2BCCE

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 41
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2bccE02
3DQYA 4QUQA 1JM1A 2ZYLA 4NBHD 4NBED 4H44D 3GCEA 5BOKA 4QDCA 3GTSA 3VCAA 3L75E 2DE5D 3L71E 1O7HA 4HM2A 1EZVE 1NYKA 4HM5A 4P1BH 3GZYA 2DE7D 1G8KB 3CWBE 2HMMA 2YVJB 3D89A 4NBDD 2I7FA 2HMNA 1NDOA 1BCCE 2HMOA 2QJKC 3GL2A 2CKFA 1VCKA 4HM1A 3L74E 2GBXA 2IBZE 1UUWA 2QJYC 2GBWA 3GB4A 2NVEA 2JZAA 2FYNC 1ULJA 3VMHD 2NWFA 3GTEA 1L0LE 3BCCE 2BMRA 4U3FE 2XR8A 1O7GA 2NUMA 4NBBD 1RFSA 1SQQE 4QURA 2B1XA 1NU1E 2YFLA 4H0LD 3VCPA 2Q3WA 2QPZA 1UUVA 3H1JE 4NBCD 1BGYE 4PV1D 2NVFA 3H1LE 1SQXE 3N0QA 1Q90C 2E74D 5HL4A 4HM0A 3L72E 3CX5E 4OGQD 1SJGA 2XRXA 1SQVE 2HMLA 3GKEA 3H1KE 4HKVA 1VF5D 5CXMA 1EG9A 2YFIA 2YIUC 2ZT9D 1WQLA 4QDFB 2NUKA 2HMKA 2BMOA 1PP9E 3L70E 2XSHA 1VM9A 3EQQA 2E75D 1O7MA 3CXHE 1G8JB 5AEWA 4QCKA 1L0NE 1SQBE 2DE6D 5KLIC 4NBAD 2E4QA 5AEUA 2YFJA 1BE3E 3GZXA 1O7PA 4HM3A 2BMQA 1KB9E 4P1CH 4HM4A 2QJPC 1P84E 3H1IE 5KKZC 1ZRTE 3AZCA 1PPJE 4QDDA 1RIEA 4AAYB 5KLVE 3H1HE 3VMGD 4H13D 3C0DA 1NTKE 3L73E 4HM8A 4HJLA 4NB8D 4HM7A 2BCCE 1NTME 3FOUA 4EMJB 4D6TE 4PD4E 1NTZE 4HM6A 3GOBA 2B24A 2E76D 2E4PA 1KYOE 1FQTA 4NBFD 4QUPA 2NVGA 3VMID 2A06E 3GL0A 4NBGD 2D2CD 2HMJA 3TGUE 1O7NA 1ULIA 4NB9D 2FYUE 3EN1A 1SQPE 1O7WA 4QDFA 4AIVA 2JO6A 2XSOA
chains in the Genus database with same CATH superfamily
3FWNA 1HWTC 3K5BA 1P84H 1AFOA 4QDCA 5APSA 1JUNA 2RN0A 2A45H 4L76A 5AW2B 3L73D 2CKFA 3ITKA 3TSIA 1QVGO 1RE4A 3CX5I 1GL2C 3GTEA 3R2PA 4U3FE 3HUSA 2WSSH 1ZLLA 1NTZK 1KILB 1E79H 4BWNA 2E76C 1L4AD 3A0HE 1KD1Q 2CK3H 2E74D 3ZDMA 4OGQC 4WY4A 1KMIZ 2HMKA 1RF1B 3AEEC 2KSEA 1EC5A 3AE6C 1SQQG 3N4XA 2GUSA 1H89A 2C0WA 2FFDC 3JCUH 2KIKA 2ZVOB 1NTKJ 1P84E 3S1KA 3AECC 2WVRA 2E43A 1FZEA 2Z5IA 3CWBD 2MKVA 1BE3J 2WPVB 3VYIA 4K3AA 2NZ2A 2Q9IA 2W6BA 3GOBA 4LC1A 1BGYG 5KAFH 2V7QH 3G71P 4QUPA 3GL0A 1L4AC 2WWWA 4EDFA 4JYCA 1BCCG 1ULIA 3C9IA 3EN1A 1NTZJ 1X9VA 1KILD 1Q2NA 1Q82Q 1K8AQ 2WSEH 1G2CB 1K05A 3L75E 2WSEJ 1SQBD 3IN6A 3EWKA 3BCCJ 3MIWA 1BE3G 3CCRP 2XDJA 5L8RJ 5E79E 4LGDE 2AXTE 2JKVA 1K9MQ 1P84D 5H2FE 1RQVA 3Q5RA 2FYNC 1VQ7P 1L0LE 2XR8A 2JO1A 3MP7B 1S72P 2K1AA 2YFLA 1H0TB 2IYPA 3CI9A 2XRXA 1N7SA 1BSHA 1PPJD 1NAYA 1NWQA 3H1JD 1LWUB 2OTJP 1KC8Q 5EFWB 3L35A 1CI6A 2OGUA 2QVAA 1CW5A 1PGQA 1KYOI 3KQGA 2E4QA 4I2LC 3M9QA 1MKMA 4EI2A 3H1LD 1NTMD 1ZR4A 4P1CH 4U3FD 3USSA 2ZFCA 1KQLA 2KZJA 4GODA 3A7OA 3V2PA 3HD7A 3C0DA 3IF4A 3RK3E 1BGYD 4NB8D 1G1JA 2P58A 5BU8B 1AQTA 2R32A 3NFQA 4NBGD 2HMJA 3HRNA 3W67A 3F5HA 2HYNA 2Y9YA 2AEFA 2Q3EA 1NTKG 1LT9B 2KI7B 1WRGA 1ZR2A 1R8EA 2C0XA 2K3RA 2NPSA 5B5EH 3BRTB 1OVVA 2KSJA 3CWBE 1NOHA 1CSBA 4GIFA 3TDKA 3L74E 1GDTA 1HUCA 1UUWA 3L70G 2BCCG 1FZAA 3L36A 3V4WA 3BCCE 1GL2D 1M56D 3HD7D 4NBBD 1S5LH 3SWYA 3WU2H 2KXPB 3RGUA 2A06D 2IZ1A 2OYIA 3H1LE 5AVWB 1FZBA 3EFFK 1SQVE 1IFMA 1SQPK 2H89C 3CX5H 1SQPG 1R5SA 3D6YA 5CBNA 4M3LA 2OTLP 1FDOA 2N1TC 2YIUB 3FWLA 1S4XA 2QM7A 4OWFA 2YKOA 4D6TJ 5GTIE 4PJ0E 5APXA 3H25A 3LIEA 2QJPC 1ZW0A 2HFED 3C1LA 3H1HE 3H1KG 4H13C 1SLQA 3CPWO 2W83C 2A06E 1URQC 2RH0A 2B87B 1LWUA 4BXLA 3GW6A 2KLUA 3V2NA 3CLQA 2GA1A 2OYHC 1QGKB 5AW8B 1L0NK 1Y8AA 4LLHA 1EQ7A 3E1IA 1K04A 2QJPB 3A2AA 2CPSA 3Q5SA 1EDLA 1LTJA 4TT3H 3D6ZA 3MGNA 2IBZE 5CMZA 2AEJA 3AE9C 1A02J 1NTMK 2P7JA 2WPSA 4QURA 2O01N 3L37A 3VCPA 2XKMA 3MUDC 2V7QJ 3L71G 1VQ5P 2D2CC 3SSUA 3FXEA 1L4AA 3NMDA 1NKZB 2IBZI 3GMAA 3JCUE 1SQXJ 1FZCA 1G1IA 1SFCB 2AXTH 3CXHE 3BASA 2IDBA 1WMKA 1LT9C 2YFJA 1KYOD 1YQ3C 2LKMA 2BMQA 3SFEC 4PD4D 2W90A 4I7ZB 3GG2A 2FFDA 2P2UA 2M8RA 3L70D 4DT0A 4ZKPA 1NTMG 1PGPA 3F89A 1LTJC 1KQFB 2ZAEB 3AE8C 4C46A 2NRGA 1K73Q 4YXDC 1SS1A 1HJBA 1GU4A 5APTA 2IBZD 2YXQB 2WQYC 1T8ZA 3DQYA 2XV5A 3O8ZA 1NHLA 1LWUC 3H1HD 3JSVC 1M8OB 4P1BH 5KAIH 2YVJB 1L0ND 3A0BH 3PJSK 3BRVB 4Y99B 1NGMB 3GB4A 4YPCA 3CMEP 2YO2A 1NO4A 2K9YA 1GW3A 1GTWA 1VQ8P 3NXSA 3V2QA 3C8VA 5CBOA 1HTLC 3V2RA 2IX7C 1Q90D 1N7SB 5GTHE 5GTIH 1S3JA 3H1HG 1CI6B 5AW0B 2E75D 2OYHA 3VMAA 2QEXP 5AEWA 1OVRA 3L75G 3CCUP 4NBAD 5AEUA 3AEGC 3RK3C 1FC2C 1IK9A 4DZOA 1URQA 3D70A 3UIAA 1LNQA 4Y28J 2HODA 2R5DA 3KDPB 3VMZA 3M91A 3L73J 1MZ9A 4HH2A 2E76D 2E4PA 4MN4C 3D71A 4NPEA 4OGQB 1IFJA 3W68A 2KLVA 4KHXA 1EZVI 2NPSD 4JQ0D 3CCMP 1T2KC 3JC22 4NB9D 3IFMA 1X22A 1KZUB 3AEFC 1QL2A 1Q7YQ 3GCEA 2YXRB 5AVVB 1PL5A 3E7KA 2O01H 2Q1KA 1NDOA 3L4FA 1DX7A 3V6IA 5KLVK 2GBWA 3AE5C 5KJ7C 1JEKA 3HUSC 1WT6A 3WUTA 1AA0A 3RL0B 2OYIB 3L74J 3H1KJ 1VQ9P 3N0QA 3HE4B 3H1JJ 3Q5PA 3RK3B 2HMLA 3PRJA 3P32A 4PV1B 3RL0C 1JCDA 2Y9ZA 3L75D 3M0DC 1T6AA 3H1IJ 3MHVA 4CPGA 2WSFJ 4XE5B 2KOGA 1OVUA 2M3EA 2JWDA 1SQXG 4I6MC 1SQBJ 1GW4A 1ZV8A 2LXBA 4N78D 3FGAD 1YTZI 1IZNB 4W80A 2WZ7A 3M9HA 4H13D 1PPJG 2N1TB 1NTME 4WWIA 3FOUA 3BCCD 3TF5A 4AUWA 1Y47A 4EYYQ 3B71A 2M0BA 2QE7H 1M57D 1JY2N 1MUUA 2NVGA 4PV1C 2H88C 5AW9B 1T3UA 2BCCD 3SFDC 1SQVD 2Y0DA 2Z4EA 4ASVA 1YJ9P 1P84I 4PD4H 5KLVG 4QUQA 3U1AA 1H88A 4H44B 1SVFA 1AVOA 1IO4A 2UWJE 2I7FA 1Q86Q 1DH3A 1JB0J 1RE3A 2NWFA 4ZKUA 2NUMA 2PP6A 3LW5J 1BGYE 4IL6E 2ZXXA 3CXHD 4N78E 1Q90C 2W8ZA 3OW2O 3CX5E 4OGQD 3L70J 1ZMEC 3BATA 3KZIH 1WQLA 2E42A 1SQPD 2Y0CA 4QMAA 1LP1A 4QCKA 1X8YA 1J1DB 4BRYB 2DW3A 2YKQA 1GK4A 1M1JB 2H8PD 3H1IE 1M1JA 4QDDA 1RIEA 2B9BA 5CCGD 5B66H 2WITA 1A02F 4HJLA 1SQXD 5KTBA 1HGZA 1VL2A 2BCCJ 3CCLP 1QLED 3GHGB 4RESB 1N7SD 1OWAA 1FE6A 4AQRD 4AIVA 2OARA 2QA4P 1RQUA 1KYOH 2N1TD 3H1KD 2CPBA 4YXWH 1KV4A 5CCGA 1JTHB 1AJYA 2BASA 1JCCA 2QJYB 3GZYA 4HM5A 1M1JC 1G8KB 1UIXA 2G3AA 3PP5A 2BEQD 3CX5D 2P1JA 3H1ID 1VQOP 2NVEA 3VMHD 5KAFE 1GU5A 3TNUA 4UB8H 2O1KA 2Q3WA 2WPRA 4WY4C 1BSNA 5B66E 4EIJA 1VDFA 2ZVNB 2KK7A 3MD0A 4DOJA 3HE4A 3GKEA 1VF5D 3FX0A 3RL0D 3CL3D 3HTKB 1PP9E 1LGHB 1GK6A 4GT1A 2XNXA 5APWA 1M7LA 1N73A 5AVSB 4HB1A 1EXJA 1HGVA 1SQBE 2OQQA 1H0TA 3RK2B 3WU2E 3G4SP 1OW8A 2A06G 3Q2YA 1BCCD 2ZYDA 2J5UA 4JPZB 3VMYA 4I1LA 3AE7C 4A7PA 3IR9A 3FXDA 4PD4E 3CC2P 2Q6QA 4HM6A 4R4MA 1BE3D 5CHXA 4K35A 2B89A 1NVOA 2D2CB 1SQVK 2VRSA 1OX3A 2FYUG 3U59A 2KUBA 2RKLA 1FDIA 3CXHI 1R5LA 1FJKA 5AW7B 1RF0C 1OIPA 2K37A 4BRYA 5E79H 3H1LG 4ZNCA 2FFDB 4R4LA 3GL2A 2HG5D 5APQA 2FYZA 4O9BA 4TLFA 2KP8A 2J59M 1O7GA 1MV8A 3CCJP 3I5CA 3M0DA 1VQNP 3II6A 1SQVG 5APYA 3KZIE 1YI2P 2M5AA 5CJ4A 4B86A 2FYUK 3L73G 5BU5A 4IFMA 4L73A 1M90Q 4NPFX 2H7HA 1S9KE 2WSFH 1LTIC 1YBKA 1O7MA 1JY3P 1HBWA 2R44A 1NYHA 1DEBA 1L0NE 3BCCG 5KAIE 2HLOA 2HR3A 4YTPC 4IFFA 3B5ND 1Z56A 1J1EC 3L74D 1IC2A 4AYCA 3RBXA 1E5WA 1D7MA 4HM8A 1ZN5A 2WT7A 2AEMA 1YJWP 3H1HJ 1G2CA 1SQQK 1FZCC 1OW7A 3P7KA 3CCEP 4EOTA 4NBFD 1PP9D 1X0TA 3GHGC 3T97B 4IOIH 1LTTC 4QDFA 2JJLA 2JO6A 4H44C 2ZYLA 3L72D 1KILA 1YQ4C 4RO0A 1J2JB 3HUSB 3G6EP 3HE5B 1EZVG 2FXMA 2FYUJ 3OJAB 4WB4A 3AE3C 1GD2E 2IZ0A 3KHUA 4RKUJ 2ITAA 2K9JA 3P8MC 2HPCB 3VP8A 2GBXA 2JZAA 1NTKK 2O3JA 3WUUA 3RBZA 1JMBA 3AE2C 2BMRA 3GLMA 1RE3C 1MFZA 2POHA 3V5BA 2JP3A 2B1XA 1NU1E 1Y9BA 2PRRA 3AEAC 2FYNB 2N9BA 4NBCD 5DJUB 4C7RA 3A0HH 4IFDK 2KS1B 3M0AA 2ZT9D 3VTPC 3AE4C 1N73C 1PP9G 1L0LG 3G9RA 4Y99C 2I1JA 1USDA 1XTGB 4HM3A 1PGOA 3V4QA 2JDIH 1L4AB 1SQQD 1PPJE 4RJTA 2Z5HA 1S1CX 4HM7A 1FOSE 2E5YA 3H1JG 1PFIA 4W7YA 4GOFA 4C7NB 1IFNA 3VMID 1JMMA 4GKGA 3O6QB 3L74G 3L72G 1USEA 5CCHC 5KLVD 1OXZA 4NBED 5BOKA 3G3ZA 3VCAA 2YMKA 2W27A 1JY3O 3P8CE 2PAJA 1U57A 2K9JB 1ZOYC 2I8DA 1N86A 1LT9A 3NTNA 4HYTB 3SWFA 1RFSA 3SWKA 4NPDA 1PGJA 1PV3A 3PH0A 1LTGC 1GMJA 1OZHA 3L72E 2YO3A 4HKVA 2LR2A 2YIUC 1LTJB 3Q1MA 3KYQA 1L0NJ 1IFPA 1KN7A 1SQVJ 3A3YB 3EQQA 2IFNA 3HD7B 2FKWB 1G8JB 1GL2B 4PD4I 3HE5A 5KJ7A 2RMZA 2ZT9B 1N2DC 1IK7A 2MJZA 2Q3IA 4GDOA 3CCQP 5AVUB 2R3CA 3VN0A 1FBMA 3I56P 1NU1D 5KLVE 1SFCA 1H8AA 2QRXA 4EMJB 1L0LD 5C39A 1FS0E 1SFCC 5AVXB 1DD3A 4OH8B 1FQTA 1IJDB 1YHQP 3P8CD 1VQ6P 2D2CD 1LTBC 3L71J 4D6TD 1JY2O 1M1KQ 1JM1A 3CMAP 2FXOA 1SQPJ 5M1BA 1EXIA 1S2EA 2O01J 3CC7P 3LIDA 1VF5B 4Z1MH 2QJKB 1BCCE 5AW4B 3RK2D 2LXCB 2WT7B 2E5TA 3AEBC 2KZIA 3MTUE 1SQQE 1KQGB 1UUVA 2ZYGA 1JTHA 1SQQJ 2NVFA 3B5NA 1SQXE 3IAOA 2H43A 3B5NB 3H1KE 2WPQA 1W2BO 4QDFB 5APUA 2QG4A 1EDIA 4DCKA 4N3YB 1QEXA 2M3BA 4U3FG 2A45I 1FAVA 3GZXA 2QIWA 1CZQA 1HF9A 1KB9E 3OA7A 4HM4A 1ZRTE 3H6PA 4HKZH 1W2EA 1YYCA 1JY3N 2C9LY 1L0NG 4H0LC 3LW5H 1MFTA 2IYOA 1NU1K 1N73B 1KYOE 1ZP0C 1LT1A 1YITP 2WSCH 2Y0EA 1SP4A 2E74C 1QX8A 2K88A 1J1DC 5DJTB 2E75C 1KFNA 1UIIA 1YTZT 3GTSA 5APVA 2SPZA 3L71E 1O7HA 5KKZB 1NYKA 3B5NC 2HPCA 4L74A 2HMNA 3MUDA 1JO5A 1NH4A 3MZWB 3CCVP 1FOSF 1JM0A 4H0LB 2IBZG 4PJ0H 3HTKA 1ULJA 4UB8E 1LTAC 1NU1G 4H0LD 1PP9J 3H1LJ 1BCCJ 2QPZA 4I7ZC 2E74B 4ZMDA 5HL4A 1HH0A 2XU6A 2R5BA 2XNDH 5CXMA 1RY3A 4JYBA 2Q7CA 3PTZA 3PLNA 2G8YA 2BEZF 3CXHH 3L71D 1W5CE 1OW6A 3VOPA 5KLVJ 3S9OA 3VMGD 1FZCB 5AVYB 3M06A 2OTKE 2E75B 1LP1B 1LJ2A 4H13B 1PIXA 3QH9A 2FY8A 3AE1C 1AV1A 1XTCC 5TISE 2OYOA 4N6JA 2M5AB 3TGUE 1URQD 2Q5UA 1FJPA 1U7MA 1SQPE 2N1TA 2ZT9C 2YMYA 1NTZD 1KB9D 1SQBK 2FBWC 1SQBG 1L2PA 1U7JA 5CCHA 1HVVA 3RK3D 3GF3A 2HMMA 1VQKP 2QJKC 4ASWA 3KPEA 3ABVC 1HJ0A 2FYUD 1VCKA 1BGYJ 3R4YA 4JBZA 3A0BE 3GF7A 3M9BA 1NJIQ 3CCSP 5AVQB 1RF1C 2WMMA 3CWBJ 1ZRTD 3CD6P 4WY4D 3E1RA 3H1JE 4PV1D 2JWAA 3EFGA 2P10A 5AW1B 2AXCA 2OYIC 1S5LX 1VQMP 2JR8A 2BMOA 2HODB 1QVFO 1VM9A 4U7JA 3TNUB 2WSCJ 2GM4A 2IPPA 2DE6D 3L72J 3CWBG 5AVRB 1RE4C 2O1JA 2NPSB 1BDDA 5B5EE 3BVHA 1VQPP 2L5GB 1AVYA 1NTMJ 1AQ5A 1ZXGA 1OMIA 1YIJP 5CJ0A 5KJ7D 4D6TE 1NTZE 2J58A 3HD7C 1JY2P 1DEEG 1X79B 1OFCX 1S5LE 1SQXK 5AVTB 1DD4A 3L75J 2I1KA 1KB9H 2FYUE 3H1IG 4KJMA 2E76B 1KFMA 1NTKD 4WY4B 4WBAA 3CC4P 2W6JH 2JEEA 1KILC 4NBHD 4H44D 4D6TG 2ZJSE 2DE5D 3N7NA 4KT0J 4HM2A 1EZVE 3TYYA 1L0LJ 3VP9A 2DE7D 4OVNF 3D89A 2A45G 1KB9I 4NBDD 1NU1J 3RK2C 1RHZB 3S4RA 1RF0A 1N8RQ 4L75A 2P67A 1NTZG 1VQLP 2GUVA 3PHLA 4U3FJ 3H32B 1EDKA 2PGDA 1N7SC 1JNMA 3AEDC 1IFDA 4HM0A 2PFXA 1SJGA 5TJHA 2YFIA 2W6AA 3L70E 2XSHA 4XA4A 1FDMA 2XZRA 4HJGH 2IFMA 5AW6B 1EDJA 3EQ2A 5KLIC 2KNCA 4WVZA 1NKNA 1PZQA 3GHGA 3B4SA 3O6QA 4UB6H 3B8EB 5KKZC 3WMM0 1NTKE 3L73E 5KLIB 1KTMA 2KYVA 1L0LK 2BCCE 1VQ4P 1DIPA 3TGUJ 2WTYA 4DJGA 3TK1A 1VF5C 4IL6X 3Q3DA 2NPSC 5AW5B 1T2KD 2ZXEB 1N7LA 1S9KD 1RF1A 1KORA 1QL1A 2KNCB 5TISH 1IFIA 1BDCA 3TGUD 5GTHH 2HMOA 3U1CA 4W7ZA 4HM1A 3TGUG 2QJYC 5CCGC 5K5GB 3VMXA 1SFCD 5BVZA 1GL2A 2C9NY 4UB6E 4GOEA 3H32A 3WUVA 1KILE 2B88A 1NAFA 4IL6H 1KQSO 5H2FH 1EG9A 2NUKA 1TU3F 3RL0g 1EZVD 4XFJA 2YNYA 2ZYAA 1Q81Q 1BE3E 1GZLA 2YKPA 1O7PA 3KXDA 3A5TA 2KB7P 3T97A 1FU1A 4C7NA 1J1EB 3AZCA 1JOCA 2L91A 4AAYB 2KS1A 1VPCA 2OYHB 5AW3B 1RH5B 1FZGA 3I55P 2B24A 3QWOC 2R3SA 2FXPA 1LTSC 2V4HA 1T3JA 1URQB 1O7NA 5AVZB 2QM8A 4JF7A 5CCHD 2N9YB 1FZFA 1YJNP 3OAKA 1O7WA 2B87A 2QSIA 2XSOA
chains in the Genus database with same CATH topology
3DQYA 4QUQA 1JM1A 2ZYLA 4NBHD 4NBED 4H44D 3GCEA 5BOKA 4QDCA 3GTSA 3VCAA 3L75E 2DE5D 3L71E 1O7HA 4HM2A 1EZVE 1NYKA 4HM5A 4P1BH 3GZYA 2DE7D 1G8KB 3CWBE 2HMMA 2YVJB 3D89A 4NBDD 2I7FA 2HMNA 1NDOA 1BCCE 2HMOA 2QJKC 3GL2A 2CKFA 1VCKA 4HM1A 3L74E 2GBXA 2IBZE 1UUWA 2QJYC 2GBWA 3GB4A 2NVEA 2JZAA 2FYNC 1ULJA 3VMHD 2NWFA 3GTEA 1L0LE 3BCCE 2BMRA 4U3FE 2XR8A 1O7GA 2NUMA 4NBBD 1RFSA 1SQQE 4QURA 2B1XA 1NU1E 2YFLA 4H0LD 3VCPA 2Q3WA 2QPZA 1UUVA 3H1JE 4NBCD 1BGYE 4PV1D 2NVFA 3H1LE 1SQXE 3N0QA 1Q90C 2E74D 5HL4A 4HM0A 3L72E 3CX5E 4OGQD 1SJGA 2XRXA 1SQVE 2HMLA 3GKEA 3H1KE 4HKVA 1VF5D 5CXMA 1EG9A 2YFIA 2YIUC 2ZT9D 1WQLA 4QDFB 2NUKA 2HMKA 2BMOA 1PP9E 3L70E 2XSHA 1VM9A 3EQQA 2E75D 1O7MA 3CXHE 1G8JB 5AEWA 4QCKA 1L0NE 1SQBE 2DE6D 5KLIC 4NBAD 2E4QA 5AEUA 2YFJA 1BE3E 3GZXA 1O7PA 4HM3A 2BMQA 1KB9E 4P1CH 4HM4A 2QJPC 1P84E 3H1IE 5KKZC 1ZRTE 3AZCA 1PPJE 4QDDA 1RIEA 4AAYB 5KLVE 3H1HE 3VMGD 4H13D 3C0DA 1NTKE 3L73E 4HM8A 4HJLA 4NB8D 4HM7A 2BCCE 1NTME 3FOUA 4EMJB 4D6TE 4PD4E 1NTZE 4HM6A 3GOBA 2B24A 2E76D 2E4PA 1KYOE 1FQTA 4NBFD 4QUPA 2NVGA 3VMID 2A06E 3GL0A 4NBGD 2D2CD 2HMJA 3TGUE 1O7NA 1ULIA 4NB9D 2FYUE 3EN1A 1SQPE 1O7WA 4QDFA 4AIVA 2JO6A 2XSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQY A;  4QUQ A;  1JM1 A;  2ZYL A;  4NBH D;  4NBE D;  4H44 D;  3GCE A;  5BOK A;  4QDC A;  3GTS A;  3VCA A;  3L75 E;  2DE5 D;  3L71 E;  1O7H A;  4HM2 A;  1EZV E;  1NYK A;  4HM5 A;  4P1B H;  3GZY A;  2DE7 D;  1G8K B;  3CWB E;  2HMM A;  2YVJ B;  3D89 A;  4NBD D;  2I7F A;  2HMN A;  1NDO A;  1BCC E;  2HMO A;  2QJK C;  3GL2 A;  2CKF A;  1VCK A;  4HM1 A;  3L74 E;  2GBX A;  2IBZ E;  1UUW A;  2QJY C;  2GBW A;  3GB4 A;  2NVE A;  2JZA A;  2FYN C;  1ULJ A;  3VMH D;  2NWF A;  3GTE A;  1L0L E;  3BCC E;  2BMR A;  4U3F E;  2XR8 A;  1O7G A;  2NUM A;  4NBB D;  1RFS A;  1SQQ E;  4QUR A;  2B1X A;  1NU1 E;  2YFL A;  4H0L D;  3VCP A;  2Q3W A;  2QPZ A;  1UUV A;  3H1J E;  4NBC D;  1BGY E;  4PV1 D;  2NVF A;  3H1L E;  1SQX E;  3N0Q A;  1Q90 C;  2E74 D;  5HL4 A;  4HM0 A;  3L72 E;  3CX5 E;  4OGQ D;  1SJG A;  2XRX A;  1SQV E;  2HML A;  3GKE A;  3H1K E;  4HKV A;  1VF5 D;  5CXM A;  1EG9 A;  2YFI A;  2YIU C;  2ZT9 D;  1WQL A;  4QDF B;  2NUK A;  2HMK A;  2BMO A;  1PP9 E;  3L70 E;  2XSH A;  1VM9 A;  3EQQ A;  2E75 D;  1O7M A;  3CXH E;  1G8J B;  5AEW A;  4QCK A;  1L0N E;  1SQB E;  2DE6 D;  5KLI C;  4NBA D;  2E4Q A;  5AEU A;  2YFJ A;  1BE3 E;  3GZX A;  1O7P A;  4HM3 A;  2BMQ A;  1KB9 E;  4P1C H;  4HM4 A;  2QJP C;  1P84 E;  3H1I E;  5KKZ C;  1ZRT E;  3AZC A;  1PPJ E;  4QDD A;  1RIE A;  4AAY B;  5KLV E;  3H1H E;  3VMG D;  4H13 D;  3C0D A;  1NTK E;  3L73 E;  4HM8 A;  4HJL A;  4NB8 D;  4HM7 A;  2BCC E;  1NTM E;  3FOU A;  4EMJ B;  4D6T E;  4PD4 E;  1NTZ E;  4HM6 A;  3GOB A;  2B24 A;  2E76 D;  2E4P A;  1KYO E;  1FQT A;  4NBF D;  4QUP A;  2NVG A;  3VMI D;  2A06 E;  3GL0 A;  4NBG D;  2D2C D;  2HMJ A;  3TGU E;  1O7N A;  1ULI A;  4NB9 D;  2FYU E;  3EN1 A;  1SQP E;  1O7W A;  4QDF A;  4AIV A;  2JO6 A;  2XSO A; 
#chains in the Genus database with same CATH topology
 3FWN A;  1HWT C;  3K5B A;  1P84 H;  1AFO A;  4QDC A;  5APS A;  1JUN A;  2RN0 A;  2A45 H;  4L76 A;  5AW2 B;  3L73 D;  2CKF A;  3ITK A;  3TSI A;  1QVG O;  1RE4 A;  3CX5 I;  1GL2 C;  3GTE A;  3R2P A;  4U3F E;  3HUS A;  2WSS H;  1ZLL A;  1NTZ K;  1KIL B;  1E79 H;  4BWN A;  2E76 C;  1L4A D;  3A0H E;  1KD1 Q;  2CK3 H;  2E74 D;  3ZDM A;  4OGQ C;  4WY4 A;  1KMI Z;  2HMK A;  1RF1 B;  3AEE C;  2KSE A;  1EC5 A;  3AE6 C;  1SQQ G;  3N4X A;  2GUS A;  1H89 A;  2C0W A;  2FFD C;  3JCU H;  2KIK A;  2ZVO B;  1NTK J;  1P84 E;  3S1K A;  3AEC C;  2WVR A;  2E43 A;  1FZE A;  2Z5I A;  3CWB D;  2MKV A;  1BE3 J;  2WPV B;  3VYI A;  4K3A A;  2NZ2 A;  2Q9I A;  2W6B A;  3GOB A;  4LC1 A;  1BGY G;  5KAF H;  2V7Q H;  3G71 P;  4QUP A;  3GL0 A;  1L4A C;  2WWW A;  4EDF A;  4JYC A;  1BCC G;  1ULI A;  3C9I A;  3EN1 A;  1NTZ J;  1X9V A;  1KIL D;  1Q2N A;  1Q82 Q;  1K8A Q;  2WSE H;  1G2C B;  1K05 A;  3L75 E;  2WSE J;  1SQB D;  3IN6 A;  3EWK A;  3BCC J;  3MIW A;  1BE3 G;  3CCR P;  2XDJ A;  5L8R J;  5E79 E;  4LGD E;  2AXT E;  2JKV A;  1K9M Q;  1P84 D;  5H2F E;  1RQV A;  3Q5R A;  2FYN C;  1VQ7 P;  1L0L E;  2XR8 A;  2JO1 A;  3MP7 B;  1S72 P;  2K1A A;  2YFL A;  1H0T B;  2IYP A;  3CI9 A;  2XRX A;  1N7S A;  1BSH A;  1PPJ D;  1NAY A;  1NWQ A;  3H1J D;  1LWU B;  2OTJ P;  1KC8 Q;  5EFW B;  3L35 A;  1CI6 A;  2OGU A;  2QVA A;  1CW5 A;  1PGQ A;  1KYO I;  3KQG A;  2E4Q A;  4I2L C;  3M9Q A;  1MKM A;  4EI2 A;  3H1L D;  1NTM D;  1ZR4 A;  4P1C H;  4U3F D;  3USS A;  2ZFC A;  1KQL A;  2KZJ A;  4GOD A;  3A7O A;  3V2P A;  3HD7 A;  3C0D A;  3IF4 A;  3RK3 E;  1BGY D;  4NB8 D;  1G1J A;  2P58 A;  5BU8 B;  1AQT A;  2R32 A;  3NFQ A;  4NBG D;  2HMJ A;  3HRN A;  3W67 A;  3F5H A;  2HYN A;  2Y9Y A;  2AEF A;  2Q3E A;  1NTK G;  1LT9 B;  2KI7 B;  1WRG A;  1ZR2 A;  1R8E A;  2C0X A;  2K3R A;  2NPS A;  5B5E H;  3BRT B;  1OVV A;  2KSJ A;  3CWB E;  1NOH A;  1CSB A;  4GIF A;  3TDK A;  3L74 E;  1GDT A;  1HUC A;  1UUW A;  3L70 G;  2BCC G;  1FZA A;  3L36 A;  3V4W A;  3BCC E;  1GL2 D;  1M56 D;  3HD7 D;  4NBB D;  1S5L H;  3SWY A;  3WU2 H;  2KXP B;  3RGU A;  2A06 D;  2IZ1 A;  2OYI A;  3H1L E;  5AVW B;  1FZB A;  3EFF K;  1SQV E;  1IFM A;  1SQP K;  2H89 C;  3CX5 H;  1SQP G;  1R5S A;  3D6Y A;  5CBN A;  4M3L A;  2OTL P;  1FDO A;  2N1T C;  2YIU B;  3FWL A;  1S4X A;  2QM7 A;  4OWF A;  2YKO A;  4D6T J;  5GTI E;  4PJ0 E;  5APX A;  3H25 A;  3LIE A;  2QJP C;  1ZW0 A;  2HFE D;  3C1L A;  3H1H E;  3H1K G;  4H13 C;  1SLQ A;  3CPW O;  2W83 C;  2A06 E;  1URQ C;  2RH0 A;  2B87 B;  1LWU A;  4BXL A;  3GW6 A;  2KLU A;  3V2N A;  3CLQ A;  2GA1 A;  2OYH C;  1QGK B;  5AW8 B;  1L0N K;  1Y8A A;  4LLH A;  1EQ7 A;  3E1I A;  1K04 A;  2QJP B;  3A2A A;  2CPS A;  3Q5S A;  1EDL A;  1LTJ A;  4TT3 H;  3D6Z A;  3MGN A;  2IBZ E;  5CMZ A;  2AEJ A;  3AE9 C;  1A02 J;  1NTM K;  2P7J A;  2WPS A;  4QUR A;  2O01 N;  3L37 A;  3VCP A;  2XKM A;  3MUD C;  2V7Q J;  3L71 G;  1VQ5 P;  2D2C C;  3SSU A;  3FXE A;  1L4A A;  3NMD A;  1NKZ B;  2IBZ I;  3GMA A;  3JCU E;  1SQX J;  1FZC A;  1G1I A;  1SFC B;  2AXT H;  3CXH E;  3BAS A;  2IDB A;  1WMK A;  1LT9 C;  2YFJ A;  1KYO D;  1YQ3 C;  2LKM A;  2BMQ A;  3SFE C;  4PD4 D;  2W90 A;  4I7Z B;  3GG2 A;  2FFD A;  2P2U A;  2M8R A;  3L70 D;  4DT0 A;  4ZKP A;  1NTM G;  1PGP A;  3F89 A;  1LTJ C;  1KQF B;  2ZAE B;  3AE8 C;  4C46 A;  2NRG A;  1K73 Q;  4YXD C;  1SS1 A;  1HJB A;  1GU4 A;  5APT A;  2IBZ D;  2YXQ B;  2WQY C;  1T8Z A;  3DQY A;  2XV5 A;  3O8Z A;  1NHL A;  1LWU C;  3H1H D;  3JSV C;  1M8O B;  4P1B H;  5KAI H;  2YVJ B;  1L0N D;  3A0B H;  3PJS K;  3BRV B;  4Y99 B;  1NGM B;  3GB4 A;  4YPC A;  3CME P;  2YO2 A;  1NO4 A;  2K9Y A;  1GW3 A;  1GTW A;  1VQ8 P;  3NXS A;  3V2Q A;  3C8V A;  5CBO A;  1HTL C;  3V2R A;  2IX7 C;  1Q90 D;  1N7S B;  5GTH E;  5GTI H;  1S3J A;  3H1H G;  1CI6 B;  5AW0 B;  2E75 D;  2OYH A;  3VMA A;  2QEX P;  5AEW A;  1OVR A;  3L75 G;  3CCU P;  4NBA D;  5AEU A;  3AEG C;  3RK3 C;  1FC2 C;  1IK9 A;  4DZO A;  1URQ A;  3D70 A;  3UIA A;  1LNQ A;  4Y28 J;  2HOD A;  2R5D A;  3KDP B;  3VMZ A;  3M91 A;  3L73 J;  1MZ9 A;  4HH2 A;  2E76 D;  2E4P A;  4MN4 C;  3D71 A;  4NPE A;  4OGQ B;  1IFJ A;  3W68 A;  2KLV A;  4KHX A;  1EZV I;  2NPS D;  4JQ0 D;  3CCM P;  1T2K C;  3JC2 2;  4NB9 D;  3IFM A;  1X22 A;  1KZU B;  3AEF C;  1QL2 A;  1Q7Y Q;  3GCE A;  2YXR B;  5AVV B;  1PL5 A;  3E7K A;  2O01 H;  2Q1K A;  1NDO A;  3L4F A;  1DX7 A;  3V6I A;  5KLV K;  2GBW A;  3AE5 C;  5KJ7 C;  1JEK A;  3HUS C;  1WT6 A;  3WUT A;  1AA0 A;  3RL0 B;  2OYI B;  3L74 J;  3H1K J;  1VQ9 P;  3N0Q A;  3HE4 B;  3H1J J;  3Q5P A;  3RK3 B;  2HML A;  3PRJ A;  3P32 A;  4PV1 B;  3RL0 C;  1JCD A;  2Y9Z A;  3L75 D;  3M0D C;  1T6A A;  3H1I J;  3MHV A;  4CPG A;  2WSF J;  4XE5 B;  2KOG A;  1OVU A;  2M3E A;  2JWD A;  1SQX G;  4I6M C;  1SQB J;  1GW4 A;  1ZV8 A;  2LXB A;  4N78 D;  3FGA D;  1YTZ I;  1IZN B;  4W80 A;  2WZ7 A;  3M9H A;  4H13 D;  1PPJ G;  2N1T B;  1NTM E;  4WWI A;  3FOU A;  3BCC D;  3TF5 A;  4AUW A;  1Y47 A;  4EYY Q;  3B71 A;  2M0B A;  2QE7 H;  1M57 D;  1JY2 N;  1MUU A;  2NVG A;  4PV1 C;  2H88 C;  5AW9 B;  1T3U A;  2BCC D;  3SFD C;  1SQV D;  2Y0D A;  2Z4E A;  4ASV A;  1YJ9 P;  1P84 I;  4PD4 H;  5KLV G;  4QUQ A;  3U1A A;  1H88 A;  4H44 B;  1SVF A;  1AVO A;  1IO4 A;  2UWJ E;  2I7F A;  1Q86 Q;  1DH3 A;  1JB0 J;  1RE3 A;  2NWF A;  4ZKU A;  2NUM A;  2PP6 A;  3LW5 J;  1BGY E;  4IL6 E;  2ZXX A;  3CXH D;  4N78 E;  1Q90 C;  2W8Z A;  3OW2 O;  3CX5 E;  4OGQ D;  3L70 J;  1ZME C;  3BAT A;  3KZI H;  1WQL A;  2E42 A;  1SQP D;  2Y0C A;  4QMA A;  1LP1 A;  4QCK A;  1X8Y A;  1J1D B;  4BRY B;  2DW3 A;  2YKQ A;  1GK4 A;  1M1J B;  2H8P D;  3H1I E;  1M1J A;  4QDD A;  1RIE A;  2B9B A;  5CCG D;  5B66 H;  2WIT A;  1A02 F;  4HJL A;  1SQX D;  5KTB A;  1HGZ A;  1VL2 A;  2BCC J;  3CCL P;  1QLE D;  3GHG B;  4RES B;  1N7S D;  1OWA A;  1FE6 A;  4AQR D;  4AIV A;  2OAR A;  2QA4 P;  1RQU A;  1KYO H;  2N1T D;  3H1K D;  2CPB A;  4YXW H;  1KV4 A;  5CCG A;  1JTH B;  1AJY A;  2BAS A;  1JCC A;  2QJY B;  3GZY A;  4HM5 A;  1M1J C;  1G8K B;  1UIX A;  2G3A A;  3PP5 A;  2BEQ D;  3CX5 D;  2P1J A;  3H1I D;  1VQO P;  2NVE A;  3VMH D;  5KAF E;  1GU5 A;  3TNU A;  4UB8 H;  2O1K A;  2Q3W A;  2WPR A;  4WY4 C;  1BSN A;  5B66 E;  4EIJ A;  1VDF A;  2ZVN B;  2KK7 A;  3MD0 A;  4DOJ A;  3HE4 A;  3GKE A;  1VF5 D;  3FX0 A;  3RL0 D;  3CL3 D;  3HTK B;  1PP9 E;  1LGH B;  1GK6 A;  4GT1 A;  2XNX A;  5APW A;  1M7L A;  1N73 A;  5AVS B;  4HB1 A;  1EXJ A;  1HGV A;  1SQB E;  2OQQ A;  1H0T A;  3RK2 B;  3WU2 E;  3G4S P;  1OW8 A;  2A06 G;  3Q2Y A;  1BCC D;  2ZYD A;  2J5U A;  4JPZ B;  3VMY A;  4I1L A;  3AE7 C;  4A7P A;  3IR9 A;  3FXD A;  4PD4 E;  3CC2 P;  2Q6Q A;  4HM6 A;  4R4M A;  1BE3 D;  5CHX A;  4K35 A;  2B89 A;  1NVO A;  2D2C B;  1SQV K;  2VRS A;  1OX3 A;  2FYU G;  3U59 A;  2KUB A;  2RKL A;  1FDI A;  3CXH I;  1R5L A;  1FJK A;  5AW7 B;  1RF0 C;  1OIP A;  2K37 A;  4BRY A;  5E79 H;  3H1L G;  4ZNC A;  2FFD B;  4R4L A;  3GL2 A;  2HG5 D;  5APQ A;  2FYZ A;  4O9B A;  4TLF A;  2KP8 A;  2J59 M;  1O7G A;  1MV8 A;  3CCJ P;  3I5C A;  3M0D A;  1VQN P;  3II6 A;  1SQV G;  5APY A;  3KZI E;  1YI2 P;  2M5A A;  5CJ4 A;  4B86 A;  2FYU K;  3L73 G;  5BU5 A;  4IFM A;  4L73 A;  1M90 Q;  4NPF X;  2H7H A;  1S9K E;  2WSF H;  1LTI C;  1YBK A;  1O7M A;  1JY3 P;  1HBW A;  2R44 A;  1NYH A;  1DEB A;  1L0N E;  3BCC G;  5KAI E;  2HLO A;  2HR3 A;  4YTP C;  4IFF A;  3B5N D;  1Z56 A;  1J1E C;  3L74 D;  1IC2 A;  4AYC A;  3RBX A;  1E5W A;  1D7M A;  4HM8 A;  1ZN5 A;  2WT7 A;  2AEM A;  1YJW P;  3H1H J;  1G2C A;  1SQQ K;  1FZC C;  1OW7 A;  3P7K A;  3CCE P;  4EOT A;  4NBF D;  1PP9 D;  1X0T A;  3GHG C;  3T97 B;  4IOI H;  1LTT C;  4QDF A;  2JJL A;  2JO6 A;  4H44 C;  2ZYL A;  3L72 D;  1KIL A;  1YQ4 C;  4RO0 A;  1J2J B;  3HUS B;  3G6E P;  3HE5 B;  1EZV G;  2FXM A;  2FYU J;  3OJA B;  4WB4 A;  3AE3 C;  1GD2 E;  2IZ0 A;  3KHU A;  4RKU J;  2ITA A;  2K9J A;  3P8M C;  2HPC B;  3VP8 A;  2GBX A;  2JZA A;  1NTK K;  2O3J A;  3WUU A;  3RBZ A;  1JMB A;  3AE2 C;  2BMR A;  3GLM A;  1RE3 C;  1MFZ A;  2POH A;  3V5B A;  2JP3 A;  2B1X A;  1NU1 E;  1Y9B A;  2PRR A;  3AEA C;  2FYN B;  2N9B A;  4NBC D;  5DJU B;  4C7R A;  3A0H H;  4IFD K;  2KS1 B;  3M0A A;  2ZT9 D;  3VTP C;  3AE4 C;  1N73 C;  1PP9 G;  1L0L G;  3G9R A;  4Y99 C;  2I1J A;  1USD A;  1XTG B;  4HM3 A;  1PGO A;  3V4Q A;  2JDI H;  1L4A B;  1SQQ D;  1PPJ E;  4RJT A;  2Z5H A;  1S1C X;  4HM7 A;  1FOS E;  2E5Y A;  3H1J G;  1PFI A;  4W7Y A;  4GOF A;  4C7N B;  1IFN A;  3VMI D;  1JMM A;  4GKG A;  3O6Q B;  3L74 G;  3L72 G;  1USE A;  5CCH C;  5KLV D;  1OXZ A;  4NBE D;  5BOK A;  3G3Z A;  3VCA A;  2YMK A;  2W27 A;  1JY3 O;  3P8C E;  2PAJ A;  1U57 A;  2K9J B;  1ZOY C;  2I8D A;  1N86 A;  1LT9 A;  3NTN A;  4HYT B;  3SWF A;  1RFS A;  3SWK A;  4NPD A;  1PGJ A;  1PV3 A;  3PH0 A;  1LTG C;  1GMJ A;  1OZH A;  3L72 E;  2YO3 A;  4HKV A;  2LR2 A;  2YIU C;  1LTJ B;  3Q1M A;  3KYQ A;  1L0N J;  1IFP A;  1KN7 A;  1SQV J;  3A3Y B;  3EQQ A;  2IFN A;  3HD7 B;  2FKW B;  1G8J B;  1GL2 B;  4PD4 I;  3HE5 A;  5KJ7 A;  2RMZ A;  2ZT9 B;  1N2D C;  1IK7 A;  2MJZ A;  2Q3I A;  4GDO A;  3CCQ P;  5AVU B;  2R3C A;  3VN0 A;  1FBM A;  3I56 P;  1NU1 D;  5KLV E;  1SFC A;  1H8A A;  2QRX A;  4EMJ B;  1L0L D;  5C39 A;  1FS0 E;  1SFC C;  5AVX B;  1DD3 A;  4OH8 B;  1FQT A;  1IJD B;  1YHQ P;  3P8C D;  1VQ6 P;  2D2C D;  1LTB C;  3L71 J;  4D6T D;  1JY2 O;  1M1K Q;  1JM1 A;  3CMA P;  2FXO A;  1SQP J;  5M1B A;  1EXI A;  1S2E A;  2O01 J;  3CC7 P;  3LID A;  1VF5 B;  4Z1M H;  2QJK B;  1BCC E;  5AW4 B;  3RK2 D;  2LXC B;  2WT7 B;  2E5T A;  3AEB C;  2KZI A;  3MTU E;  1SQQ E;  1KQG B;  1UUV A;  2ZYG A;  1JTH A;  1SQQ J;  2NVF A;  3B5N A;  1SQX E;  3IAO A;  2H43 A;  3B5N B;  3H1K E;  2WPQ A;  1W2B O;  4QDF B;  5APU A;  2QG4 A;  1EDI A;  4DCK A;  4N3Y B;  1QEX A;  2M3B A;  4U3F G;  2A45 I;  1FAV A;  3GZX A;  2QIW A;  1CZQ A;  1HF9 A;  1KB9 E;  3OA7 A;  4HM4 A;  1ZRT E;  3H6P A;  4HKZ H;  1W2E A;  1YYC A;  1JY3 N;  2C9L Y;  1L0N G;  4H0L C;  3LW5 H;  1MFT A;  2IYO A;  1NU1 K;  1N73 B;  1KYO E;  1ZP0 C;  1LT1 A;  1YIT P;  2WSC H;  2Y0E A;  1SP4 A;  2E74 C;  1QX8 A;  2K88 A;  1J1D C;  5DJT B;  2E75 C;  1KFN A;  1UII A;  1YTZ T;  3GTS A;  5APV A;  2SPZ A;  3L71 E;  1O7H A;  5KKZ B;  1NYK A;  3B5N C;  2HPC A;  4L74 A;  2HMN A;  3MUD A;  1JO5 A;  1NH4 A;  3MZW B;  3CCV P;  1FOS F;  1JM0 A;  4H0L B;  2IBZ G;  4PJ0 H;  3HTK A;  1ULJ A;  4UB8 E;  1LTA C;  1NU1 G;  4H0L D;  1PP9 J;  3H1L J;  1BCC J;  2QPZ A;  4I7Z C;  2E74 B;  4ZMD A;  5HL4 A;  1HH0 A;  2XU6 A;  2R5B A;  2XND H;  5CXM A;  1RY3 A;  4JYB A;  2Q7C A;  3PTZ A;  3PLN A;  2G8Y A;  2BEZ F;  3CXH H;  3L71 D;  1W5C E;  1OW6 A;  3VOP A;  5KLV J;  3S9O A;  3VMG D;  1FZC B;  5AVY B;  3M06 A;  2OTK E;  2E75 B;  1LP1 B;  1LJ2 A;  4H13 B;  1PIX A;  3QH9 A;  2FY8 A;  3AE1 C;  1AV1 A;  1XTC C;  5TIS E;  2OYO A;  4N6J A;  2M5A B;  3TGU E;  1URQ D;  2Q5U A;  1FJP A;  1U7M A;  1SQP E;  2N1T A;  2ZT9 C;  2YMY A;  1NTZ D;  1KB9 D;  1SQB K;  2FBW C;  1SQB G;  1L2P A;  1U7J A;  5CCH A;  1HVV A;  3RK3 D;  3GF3 A;  2HMM A;  1VQK P;  2QJK C;  4ASW A;  3KPE A;  3ABV C;  1HJ0 A;  2FYU D;  1VCK A;  1BGY J;  3R4Y A;  4JBZ A;  3A0B E;  3GF7 A;  3M9B A;  1NJI Q;  3CCS P;  5AVQ B;  1RF1 C;  2WMM A;  3CWB J;  1ZRT D;  3CD6 P;  4WY4 D;  3E1R A;  3H1J E;  4PV1 D;  2JWA A;  3EFG A;  2P10 A;  5AW1 B;  2AXC A;  2OYI C;  1S5L X;  1VQM P;  2JR8 A;  2BMO A;  2HOD B;  1QVF O;  1VM9 A;  4U7J A;  3TNU B;  2WSC J;  2GM4 A;  2IPP A;  2DE6 D;  3L72 J;  3CWB G;  5AVR B;  1RE4 C;  2O1J A;  2NPS B;  1BDD A;  5B5E E;  3BVH A;  1VQP P;  2L5G B;  1AVY A;  1NTM J;  1AQ5 A;  1ZXG A;  1OMI A;  1YIJ P;  5CJ0 A;  5KJ7 D;  4D6T E;  1NTZ E;  2J58 A;  3HD7 C;  1JY2 P;  1DEE G;  1X79 B;  1OFC X;  1S5L E;  1SQX K;  5AVT B;  1DD4 A;  3L75 J;  2I1K A;  1KB9 H;  2FYU E;  3H1I G;  4KJM A;  2E76 B;  1KFM A;  1NTK D;  4WY4 B;  4WBA A;  3CC4 P;  2W6J H;  2JEE A;  1KIL C;  4NBH D;  4H44 D;  4D6T G;  2ZJS E;  2DE5 D;  3N7N A;  4KT0 J;  4HM2 A;  1EZV E;  3TYY A;  1L0L J;  3VP9 A;  2DE7 D;  4OVN F;  3D89 A;  2A45 G;  1KB9 I;  4NBD D;  1NU1 J;  3RK2 C;  1RHZ B;  3S4R A;  1RF0 A;  1N8R Q;  4L75 A;  2P67 A;  1NTZ G;  1VQL P;  2GUV A;  3PHL A;  4U3F J;  3H32 B;  1EDK A;  2PGD A;  1N7S C;  1JNM A;  3AED C;  1IFD A;  4HM0 A;  2PFX A;  1SJG A;  5TJH A;  2YFI A;  2W6A A;  3L70 E;  2XSH A;  4XA4 A;  1FDM A;  2XZR A;  4HJG H;  2IFM A;  5AW6 B;  1EDJ A;  3EQ2 A;  5KLI C;  2KNC A;  4WVZ A;  1NKN A;  1PZQ A;  3GHG A;  3B4S A;  3O6Q A;  4UB6 H;  3B8E B;  5KKZ C;  3WMM 0;  1NTK E;  3L73 E;  5KLI B;  1KTM A;  2KYV A;  1L0L K;  2BCC E;  1VQ4 P;  1DIP A;  3TGU J;  2WTY A;  4DJG A;  3TK1 A;  1VF5 C;  4IL6 X;  3Q3D A;  2NPS C;  5AW5 B;  1T2K D;  2ZXE B;  1N7L A;  1S9K D;  1RF1 A;  1KOR A;  1QL1 A;  2KNC B;  5TIS H;  1IFI A;  1BDC A;  3TGU D;  5GTH H;  2HMO A;  3U1C A;  4W7Z A;  4HM1 A;  3TGU G;  2QJY C;  5CCG C;  5K5G B;  3VMX A;  1SFC D;  5BVZ A;  1GL2 A;  2C9N Y;  4UB6 E;  4GOE A;  3H32 A;  3WUV A;  1KIL E;  2B88 A;  1NAF A;  4IL6 H;  1KQS O;  5H2F H;  1EG9 A;  2NUK A;  1TU3 F;  3RL0 g;  1EZV D;  4XFJ A;  2YNY A;  2ZYA A;  1Q81 Q;  1BE3 E;  1GZL A;  2YKP A;  1O7P A;  3KXD A;  3A5T A;  2KB7 P;  3T97 A;  1FU1 A;  4C7N A;  1J1E B;  3AZC A;  1JOC A;  2L91 A;  4AAY B;  2KS1 A;  1VPC A;  2OYH B;  5AW3 B;  1RH5 B;  1FZG A;  3I55 P;  2B24 A;  3QWO C;  2R3S A;  2FXP A;  1LTS C;  2V4H A;  1T3J A;  1URQ B;  1O7N A;  5AVZ B;  2QM8 A;  4JF7 A;  5CCH D;  2N9Y B;  1FZF A;  1YJN P;  3OAK A;  1O7W A;  2B87 A;  2QSI A;  2XSO A; 
#chains in the Genus database with same CATH homology
 3DQY A;  4QUQ A;  1JM1 A;  2ZYL A;  4NBH D;  4NBE D;  4H44 D;  3GCE A;  5BOK A;  4QDC A;  3GTS A;  3VCA A;  3L75 E;  2DE5 D;  3L71 E;  1O7H A;  4HM2 A;  1EZV E;  1NYK A;  4HM5 A;  4P1B H;  3GZY A;  2DE7 D;  1G8K B;  3CWB E;  2HMM A;  2YVJ B;  3D89 A;  4NBD D;  2I7F A;  2HMN A;  1NDO A;  1BCC E;  2HMO A;  2QJK C;  3GL2 A;  2CKF A;  1VCK A;  4HM1 A;  3L74 E;  2GBX A;  2IBZ E;  1UUW A;  2QJY C;  2GBW A;  3GB4 A;  2NVE A;  2JZA A;  2FYN C;  1ULJ A;  3VMH D;  2NWF A;  3GTE A;  1L0L E;  3BCC E;  2BMR A;  4U3F E;  2XR8 A;  1O7G A;  2NUM A;  4NBB D;  1RFS A;  1SQQ E;  4QUR A;  2B1X A;  1NU1 E;  2YFL A;  4H0L D;  3VCP A;  2Q3W A;  2QPZ A;  1UUV A;  3H1J E;  4NBC D;  1BGY E;  4PV1 D;  2NVF A;  3H1L E;  1SQX E;  3N0Q A;  1Q90 C;  2E74 D;  5HL4 A;  4HM0 A;  3L72 E;  3CX5 E;  4OGQ D;  1SJG A;  2XRX A;  1SQV E;  2HML A;  3GKE A;  3H1K E;  4HKV A;  1VF5 D;  5CXM A;  1EG9 A;  2YFI A;  2YIU C;  2ZT9 D;  1WQL A;  4QDF B;  2NUK A;  2HMK A;  2BMO A;  1PP9 E;  3L70 E;  2XSH A;  1VM9 A;  3EQQ A;  2E75 D;  1O7M A;  3CXH E;  1G8J B;  5AEW A;  4QCK A;  1L0N E;  1SQB E;  2DE6 D;  5KLI C;  4NBA D;  2E4Q A;  5AEU A;  2YFJ A;  1BE3 E;  3GZX A;  1O7P A;  4HM3 A;  2BMQ A;  1KB9 E;  4P1C H;  4HM4 A;  2QJP C;  1P84 E;  3H1I E;  5KKZ C;  1ZRT E;  3AZC A;  1PPJ E;  4QDD A;  1RIE A;  4AAY B;  5KLV E;  3H1H E;  3VMG D;  4H13 D;  3C0D A;  1NTK E;  3L73 E;  4HM8 A;  4HJL A;  4NB8 D;  4HM7 A;  2BCC E;  1NTM E;  3FOU A;  4EMJ B;  4D6T E;  4PD4 E;  1NTZ E;  4HM6 A;  3GOB A;  2B24 A;  2E76 D;  2E4P A;  1KYO E;  1FQT A;  4NBF D;  4QUP A;  2NVG A;  3VMI D;  2A06 E;  3GL0 A;  4NBG D;  2D2C D;  2HMJ A;  3TGU E;  1O7N A;  1ULI A;  4NB9 D;  2FYU E;  3EN1 A;  1SQP E;  1O7W A;  4QDF A;  4AIV A;  2JO6 A;  2XSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...