY A;  4RES B;  1VQ6 P;  1GL2 D;  1LWU B;  1M1J B;  1BGY D;  1LTJ C;  2H88 C;  3R4Y A;  1XTG B;  2Q6Q A;  4DT0 A;  2QJY C;  3BCC J;  3B5N B;  1NTK E;  3LW5 J;  3RL0 C;  1NOH A;  2HYN A;  2NWF A;  1IFD A;  3E1R A;  1SQQ G;  1LWU A;  1EZV E;  1M1J A;  3I56 P;  4U3F G;  1OWA A;  4WBA A;  3HE4 B;  4HKV A;  4QUP A;  5KKZ C;  1JY2 N;  2E76 C;  3B5N A;  3CXH I;  2R3S A;  5C39 A;  1JY3 O;  1FOS F;  1RE4 A;  1U7J A;  3H1L G;  1SQQ K;  1JUN A;  3B5N D;  3HE4 A;  2WSF H;  3VP8 A;  5KLV J;  1KB9 H;  2JZA A;  1GMJ A;  3D6Y A;  1HBW A;  3L72 D;  5CCH C;  1FDM A;  3L4F A;  4B86 A;  2JR8 A;  2QJK C;  1MUU A;  4XFJ A;  2AXC A;  3TSI A;  2B24 A;  1LNQ A;  1BCC D;  3II6 A;  3T97 B;  4IL6 X;  1T2K C;  2HMM A;  3GCE A;  3ITK A;  3L73 E;  1IFM A;  1N7S C;  2XU6 A;  3AE4 C;  3H32 B;  1BGY J;  2R32 A;  3EWK A;  2WIT A;  3M0A A;  3T97 A;  3V2N A;  1K05 A;  2WSE H;  1EDI A;  1N2D C;  1SQB J;  3H32 A;  1X79 B;  4OGQ B;  1OW8 A;  3G4S P;  4HB1 A;  2ZT9 B;  3BVH A;  2CKF A;  3H6P A;  1EDL A;  4O9B A;  4U7J A;  2PAJ A;  1SQQ E;  5AVU B;  4YPC A;  1G2C B;  1OZH A;  1LT9 C;  2O01 N;  4PV1 B;  4U3F E;  4BWN A;  2QA4 P;  3CD6 P;  2OQQ A;  3BCC G;  1IK7 A;  2QJK B;  1R8E A;  1FOS E;  2BMR A;  4GIF A;  1FS0 E;  3OA7 A;  1RF0 A;  2Y9Y A;  3Q2Y A;  2HLO A;  1S5L X;  3L72 J;  2KLU A;  4OGQ D;  4DZO A;  2FYU G;  1G2C A;  3H1L E;  3H1K G;  5APY A;  3HE5 B;  3GKE A;  2ZT9 D;  2Z5H A;  3AE2 C;  1KQS O;  3RBZ A;  3VCA A;  1RF1 C;  1BCC J;  2M0B A;  4PV1 D;  1SQV G;  1PGP A;  1YJN P;  3HE5 A;  5KLV G;  3CCV P;  2ZYA A;  1RE3 C;  2IBZ I;  1YQ3 C;  4CPG A;  4XE5 B;  3VMX A;  3V4Q A;  1QL2 A;  2MJZ A;  3A0B E;  4LC1 A;  3MUD C;  2IPP A;  2BAS A;  5AW1 B;  2ZYD A;  5KLV K;  2W83 C;  2NUK A;  5KAF H;  1BSH A;  3L71 G;  3CX5 D;  1NKN A;  1P84 H;  2FYN C;  4RO0 A;  3W67 A;  1MFT A;  1JY2 O;  5KAF E;  3KQG A;  1N73 C;  1FZC B;  1BGY G;  1VDF A;  2BEZ F;  2PFX A;  5AW5 B;  3SFE C;  3H1I D;  1EG9 A;  2E75 C;  1GD2 E;  3AED C;  2JP3 A;  3GZX A;  3L74 D;  2HG5 D;  1FZC A;  2O1J A;  4WY4 C;  4EIJ A;  1M56 D;  5CXM A;  4HJL A;  2QVA A;  4I1L A;  1L2P A;  3BCC E;  4AIV A;  2XND H;  3W68 A;  1RF1 A;  1JO5 A;  3A5T A;  5AW0 B;  2XV5 A;  2NVE A;  1Q81 Q;  1N7L A;  4IFF A;  3H1K E;  4QDC A;  3CCS P;  2IYO A;  3L72 G;  2VRS A;  1L0L D;  3VMY A;  3CCQ P;  2OAR A;  3CL3 D;  2N1T B;  1SQP D;  3FWN A;  2HMJ A;  1CI6 B;  5KLV E;  1NJI Q;  3GLM A;  1BCC G;  4Y99 C;  3H25 A;  5DJU B;  4H0L C;  2QRX A;  2XR8 A;  2N1T A;  1LP1 B;  1CI6 A;  2GBW A;  2GUV A;  4C7R A;  3CXH E;  3RGU A;  1ZR2 A;  4NBH D;  1VQ4 P;  3H1I J;  4L74 A;  4H44 B;  1OVU A;  1SP4 A;  2W90 A;  3MTU E;  2P2U A;  1LP1 A;  4NBA D;  2POH A;  1BGY E;  1Q7Y Q;  1VF5 C;  2FXM A;  3HD7 B;  2R5D A;  3USS A;  2NPS B;  1S3J A;  4DJG A;  4W80 A;  5GTH H;  3WUT A;  1T3J A;  4L75 A;  3PTZ A;  1KC8 Q;  2G8Y A;  1ZRT D;  4YXD C;  3HD7 A;  3CC2 P;  3L70 D;  4HM4 A;  2NPS A;  2R5B A;  1L0L J;  2OYH B;  2ZAE B;  4EI2 A;  4LGD E;  2B89 A;  2E42 A;  2NPS D;  1SQP J;  4EOT A;  4HKZ H;  2E5T A;  1ZME C;  3GW6 A;  2W6A A;  3EQ2 A;  3L72 E;  1YIJ P;  3G6E P;  3M9H A;  1EXJ A;  1X9V A;  1PPJ G;  2E74 C;  4NBD D;  1DEE G;  5APS A;  1VM9 A;  2HMO A;  3P32 A;  2QJP B;  1IFP A;  1BCC E;  3MHV A;  1O7P A;  2KZI A;  3M9Q A;  2WSS H;  2WPS A;  2IYP A;  4P1B H;  3Q1M A;  2RKL A;  5AVS B;  1ZN5 A;  3OAK A;  1FZF A;  4D6T D;  1OXZ A;  3JCU H;  1X0T A;  4DOJ A;  3RK3 B;  1J1E B;  2DE6 D;  2JWA A;  2O01 H;  3JCU E;  1SFC D;  2KSJ A;  3H1I G;  1OMI A;  2CK3 H;  1Q2N A;  3BAS A;  3L74 G;  1CW5 A;  4HM6 A;  2JO6 A;  2N9B A;  5H2F H;  2J58 A;  2YXR B;  2NVF A;  5AVQ B;  3B71 A;  2FYU D;  2UWJ E;  5APV A;  1KQG B;  2Q3I A;  3V2P A;  2IFN A;  4NB8 D;  2V4H A;  5HL4 A;  5KJ7 A;  5H2F E;  1HWT C;  3RK3 D;  1CSB A;  2Z4E A;  3QH9 A;  1X22 A;  2WPV B;  1FQT A;  3AEG C;  1URQ D;  5KJ7 D;  1YTZ T;  2GM4 A;  2I8D A;  3S4R A;  2P10 A;  2BEQ D;  1FDI A;  1Q86 Q;  1FZB A;  3C8V A;  3HUS B;  1JM1 A;  1KIL D;  1L0L G;  1YI2 P;  2Q9I A;  2JWD A;  4NBE D;  5B66 H;  1SQP G;  4PD4 D;  5APT A;  1OIP A;  4IL6 E;  2M5A B;  3L36 A;  3WUV A;  4AQR D;  3BRT B;  4K3A A;  3HUS A;  3PRJ A;  3RK2 B;  1J1D C;  5CJ0 A;  3L71 D;  4D6T J;  1M7L A;  4NPF X;  3CCU P;  2YXQ B;  4I7Z C;  1L0L K;  1ZXG A;  1SQP K;  4W7Z A;  2M5A A;  3S9O A;  2B9B A;  3A3Y B;  3TGU D;  3L75 D;  2FYZ A;  3BAT A;  3CX5 E;  3EN1 A;  3VP9 A;  2Y0E A;  4NPD A;  1O7H A;  2Y0C A;  3P7K A;  3VMG D;  1S72 P;  2FYU J;  3RK2 D;  3H1K J;  4PD4 I;  2ZVO B;  5AW4 B;  3H1I E;  3TK1 A;  1LGH B;  5M1B A;  3H1H D;  1MV8 A;  1EC5 A;  1SQV J;  1S5L E;  1Q90 D;  3WU2 H;  2R44 A;  3A0H H;  3L70 G;  2IDB A;  2V7Q J;  1FZE A;  4L73 A;  1AFO A;  1HF9 A;  1DD4 A;  2W8Z A;  1VL2 A;  3AE1 C;  3WU2 E;  3A0H E;  3MIW A;  4WB4 A;  2QSI A;  3B4S A;  3OW2 O;  2WQY C;  1AV1 A;  1HUC A;  3GTE A;  4GKG A;  1LTJ B;  2HFE D;  1Z56 A;  1VCK A;  1U57 A;  2QJY B;  1RIE A;  3L71 J;  1L0L E;  3RL0 B;  2WSC J;  1U7M A;  1OX3 A;  1SQP E;  1KQF B;  2C9L Y;  5AW8 B;  1XTC C;  2FKW B;  1KV4 A;  1LTJ A;  4HM0 A;  4I2L C;  3TGU J;  3L75 J;  1O7G A;  3SWY A;  5KKZ B;  1WRG A;  2OTJ P;  2E76 B;  3P8M C;  1JCC A;  3AE9 C;  1NU1 D;  4GT1 A;  1KQL A;  4EMJ B;  4MN4 C;  2Q3W A;  5GTI E;  3RL0 D;  4C7N B;  2RH0 A;  4D6T G;  1IZN B;  2C9N Y;  1EQ7 A;  1W2E A;  2WPR A;  3ABV C;  1IC2 A;  3H1H J;  2J5U A;  3GHG C;  4TLF A;  1LTG C;  3AEF C;  3B8E B;  1WQL A;  4C7N A;  1VQ9 P;  3V5B A;  4HM7 A;  5CCH A;  4Y28 J;  3VYI A;  1ZRT E;  3O6Q B;  1N7S B;  3V2Q A;  3L70 E;  1Q82 Q;  5CCH D;  4ZKU A;  1DIP A;  3TDK A;  1E5W A;  1ZW0 A;  1LTT C;  3TNU B;  3O6Q A;  2KLV A;  1N7S A;  3GZY A;  2B87 B;  1PPJ D;  2FYU K;  1HGZ A;  3A0B H;  1T2K D;  2ZYG A;  5CMZ A;  1N7S D;  4JF7 A;  3CMA P;  3TNU A;  5K5G B;  4HM5 A;  2B87 A;  1SQV K;  5AW3 B;  2FFD C;  1LT9 B;  3O8Z A;  3VTP C;  4QDF B;  3A7O A;  5AVR B;  1PP9 D;  5APQ A;  5CCG C;  1FE6 A;  2QIW A;  3TGU G;  3L75 G;  1LT9 A;  1LTS C;  5TJH A;  4QDF A;  5CHX A;  4D6T E;  1N86 A;  3CCJ P;  1K9M Q;  1RF1 B;  3JC2 2;  3RL0 g;  2G3A A;  1HH0 A;  2KYV A;  1ZLL A;  2NVG A;  2D2C C;  3LW5 H;  2KS1 B;  1KN7 A;  2YIU C;  4DCK A;  2O1K A;  2I1J A;  2QM8 A;  1VQK P;  3FGA D;  5E79 E;  2YFI A;  3AEB C;  4N3Y B;  2K1A A;  2O3J A;  1YQ4 C;  3R2P A;  4JYB A;  3I55 P;  3H1H G;  1GTW A;  1L0N D;  3CX5 I;  3HTK B;  1EDJ A;  5APX A;  3MZW B;  3P8C D;  2FYU E;  2XDJ A;  2KS1 A;  1JMM A;  2IX7 C;  3NFQ A;  1RE3 A;  2KP8 A;  3QWO C;  3RK3 E;  3VMA A;  1R5S A;  1VQ5 P;  4HM1 A;  2HMK A;  2LKM A;  2FYN B;  2V7Q H;  4WWI A;  3HTK A;  3MUD A;  1Y8A A;  3FXD A;  1SQV E;  1EDK A;  1KB9 D;  5AVV B;  3CCR P;  1N73 B;  1QGK B;  1FZG A;  3C1L A;  1SQX D;  4PD4 H;  2NZ2 A;  2GUS A;  2PGD A;  4XA4 A;  1KIL E;  2E75 B;  1PP9 J;  3CXH H;  3I5C A;  4PD4 E;  5AVW B;  3M0D C;  1N73 A;  1BDD A;  1RH5 B;  3L73 D;  4NBG D;  1T8Z A;  1Y47 A;  4WY4 B;  1W5C E;  2E4Q A;  2WSC H;  4BXL A;  4A7P A;  2A45 G;  3S1K A;  1D7M A;  3CWB D;  4P1C H;  2A06 D;  2XKM A;  3AEC C;  3L71 E;  1MFZ A;  2NUM A;  1JEK A;  2N1T D;  1NU1 G;  2QM7 A;  3L74 J;  2KB7 P;  3Q5R A;  1VQ7 P;  4WY4 A;  1GK4 A;  2E75 D;  1KOR A;  3L75 E;  3TGU E;  3RBX A;  4ZMD A;  5CBN A;  4EDF A;  3WMM 0;  3H1J D;  1ZOY C;  4WY4 D;  1JM0 A;  1NHL A;  1GW3 A;  1NU1 K;  2I1K A;  3NXS A;  1VQM P;  1GDT A;  2KOG A;  1K04 A;  2YNY A;  4QCK A;  4H44 D;  4QDD A;  4HM2 A;  1SFC C;  4Y99 B;  3E7K A;  2JKV A;  3H1H E;  3HD7 D;  4H0L B;  2SPZ A;  2OYI C;  3EQQ A;  3GF7 A;  2OTK E;  1GU5 A;  3E1I A;  2Q3E A;  1SQX J;  1VQL P;  2QEX P;  3AEA C;  1A02 F;  1M57 D;  2K9J B;  4AYC A;  2JEE A;  4NBF D;  1URQ C;  1JTH B;  4GOE A;  1VF5 B;  3KHU A;  4H0L D;  1AVO A;  3CWB J;  1BE3 D;  5TIS H;  5DJT B;  1IFN A;  4C46 A;  2K9J A;  3CC7 P;  1L4A C;  1KIL C;  5TIS E;  1JTH A;  3UIA A;  2KSE A;  1FC2 C;  1G1J A;  1LT1 A;  2WWW A;  1BDC A;  5BU5 A;  3AE7 C;  1T3U A;  1EXI A;  1K8A Q;  3H1J J;  1PP9 G;  2IZ0 A;  3U59 A;  1NYK A;  1NU1 E;  2DW3 A;  2YKQ A;  1VF5 D;  2K88 A;  2GBX A;  5AW7 B;  5AEW A;  1KFM A;  4HJG H;  4H13 C;  2OYI B;  2E43 A;  2NRG A;  2HOD B;  1P84 D;  1O7W A;  2WMM A;  1FDO A;  2C0X A;  1NTZ D;  3GB4 A;  1ZP0 C;  4W7Y A;  1GL2 C;  4NB9 D;  3L70 J;  3VCP A;  5AW6 B;  2FBW C;  2Q7C A;  2H43 A;  1GU4 A;  3U1C A;  4TT3 H;  2OYI A;  2JJL A;  2HOD A;  2E74 B;  2M3E A;  3CCM P;  3KDP B;  2AEM A;  1SVF A;  3G3Z A;  3CI9 A;  2QPZ A;  2P67 A;  1L0N G;  4KT0 J;  2L5G B;  3VMH D;  3EFF K;  1G8J B;  2MKV A;  1LWU C;  1YIT P;  3GOB A;  2N9Y B;  4KJM A;  1NVO A;  1GW4 A;  3AE3 C;  3B5N C;  1BE3 J;  2E74 D;  4IL6 H;  1KMI Z;  2YVJ B;  3NMD A;  1E79 H;  1RE4 C;  1L0N K;  1L4A A;  1LTB C;  1PPJ E;  2HPC B;  2IZ1 A;  4GDO A;  1KYO D;  2K3R A;  1SQX G;  4IFM A;  2B1X A;  1O7N A;  2WTY A;  1S9K D;  2XRX A;  3CCL P;  1SJG A;  3Q3D A;  5AEU A;  3L73 G;  5B5E E;  1FAV A;  2HPC A;  1VPC A;  3CX5 H;  3TYY A;  3PP5 A;  1MKM A;  1KTM A;  3CWB G;  1NTZ J;  1SQX K;  2A06 G;  2Q5U A;  1IO4 A;  4QMA A;  4IFD K;  1PP9 E;  2OYO A;  2FY8 A;  4WVZ A;  1ULJ A;  3AE5 C;  1N8R Q;  1JY3 P;  1JNM A;  1GZL A;  3H1J G;  3M91 A;  1KYO I;  5AVY B;  3PHL A;  1QX8 A;  1S5L H;  1ZV8 A;  2Q1K A;  3L74 E;  1SQB D;  3SFD C;  3VN0 A;  1YBK A;  1AVY A;  1HGV A;  4OH8 B;  2XNX A;  2WZ7 A;  4N6J A;  2YFL A;  1J1D B;  3Q5P A;  1AQT A;  1L0N E;  4I7Z B;  3P8C E;  2P7J A;  1NAY A;  4Z1M H;  4OGQ C;  2WT7 B;  2ZXE B;  3L35 A;  3F5H A;  1R5L A;  1NAF A;  3MGN A;  2ZT9 C;  1RF0 C;  3KYQ A;  1HTL C;  1NO4 A;  4R4L A;  1PFI A;  1KB9 E;  2KK7 A;  3C9I A;  2WT7 A;  4PV1 C;  1SQX E;  1QVF O;  2YO3 A;  3V2R A;  5CJ4 A;  1BE3 G;  3G71 P;  1KD1 Q;  3FWL A;  2R3C A;  3LIE A;  3SWF A;  1NTM D;  4N78 D;  1JCD A;  1RQU A;  4ZKP A;  5GTI H;  3VMI D;  4K35 A;  5AVT B;  2H89 C;  1QVG O;  2DE7 D;  4ASV A;  3CWB E;  2QG4 A;  3CCE P;  3FXE A;  4YXW H;  3ZDM A;  2A06 E;  2W27 A;  2Y9Z A;  4I6M C;  1OVR A;  1NYH A;  3PJS K;  3V4W A;  1VQN P;  1MZ9 A;  3SWK A;  1M90 Q;  2DE5 D;  3TF5 A;  2E76 D;  1NTZ G;  4JQ0 D;  1OVV A;  3A2A A;  3H1J E;  1ZR4 A;  2CPB A;  1IFI A;  2A45 I;  4JBZ A;  3D70 A;  1X8Y A;  4RKU J;  3FOU A;  3F89 A;  2IBZ D;  4RJT A;  4JPZ B;  3M9B A;  4HM3 A;  2J59 M;  1NTZ K;  2ITA A;  5KTB A;  2WPQ A;  1CZQ A;  2QE7 H;  4UB6 H;  3OJA B;  1FZC C;  2FXP A;  1LJ2 A;  1PGQ A;  2ZVN B;  1NWQ A;  4YTP C;  4UB6 E;  3GTS A;  2BCC D;  2ZXX A;  2H7H A;  2C0W A;  1WT6 A;  1NTM J;  4EYY Q;  1BSN A;  1NU1 J;  1JY2 P;  5CBO A;  2YKO A;  3GHG B;  3IAO A;  3VOP A;  2JDI H;  1BE3 E;  1H0T B;  1NGM B;  1K73 Q;  2CPS A;  2KNC B;  1AA0 A;  4HH2 A;  1VQO P;  3GHG A;  4NPE A;  2BMO A;  1H0T A;  4BRY B;  2O01 J;  1YJ9 P;  1NTK D;  4QUQ A;  5E79 H;  2LR2 A;  2KNC A;  1TU3 F;  2N1T C;  4OWF A;  1QLE D;  5BVZ A;  1P84 E;  1EZV D;  2K37 A;  1NTZ E;  4JYC A;  1M1K Q;  1DD3 A;  1A02 J;  2PRR A;  3IN6 A;  1KZU B;  4BRY A;  1JOC A;  2L91 A;  3LID A;  4IOI H;  1SQB G;  3MD0 A;  1PZQ A;  1QEX A;  5BU8 B;  2YFJ A;  2HML A;  2W6J H;  1FU1 A;  2XZR A;  2FFD B;  1OFC X;  3KPE A;  1T6A A;  1GK6 A;  2BCC J;  2M3B A;  1LTI C;  1W2B O;  4H44 C;  3AZC A;  2E5Y A;  2PP6 A;  3SSU A;  1SQB K;  1LTA C;  1AQ5 A;  3HD7 C;  2B88 A;  4AAY B;  2FFD A;  5AW9 B;  4M3L A;  1EZV I;  1DH3 A;  2NPS C;  1G8K B;  1KYO H;  1OW6 A;  5CCG A;  1NDO A;  4KHX A;  1O7M A;  1G1I A;  5KLI C;  1KYO E;  2D2C B;  4ASW A;  2YIU B;  2IFM A;  4LLH A;  3HRN A;  1VQ8 P;  5CCG D;  1S9K E;  1NTM G;  1AJY A;  1WMK A;  1IJD B;  1NTK J;  3CLQ A;  4ZNC A;  2OYH C;  3G9R A;  2AEJ A;  1UII A;  1USE A;  1NKZ B;  3NTN A;  1KB9 I;  4R4M A;  5BOK A;  4L76 A;  3K5B A;  2OTL P;  1HJ0 A;  2HMN A;  2W6B A;  1NTM K;  2D2C D;  5AW2 B;  1SS1 A;  1UUW A;  1L0N J;  1SQQ D;  2I7F A;  2E4P A;  1H89 A;  3D6Z A;  4HM8 A;  4U3F D;  1ULI A;  3GL0 A;  1S1C X;  1OW7 A;  2QJP C;  2KZJ A;  1KFN A;  2GA1 A;  1SQB E;  1PGO A;  2XSO A;  2WSF J;  1DX7 A;  2IBZ G;  3U1A A;  5KLI B;  3H1L D;  1RQV A;  4UB8 H;  5GTH E;  1JMB A;  3VMZ A;  2YMK A;  1DEB A;  4GOF A;  2YMY A;  3M06 A;  4NBC D;  2RMZ A;  1USD A;  2WVR A;  4HYT B;  2M8R A;  4UB8 E;  2LXC B;  3RK3 C;  1PGJ A;  3M0D A;  3AEE C;  1J1E C;  1YTZ I;  5APW A;  3L73 J;  3EFG A;  1YJW P;  5KJ7 C;  2BCC G;  3N4X A;  1VQP P;  1JY3 N;  3PH0 A;  1NH4 A;  1PL5 A;  1FJK A;  4OVN F;  2OYH A;  2A45 H;  5KAI H;  1IK9 A;  1PIX A;  2ZFC A;  3KXD A;  1J2J B;  3AE6 C;  3GF3 A;  1QL1 A;  3L37 A;  1HJB A;  3KZI H;  1RFS A;  5KAI E;  4QUR A;  2WSE J;  2OGU A;  1SFC B;  2XSH A;  1NTM E;  4N78 E;  3KZI E;  3MP7 B; 
#chains in the Genus database with same CATH homology
 4H13 D;  3L74 E;  1UUV A;  3H1J E;  3GL2 A;  3H1H E;  2HMN A;  1P84 E;  3GTE A;  2D2C D;  3EQQ A;  1NTZ E;  4NBD D;  3DQY A;  1UUW A;  2QPZ A;  4HM1 A;  3GZY A;  4NBE D;  1VM9 A;  2HMK A;  2HMO A;  1VCK A;  2I7F A;  2XR8 A;  2E4P A;  3VMH D;  3FOU A;  1RIE A;  2NUK A;  1G8J B;  2YFL A;  1L0L E;  1BCC E;  1O7P A;  4HM8 A;  3GL0 A;  1ULI A;  1SQV E;  2ZYL A;  4HM3 A;  3GOB A;  2GBW A;  2FYN C;  2QJP C;  3CXH E;  2QJY C;  1L0N E;  4NBH D;  1SQP E;  1NTK E;  2NWF A;  2YFJ A;  2HML A;  4HM0 A;  4NBF D;  1SQB E;  1O7G A;  2XSO A;  2E74 D;  2CKF A;  4HM5 A;  1EZV E;  2YVJ B;  4P1B H;  3AZC A;  4HKV A;  4QUP A;  4NBA D;  4H0L D;  5KKZ C;  1PPJ E;  1SQQ E;  1BGY E;  4PD4 E;  1EG9 A;  4NBC D;  4QDF B;  2IBZ E;  4NBG D;  3GZX A;  4EMJ B;  3D89 A;  3GTS A;  4U3F E;  2E4Q A;  3CX5 E;  3C0D A;  1KB9 E;  3EN1 A;  2B1X A;  2DE6 D;  1O7N A;  2Q3W A;  4AAY B;  1O7H A;  2BMR A;  4P1C H;  2XRX A;  1SJG A;  1Q90 C;  3L71 E;  2NUM A;  5CXM A;  1SQX E;  3VMG D;  4HJL A;  4OGQ D;  5AEU A;  1G8K B;  5KLV E;  3BCC E;  4AIV A;  4QDF A;  3H1L E;  3N0Q A;  2JZA A;  4HM6 A;  2BMQ A;  2JO6 A;  1NDO A;  1NYK A;  4D6T E;  3H1I E;  1O7M A;  3GKE A;  2ZT9 D;  3VMI D;  4HM4 A;  1NU1 E;  1BE3 E;  2NVF A;  3TGU E;  3L75 E;  2E75 D;  5KLI C;  1VF5 D;  1KYO E;  2NVE A;  2GBX A;  5AEW A;  4NB8 D;  2BCC E;  3H1K E;  3VCA A;  1WQL A;  1PP9 E;  5HL4 A;  2DE7 D;  2NVG A;  1O7W A;  1ULJ A;  3CWB E;  2YIU C;  4QDC A;  4PV1 D;  2A06 E;  3GB4 A;  1FQT A;  4NB9 D;  4HM7 A;  2QJK C;  3VCP A;  2YFI A;  1RFS A;  4QUR A;  2B24 A;  1ZRT E;  2BMO A;  2XSH A;  4QCK A;  1NTM E;  4H44 D;  2DE5 D;  4QDD A;  4NBB D;  2HMM A;  4HM2 A;  3L70 E;  2E76 D;  2HMJ A;  3GCE A;  3L72 E;  3L73 E;  4QUQ A;  5BOK A;  2FYU E;  1JM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...