2BCCE

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2bccE02
3CX5E 1NTME 3L73E 3DQYA 1NTKE 1SQVE 2BCCE 3L71E 4QDCA 2E75D 2NWFA 4HM8A 3GB4A 4D6TE 3TGUE 4H0LD 2HMOA 2HMJA 2YFJA 2NVGA 2QPZA 4OGQD 4HKVA 3L70E 1O7WA 2E76D 4HM5A 2QJPC 4NBHD 4QUQA 1O7NA 2HMKA 2YFIA 3BCCE 4QDDA 1NYKA 5AEWA 3FOUA 3EQQA 1BE3E 3L74E 1SQPE 1SJGA 2I7FA 1G8JB 1NTZE 2YIUC 4HJLA 5KKZC 1ZRTE 1UUVA 1L0LE 3GZXA 2XR8A 3GL0A 1O7PA 2DE6D 1BGYE 4NBFD 2ZYLA 3VCPA 2HMMA 4AIVA 2NUMA 1KB9E 2B24A 4HM1A 3EN1A 4AAYB 2XRXA 4NBGD 1SQQE 1KYOE 2E74D 4QCKA 3VMID 2NUKA 4P1BH 4HM4A 4HM2A 4QUPA 1UUWA 2BMOA 5CXMA 1ULIA 3VCAA 2XSHA 2JZAA 1RFSA 4H44D 3H1KE 4NBDD 1VF5D 2BMRA 3L75E 1O7HA 3L72E 1Q90C 4PV1D 1PPJE 1VM9A 4HM0A 3GTEA 5BOKA 2HMLA 4NBBD 1BCCE 4QURA 1EZVE 1FQTA 2QJYC 2DE7D 1VCKA 2E4QA 4HM6A 4NBCD 1SQBE 1RIEA 4NB8D 2NVFA 2QJKC 5HL4A 1P84E 4H13D 3H1HE 4QDFB 3C0DA 2B1XA 1G8KB 2GBXA 4EMJB 3GL2A 1NU1E 2YFLA 1JM1A 2YVJB 2JO6A 1SQXE 2BMQA 3GCEA 5KLVE 4HM3A 3VMGD 3GZYA 4QDFA 1PP9E 4NBED 4PD4E 3H1IE 3CXHE 1L0NE 1NDOA 4HM7A 2ZT9D 2FYNC 4P1CH 3AZCA 2A06E 5KLIC 1EG9A 1O7GA 1ULJA 2Q3WA 5AEUA 3GTSA 3H1JE 3H1LE 1O7MA 2NVEA 2HMNA 4U3FE 2D2CD 2IBZE 2DE5D 1WQLA 2XSOA 3GKEA 4NBAD 3GOBA 3D89A 3N0QA 2FYUE 2CKFA 4NB9D 2E4PA 3CWBE 3VMHD 2GBWA
chains in the Genus database with same CATH superfamily
1OW7A 1KILC 2V7QJ 1H8AA 2YFJA 3HE4B 4YXDC 3RGUA 1JO5A 1SQPK 4DCKA 2QE7H 2YO3A 5CHXA 4O9BA 1HVVA 2K3RA 4OVNF 1G8JB 1Y9BA 3FXEA 2KSJA 2MKVA 2KZJA 1N7SB 2ZXEB 3KHUA 2B24A 1S9KD 2E5YA 4PD4H 1QLED 4K35A 4QUPA 4H13B 1LTIC 1L4AA 4ZNCA 3B5NB 1BSNA 3SSUA 2C9LY 3GHGC 5L8RJ 1M1JC 3FWNA 4EYYQ 5BU5A 1BCCE 2JJLA 2YKQA 4HM6A 1RF0C 4L74A 3H1JJ 1VDFA 2FKWB 3OJAB 1BCCG 2HPCB 1PGJA 1H0TA 4QDFA 2BCCJ 2LXBA 3WUVA 1S9KE 2DE5D 3C1LA 4HJGH 4NB9D 5AVTB 4LC1A 2E5TA 1VQ7P 2QJYB 1DEEG 1P84H 1NTKE 2OYIB 2K9YA 1AA0A 1HF9A 2ZFCA 1BGYD 3GB4A 1T3UA 3IN6A 1YQ3C 4HKVA 3PHLA 1GMJA 1NTKG 4QUQA 1X9VA 5KAIH 1FDMA 1L0LK 1NTKK 1SQXD 1K73Q 1T2KD 2W83C 1FAVA 4B86A 1T2KC 5AVXB 2HYNA 4JF7A 3RL0g 1VL2A 2WQYC 1KQSO 1Q90D 3VMYA 2HFED 4W80A 1A02J 1Q90C 2OYHC 5B66E 1VM9A 3E7KA 3GMAA 3L70D 2WWWA 5KKZB 2NVFA 2QJKC 5HL4A 1LWUC 3MTUE 5TISH 4ZKUA 1JB0J 1SQXE 4HM3A 1A02F 2KLUA 2K37A 1L0NE 4HM7A 1FE6A 1KN7A 1FJKA 1O7MA 3N0QA 1AFOA 1KYOI 1L0NG 3CWBE 3D6YA 2Y0EA 1L0NK 3CX5E 2YXRB 2O01J 1N8RQ 1LTJC 1EC5A 2NWFA 3CWBG 3HD7B 5AW8B 5AVSB 1BGYJ 2Z5IA 3L70E 2QJPC 2K9JB 4JQ0D 3ABVC 1S5LX 3C8VA 2SPZA 1SJGA 1Q86Q 4I2LC 1DX7A 4HJLA 1JOCA 3L70G 1NTZJ 4IL6E 5BU8B 2E42A 2QIWA 5AW9B 1URQB 3CXHI 1KFNA 3MP7B 3H1LD 4NBGD 1NH4A 1R8EA 4GODA 1JY3P 1R5SA 2RH0A 1YBKA 3G3ZA 1YQ4C 1GW4A 1PP9D 1M56D 3ITKA 1PPJE 2O01H 2ZYGA 1T8ZA 4YPCA 3R4YA 2ZYAA 1AQTA 5KLVK 2FYUD 3H1HE 1IFMA 1BE3D 1PPJG 3T97B 5AW5B 1GZLA 1JTHA 3KYQA 1SQVD 2NPSA 3L37A 3H1HG 1O7GA 1L4AD 5AEUA 3H1LE 1RE4A 3HE5B 3CCUP 3CC2P 2H8PD 5BVZA 1MUUA 2WZ7A 5B5EH 1L4AC 3Q1MA 4BXLA 3AEEC 3H1LG 3HUSA 4HM8A 5GTHH 3A2AA 3MHVA 2E76D 3CMAP 1ZR4A 4NBHD 2E74B 5M1BA 2WPSA 1NYHA 4N6JA 1CSBA 1BE3E 4HKZH 2N1TA 2E76C 4WY4D 2YIUC 1U7JA 5GTIH 1VF5B 3A0BE 5APSA 2I8DA 3II6A 4RO0A 1FBMA 1JM0A 5AW6B 3QH9A 4PV1B 3EN1A 1D7MA 2IYOA 2H43A 2V4HA 3L73D 3JCUE 1O7HA 2POHA 2PGDA 1YTZT 1EDKA 1NVOA 1PP9J 1ZP0C 3TNUB 3NMDA 3P8CD 4Y99B 1DD4A 1LT9B 1NU1K 2G3AA 3RK3E 4AUWA 2OGUA 1AVOA 2CPSA 2FYUJ 2YFLA 1JCDA 2WPVB 2Q9IA 4IFDK 1RY3A 3RK2B 3GZYA 1HGVA 5APYA 1H89A 3WMM0 4I1LA 1NTMJ 1RF1A 2FYNC 4D6TD 1SQVJ 3GTSA 3H6PA 4BRYA 2A45I 1YJ9P 3JSVC 1T6AA 3L73E 3DQYA 2WPRA 1VQKP 1Q2NA 3L36A 1N2DC 2E75D 2HMJA 2R32A 3BRTB 5E79E 1KQFB 4ZMDA 2XNDH 1VPCA 3P8CE 1SQBD 1N7SA 2MJZA 2Q5UA 3L73G 4QDDA 1YJNP 1KMIZ 1NYKA 3OAKA 1CI6B 4TT3H 1S1CX 2VRSA 1PGPA 3V4WA 3IF4A 3L72D 2ZYLA 2PFXA 4AIVA 3WU2H 1XTCC 5DJTB 3I56P 1ZOYC 1SQQE 2XRXA 1DD3A 1SP4A 4GDOA 3VMID 3EFGA 1S5LH 3M9HA 3C9IA 3CCJP 5AW2B 5AVWB 5KLIB 2JEEA 1SQQG 1SVFA 5AW0B 3L71D 1SQQK 1CW5A 1JY2N 1YJWP 3F89A 3A5TA 3BVHA 1EZVE 1E79H 1GK6A 4UB6E 1SQBE 4NB8D 2J59M 1M57D 3WUUA 4RJTA 2WPQA 3TF5A 1AQ5A 4DT0A 1SQPD 1N73B 3CCEP 3M0AA 2WMMA 2BMQA 2PP6A 1EZVG 3RL0D 4PD4E 2B87B 2KP8A 3AE2C 1ULJA 3RL0C 1FJPA 4D6TJ 1KQGB 4YXWH 3AEDC 2CKFA 3GHGB 1JMMA 3V2RA 1KC8Q 3MUDC 2Z5HA 2AEFA 4XE5B 1RH5B 3BCCG 3GW6A 3L71E 2ZJSE 1IFDA 5AW3B 2NVGA 1RHZB 2WT7B 1NOHA 1K04A 1JY2P 1ZW0A 1FZCA 3W67A 1M8OB 3V4QA 3FOUA 3L71G 2NPSD 1SQPE 2D2CC 4GIFA 3PTZA 1HBWA 2NPSC 3L75J 4L73A 2HG5D 1KB9E 3L72J 1BCCD 1SQPG 1JY3O 3V2PA 3U1AA 1RE4C 4QCKA 2KZIA 3P7KA 1EZVI 2KUBA 2BMRA 1GU4A 2B9BA 3HUSC 1VQPP 3KPEA 4HM0A 1GDTA 4QURA 1LP1A 4PD4I 1VQ4P 2N1TD 3GLMA 1WMKA 4KHXA 2B1XA 2R3CA 5CCHD 2N1TC 4ASVA 1L0LD 1MFZA 3CCLP 1NTKD 3CCRP 1S4XA 1QX8A 3KZIH 3I55P 1JNMA 1LTBC 2V7QH 1KYOD 2HMNA 2IBZE 3HD7A 3D89A 3N7NA 1SFCB 2O01N 1XTGB 1IFJA 2OYHB 2K9JA 5APTA 2IBZG 1GL2D 2W6JH 2G8YA 4R4LA 1J1DB 2QJKB 1MV8A 1LWUB 5AW4B 2HMOA 4WY4A 5APWA 1QEXA 2R3SA 3VP8A 2GM4A 1KB9I 2KI7B 1URQA 3M0DA 3L74E 3S9OA 2B89A 2R44A 2H88C 1P84I 3D6ZA 2KS1B 4A7PA 1L0LE 3MD0A 2M8RA 3H1ID 5APXA 3CXHD 1E5WA 2QG4A 1RF1C 3L74G 2HMMA 1KYOE 1BCCJ 1L0LG 1UUWA 2BMOA 2N9YB 1IK7A 4IL6X 3CPWO 4C7NB 1LTJB 1RFSA 3VTPC 4IFMA 5AVZB 2QJPB 1N7SD 2WVRA 1L0ND 3PLNA 3A0HH 3EQ2A 2J5UA 1OW6A 3HTKB 3LIEA 1RIEA 1N7SC 4HB1A 3AE7C 4H13D 2K88A 4BWNA 2OYOA 3B5ND 3CWBD 1G8KB 2IBZI 2BASA 3HRNA 5EFWB 3CX5D 4WVZA 4NBED 3H1IE 2PAJA 3CXHE 3EFFK 1HWTC 1KV4A 1KD1Q 3H1IG 2P2UA 4HH2A 2IZ0A 4Z1MH 1T3JA 4OWFA 3KXDA 2O1KA 3CMEP 2QPZA 3V2NA 5AVUB 1FS0E 1PZQA 3VOPA 1FZGA 2LKMA 1KZUB 1NTZE 5KLVD 2I1JA 1DIPA 3GZXA 3VMXA 4JYCA 4NBFD 3VCPA 1LTGC 5APUA 1PPJD 4IOIH 2NUMA 3M06A 1SLQA 1NTZG 1QGKB 4Y28J 4HM4A 1NTZK 3TNUA 4HM2A 3H1HD 5GTHE 3H1KE 3BATA 1SQXJ 1VQMP 1S72P 2HMLA 1BDCA 5DJUB 2YMKA 3H1KG 2GUVA 1PGOA 2E76B 2YIUB 1FZCC 2L5GB 4QDFB 1MZ9A 3C0DA 1EDJA 2KNCA 4N3YB 3CWBJ 1JMBA 5KLVE 2HODA 2UWJE 1LT1A 3V2QA 3M91A 3IFMA 2M5AB 4H0LB 4HYTB 5CBNA 2IYPA 3CCQP 4NPEA 3Q2YA 5KLVG 3R2PA 2CK3H 3L70J 2M3EA 3GOBA 2IPPA 5B66H 2O1JA 3AE4C 2W6BA 2JP3A 1Z56A 1UIXA 1JY2O 1CI6A 4N78D 1PV3A 1YIJP 1HUCA 3MGNA 2M0BA 2Q3EA 3LW5J 3CCMP 1LNQA 1M90Q 1EQ7A 2BEQD 1VQ9P 2FYNB 3H32A 4GOFA 2XR8A 3AEGC 3I5CA 5KAFE 1VQOP 3HD7D 2DE6D 2ZXXA 3GG2A 2XZRA 4AAYB 3CX5H 2YKPA 1AVYA 3RK3D 2IZ1A 3PH0A 4LLHA 1RQVA 4AQRD 4R4MA 1FU1A 3H1HJ 1MFTA 3RK3C 3KDPB 2A45G 2FXPA 1ZMEC 2R5DA 4OH8B 1KQLA 1N73A 1LGHB 4N78E 1NHLA 3TGUD 1W2BO 2QM8A 5BOKA 1URQD 5CCHA 3BASA 4EDFA 2R5BA 4WY4C 1TU3F 1W5CE 2B87A 3TK1A 4IL6H 3LW5H 3H1LJ 4W7ZA 1URQC 4DZOA 2A06G 3M0DC 1NU1E 1LTTC 2Y0CA 3WU2E 4JYBA 2FYZA 3AE9C 1FZEA 2QRXA 3AZCA 1NU1G 3K5BA 5TJHA 3FGAD 1GL2A 4U3FE 2H89C 1WQLA 1NTMK 5H2FH 2WT7A 1SQVK 1G2CA 5AVYB 5AW7B 1BE3J 4M3LA 1PFIA 1VQLP 4U3FG 4QDCA 2FFDA 3TGUE 3AEAC 1USEA 1SQQD 4HM5A 1O7NA 1UIIA 1YTZI 2O3JA 3EQQA 3HE4A 1Y8AA 3TGUG 3D71A 1WRGA 4H44B 2KB7P 3RL0B 2YO2A 5CJ4A 1J1EC 3GL0A 1AV1A 3G4SP 3CI9A 1YHQP 3N4XA 1EZVD 2E74D 3MZWB 4P1BH 2FBWC 1OZHA 2E75C 2JZAA 1VF5D 2WTYA 4PD4D 1FZAA 3B5NA 1OXZA 4PV1D 2ZT9B 1OWAA 1VF5C 3A0BH 1GU5A 3BCCD 2D2CB 3MIWA 4PV1C 1ZLLA 1KILB 3M9BA 4DOJA 1ZRTD 2XKMA 2ZYDA 3JC22 1SFCA 2LR2A 3L73J 4P1CH 4RESB 2HPCA 2HLOA 3PRJA 1R5LA 3JCUH 1S2EA 2GUSA 4DJGA 1HH0A 3D70A 3E1IA 3RK2D 1M7LA 2JDIH 3B8EB 3QWOC 3CLQA 1IJDB 4GOEA 4KT0J 2ZVOB 3NXSA 2KS1A 2P1JA 3G9RA 2K1AA 1KB9D 3RBZA 4OGQD 3RK2C 2OYIA 1NJIQ 2N1TB 3NFQA 1DH3A 3BCCE 2XDJA 1USDA 1SQQJ 1M1JB 4OGQC 3O6QB 1ZRTE 1YYCA 4PJ0H 4KJMA 2FXMA 3U1CA 3L35A 1Y47A 3L75G 5KJ7D 1Q81Q 3V6IA 1ZV8A 5E79H 1SQBJ 3SWYA 2Q7CA 4I7ZC 2HR3A 1HJ0A 2BCCD 1DEBA 2IFMA 1KORA 1X22A 3PJSK 1OIPA 1ZXGA 3Q5RA 2DE7D 2IBZD 1Q7YQ 1P84E 2RN0A 1JM1A 2JO6A 1GK4A 4C46A 2W90A 5KAIE 4BRYB 5C39A 5KLIC 1NO4A 3L71J 2E43A 3CC7P 2CPBA 3VMZA 4YTPC 3H1JE 2PRRA 4JBZA 3AEFC 3P8MC 3A0HE 3AE3C 3L74D 4UB6H 1K05A 3AE6C 1X79B 3H1JG 1SQPJ 3OW2O 3V5BA 2BCCE 1YITP 1N73C 3GF3A 1H88A 1OVRA 4TLFA 1VQ6P 5CCHC 2AEJA 1O7WA 1LJ2A 2HMKA 1KILE 2BCCG 3AE1C 2RMZA 4L75A 3WUTA 2AXTH 3SFDC 2QEXP 4EOTA 2AXCA 1VQ5P 1U7MA 1QVGO 1OX3A 2KXPB 1O7PA 4IFFA 3CC4P 5TISE 1RE3A 1GL2C 4EI2A 2NZ2A 3SFEC 3Q5PA 3F5HA 2XSHA 4NBDD 1HTLC 3O8ZA 2I1KA 1NAFA 4UB8H 2FFDC 3GTEA 4LGDE 4W7YA 3CD6P 2KOGA 1PIXA 2M5AA 2Q3IA 3KQGA 1LTSC 2OTJP 1FDOA 3U59A 1KB9H 2GBXA 4EMJB 3GL2A 3TDKA 4AYCA 3Q5SA 2KYVA 1IFNA 3T97A 4C7RA 2Q3WA 3GF7A 3P32A 3GKEA 4NPFX 1S3JA 3VMHD 2NRGA 3HE5A 1NTZD 3L74J 1FZFA 2IDBA 1FZCB 4H13C 1L0LJ 1EDIA 3B5NC 2XNXA 4L76A 2BEZF 1NTKJ 3Q3DA 1G1IA 2WSCJ 1QL2A 3AEBC 3NTNA 1SFCD 4U7JA 2I7FA 3H1KD 1KTMA 1BSHA 2OTLP 1VQ8P 5CBOA 1SFCC 2L91A 2WITA 1BGYE 2OQQA 3SWFA 1QVFO 1W2EA 2KIKA 3CCVP 3TYYA 1J1DC 1JUNA 3SWKA 5CXMA 2GA1A 2YXQB 1BGYG 2IX7C 1GTWA 2C0WA 1LP1B 4XFJA 4EIJA 1FOSE 3H1IJ 2KK7A 1SQXG 5B5EE 2QJYC 1L4AB 2OYIC 3FX0A 1VCKA 2E4QA 1SQXK 2WSCH 4GT1A 1JY3N 2P58A 2YMYA 1LT9A 3EWKA 2YVJB 1KYOH 1ZR2A 1SS1A 4WB4A 3GCEA 3VMGD 2DW3A 1X0TA 3TSIA 4K3AA 1L0NJ 2WSSH 4WBAA 3RK3B 5KTBA 5GTIE 2ZAEB 4NBAD 1GW3A 1H0TB 1NGMB 2KSEA 3W68A 1YI2P 2GBWA 4WY4B 2P67A 3VP9A 5APQA 2J58A 2M3BA 3AE5C 3AE8C 3UIAA 3CXHH 2YFIA 3B4SA 5AEWA 1N86A 2H7HA 3MUDA 1AJYA 3S1KA 5KKZC 5KJ7A 3H1KJ 3M9QA 2JWDA 1FOSF 5H2FE 2A06D 2XU6A 1K8AQ 4RKUJ 1HGZA 5CCGA 2Y0DA 1L2PA 2JKVA 2QM7A 2OTKE 2NUKA 1FC2C 1LTAC 2WSFJ 1BDDA 1RQUA 1NU1D 1PL5A 2W6AA 2N9BA 1NTMD 1KILA 1OMIA 3E1RA 5KLVJ 3CX5I 2YKOA 1N7LA 3LIDA 4U3FD 3HD7C 1J1EB 1IFPA 2QA4P 1OVVA 3IR9A 1PP9E 3CCSP 2A06E 2E75B 2W27A 4ZKPA 2Z4EA 5AVQB 2JO1A 1J2JB 1RE3C 1EXIA 1NAYA 2XSOA 1PP9G 2FYUE 2E4PA 3VN0A 4I6MC 2WSFH 1IZNB 1NTME 2C0XA 3GHGA 1M1JA 2AEMA 4XA4A 1SQVE 2FYUG 3VMAA 1BE3G 1S5LE 3O6QA 4H0LD 1IC2A 3VYIA 2FYUK 1Q82Q 2Q1KA 1QL1A 1RF0A 2LXCB 1NTMG 1G1JA 1SQVG 2P10A 4H0LC 3FXDA 2Y9ZA 1OVUA 5CMZA 2IFNA 4HM1A 1M1KQ 1IK9A 1WT6A 5AVVB 1NKNA 2OARA 1ULIA 2YNYA 5CJ0A 1FDIA 3L4FA 3H25A 1NU1J 1GD2E 1FZBA 2RKLA 3AECC 3RBXA 4OGQB 1MKMA 1IO4A 2KNCB 2P7JA 3BRVB 4NBCD 2KLVA 4QMAA 3A7OA 5KAFH 4JPZB 1X8YA 2HODB 4PJ0E 4U3FJ 5AVRB 1VQNP 4NPDA 2WSEJ 5APVA 1OW8A 2A45H 2E74C 2QVAA 1NDOA 1EG9A 1KFMA 3TGUJ 2NVEA 4I7ZB 2ZVNB 1JTHB 4WWIA 2FY8A 2NPSB 4GKGA 3L75D 1HJBA 4ASWA 3S4RA 2OYHA 4D6TE 1EXJA 3OA7A 1U57A 3H32B 1LWUA 2B88A 4D6TG 1PGQA 4Y99C 3HUSB 1LT9C 2W8ZA 2C9NY 1UUVA 2WSEH 1ZN5A 1NWQA 3ZDMA 3FWLA 2Y9YA 3USSA 1P84D 2FXOA 3B71A 1JCCA 5K5GB 3VCAA 4H44D 2JWAA 3KZIE 1SQBG 2XV5A 1IFIA 3L75E 1K9MQ 1CZQA 3L72E 4C7NA 1LTJA 1SQBK 4H44C 1JEKA 3PP5A 4NBBD 3G6EP 1FQTA 2AXTE 3H1JD 1EDLA 3L72G 3CL3D 1OFCX 2ITAA 3HTKA 5CCGD 5KJ7C 1GL2B 2ZT9D 3G71P 5AW1B 1G2CB 5CCGC 2Q6QA 2D2CD 1NKZB 3IAOA 1KILD 2ZT9C 2JR8A 2QSIA 4UB8E 3A3YB 3BCCJ 2FFDB 1RF1B 4MN4C 4CPGA
chains in the Genus database with same CATH topology
3CX5E 1NTME 3L73E 3DQYA 1NTKE 1SQVE 2BCCE 3L71E 4QDCA 2E75D 2NWFA 4HM8A 3GB4A 4D6TE 3TGUE 4H0LD 2HMOA 2HMJA 2YFJA 2NVGA 2QPZA 4OGQD 4HKVA 3L70E 1O7WA 2E76D 4HM5A 2QJPC 4NBHD 4QUQA 1O7NA 2HMKA 2YFIA 3BCCE 4QDDA 1NYKA 5AEWA 3FOUA 3EQQA 1BE3E 3L74E 1SQPE 1SJGA 2I7FA 1G8JB 1NTZE 2YIUC 4HJLA 5KKZC 1ZRTE 1UUVA 1L0LE 3GZXA 2XR8A 3GL0A 1O7PA 2DE6D 1BGYE 4NBFD 2ZYLA 3VCPA 2HMMA 4AIVA 2NUMA 1KB9E 2B24A 4HM1A 3EN1A 4AAYB 2XRXA 4NBGD 1SQQE 1KYOE 2E74D 4QCKA 3VMID 2NUKA 4P1BH 4HM4A 4HM2A 4QUPA 1UUWA 2BMOA 5CXMA 1ULIA 3VCAA 2XSHA 2JZAA 1RFSA 4H44D 3H1KE 4NBDD 1VF5D 2BMRA 3L75E 1O7HA 3L72E 1Q90C 4PV1D 1PPJE 1VM9A 4HM0A 3GTEA 5BOKA 2HMLA 4NBBD 1BCCE 4QURA 1EZVE 1FQTA 2QJYC 2DE7D 1VCKA 2E4QA 4HM6A 4NBCD 1SQBE 1RIEA 4NB8D 2NVFA 2QJKC 5HL4A 1P84E 4H13D 3H1HE 4QDFB 3C0DA 2B1XA 1G8KB 2GBXA 4EMJB 3GL2A 1NU1E 2YFLA 1JM1A 2YVJB 2JO6A 1SQXE 2BMQA 3GCEA 5KLVE 4HM3A 3VMGD 3GZYA 4QDFA 1PP9E 4NBED 4PD4E 3H1IE 3CXHE 1L0NE 1NDOA 4HM7A 2ZT9D 2FYNC 4P1CH 3AZCA 2A06E 5KLIC 1EG9A 1O7GA 1ULJA 2Q3WA 5AEUA 3GTSA 3H1JE 3H1LE 1O7MA 2NVEA 2HMNA 4U3FE 2D2CD 2IBZE 2DE5D 1WQLA 2XSOA 3GKEA 4NBAD 3GOBA 3D89A 3N0QA 2FYUE 2CKFA 4NB9D 2E4PA 3CWBE 3VMHD 2GBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 E;  1NTM E;  3L73 E;  3DQY A;  1NTK E;  1SQV E;  2BCC E;  3L71 E;  4QDC A;  2E75 D;  2NWF A;  4HM8 A;  3GB4 A;  4D6T E;  3TGU E;  4H0L D;  2HMO A;  2HMJ A;  2YFJ A;  2NVG A;  2QPZ A;  4OGQ D;  4HKV A;  3L70 E;  1O7W A;  2E76 D;  4HM5 A;  2QJP C;  4NBH D;  4QUQ A;  1O7N A;  2HMK A;  2YFI A;  3BCC E;  4QDD A;  1NYK A;  5AEW A;  3FOU A;  3EQQ A;  1BE3 E;  3L74 E;  1SQP E;  1SJG A;  2I7F A;  1G8J B;  1NTZ E;  2YIU C;  4HJL A;  5KKZ C;  1ZRT E;  1UUV A;  1L0L E;  3GZX A;  2XR8 A;  3GL0 A;  1O7P A;  2DE6 D;  1BGY E;  4NBF D;  2ZYL A;  3VCP A;  2HMM A;  4AIV A;  2NUM A;  1KB9 E;  2B24 A;  4HM1 A;  3EN1 A;  4AAY B;  2XRX A;  4NBG D;  1SQQ E;  1KYO E;  2E74 D;  4QCK A;  3VMI D;  2NUK A;  4P1B H;  4HM4 A;  4HM2 A;  4QUP A;  1UUW A;  2BMO A;  5CXM A;  1ULI A;  3VCA A;  2XSH A;  2JZA A;  1RFS A;  4H44 D;  3H1K E;  4NBD D;  1VF5 D;  2BMR A;  3L75 E;  1O7H A;  3L72 E;  1Q90 C;  4PV1 D;  1PPJ E;  1VM9 A;  4HM0 A;  3GTE A;  5BOK A;  2HML A;  4NBB D;  1BCC E;  4QUR A;  1EZV E;  1FQT A;  2QJY C;  2DE7 D;  1VCK A;  2E4Q A;  4HM6 A;  4NBC D;  1SQB E;  1RIE A;  4NB8 D;  2NVF A;  2QJK C;  5HL4 A;  1P84 E;  4H13 D;  3H1H E;  4QDF B;  3C0D A;  2B1X A;  1G8K B;  2GBX A;  4EMJ B;  3GL2 A;  1NU1 E;  2YFL A;  1JM1 A;  2YVJ B;  2JO6 A;  1SQX E;  2BMQ A;  3GCE A;  5KLV E;  4HM3 A;  3VMG D;  3GZY A;  4QDF A;  1PP9 E;  4NBE D;  4PD4 E;  3H1I E;  3CXH E;  1L0N E;  1NDO A;  4HM7 A;  2ZT9 D;  2FYN C;  4P1C H;  3AZC A;  2A06 E;  5KLI C;  1EG9 A;  1O7G A;  1ULJ A;  2Q3W A;  5AEU A;  3GTS A;  3H1J E;  3H1L E;  1O7M A;  2NVE A;  2HMN A;  4U3F E;  2D2C D;  2IBZ E;  2DE5 D;  1WQL A;  2XSO A;  3GKE A;  4NBA D;  3GOB A;  3D89 A;  3N0Q A;  2FYU E;  2CKF A;  4NB9 D;  2E4P A;  3CWB E;  3VMH D;  2GBW A; 
#chains in the Genus database with same CATH topology
 1OW7 A;  1KIL C;  2V7Q J;  1H8A A;  2YFJ A;  3HE4 B;  4YXD C;  3RGU A;  1JO5 A;  1SQP K;  4DCK A;  2QE7 H;  2YO3 A;  5CHX A;  4O9B A;  1HVV A;  2K3R A;  4OVN F;  1G8J B;  1Y9B A;  3FXE A;  2KSJ A;  2MKV A;  2KZJ A;  1N7S B;  2ZXE B;  3KHU A;  2B24 A;  1S9K D;  2E5Y A;  4PD4 H;  1QLE D;  4K35 A;  4QUP A;  4H13 B;  1LTI C;  1L4A A;  4ZNC A;  3B5N B;  1BSN A;  3SSU A;  2C9L Y;  3GHG C;  5L8R J;  1M1J C;  3FWN A;  4EYY Q;  5BU5 A;  1BCC E;  2JJL A;  2YKQ A;  4HM6 A;  1RF0 C;  4L74 A;  3H1J J;  1VDF A;  2FKW B;  3OJA B;  1BCC G;  2HPC B;  1PGJ A;  1H0T A;  4QDF A;  2BCC J;  2LXB A;  3WUV A;  1S9K E;  2DE5 D;  3C1L A;  4HJG H;  4NB9 D;  5AVT B;  4LC1 A;  2E5T A;  1VQ7 P;  2QJY B;  1DEE G;  1P84 H;  1NTK E;  2OYI B;  2K9Y A;  1AA0 A;  1HF9 A;  2ZFC A;  1BGY D;  3GB4 A;  1T3U A;  3IN6 A;  1YQ3 C;  4HKV A;  3PHL A;  1GMJ A;  1NTK G;  4QUQ A;  1X9V A;  5KAI H;  1FDM A;  1L0L K;  1NTK K;  1SQX D;  1K73 Q;  1T2K D;  2W83 C;  1FAV A;  4B86 A;  1T2K C;  5AVX B;  2HYN A;  4JF7 A;  3RL0 g;  1VL2 A;  2WQY C;  1KQS O;  1Q90 D;  3VMY A;  2HFE D;  4W80 A;  1A02 J;  1Q90 C;  2OYH C;  5B66 E;  1VM9 A;  3E7K A;  3GMA A;  3L70 D;  2WWW A;  5KKZ B;  2NVF A;  2QJK C;  5HL4 A;  1LWU C;  3MTU E;  5TIS H;  4ZKU A;  1JB0 J;  1SQX E;  4HM3 A;  1A02 F;  2KLU A;  2K37 A;  1L0N E;  4HM7 A;  1FE6 A;  1KN7 A;  1FJK A;  1O7M A;  3N0Q A;  1AFO A;  1KYO I;  1L0N G;  3CWB E;  3D6Y A;  2Y0E A;  1L0N K;  3CX5 E;  2YXR B;  2O01 J;  1N8R Q;  1LTJ C;  1EC5 A;  2NWF A;  3CWB G;  3HD7 B;  5AW8 B;  5AVS B;  1BGY J;  2Z5I A;  3L70 E;  2QJP C;  2K9J B;  4JQ0 D;  3ABV C;  1S5L X;  3C8V A;  2SPZ A;  1SJG A;  1Q86 Q;  4I2L C;  1DX7 A;  4HJL A;  1JOC A;  3L70 G;  1NTZ J;  4IL6 E;  5BU8 B;  2E42 A;  2QIW A;  5AW9 B;  1URQ B;  3CXH I;  1KFN A;  3MP7 B;  3H1L D;  4NBG D;  1NH4 A;  1R8E A;  4GOD A;  1JY3 P;  1R5S A;  2RH0 A;  1YBK A;  3G3Z A;  1YQ4 C;  1GW4 A;  1PP9 D;  1M56 D;  3ITK A;  1PPJ E;  2O01 H;  2ZYG A;  1T8Z A;  4YPC A;  3R4Y A;  2ZYA A;  1AQT A;  5KLV K;  2FYU D;  3H1H E;  1IFM A;  1BE3 D;  1PPJ G;  3T97 B;  5AW5 B;  1GZL A;  1JTH A;  3KYQ A;  1SQV D;  2NPS A;  3L37 A;  3H1H G;  1O7G A;  1L4A D;  5AEU A;  3H1L E;  1RE4 A;  3HE5 B;  3CCU P;  3CC2 P;  2H8P D;  5BVZ A;  1MUU A;  2WZ7 A;  5B5E H;  1L4A C;  3Q1M A;  4BXL A;  3AEE C;  3H1L G;  3HUS A;  4HM8 A;  5GTH H;  3A2A A;  3MHV A;  2E76 D;  3CMA P;  1ZR4 A;  4NBH D;  2E74 B;  5M1B A;  2WPS A;  1NYH A;  4N6J A;  1CSB A;  1BE3 E;  4HKZ H;  2N1T A;  2E76 C;  4WY4 D;  2YIU C;  1U7J A;  5GTI H;  1VF5 B;  3A0B E;  5APS A;  2I8D A;  3II6 A;  4RO0 A;  1FBM A;  1JM0 A;  5AW6 B;  3QH9 A;  4PV1 B;  3EN1 A;  1D7M A;  2IYO A;  2H43 A;  2V4H A;  3L73 D;  3JCU E;  1O7H A;  2POH A;  2PGD A;  1YTZ T;  1EDK A;  1NVO A;  1PP9 J;  1ZP0 C;  3TNU B;  3NMD A;  3P8C D;  4Y99 B;  1DD4 A;  1LT9 B;  1NU1 K;  2G3A A;  3RK3 E;  4AUW A;  2OGU A;  1AVO A;  2CPS A;  2FYU J;  2YFL A;  1JCD A;  2WPV B;  2Q9I A;  4IFD K;  1RY3 A;  3RK2 B;  3GZY A;  1HGV A;  5APY A;  1H89 A;  3WMM 0;  4I1L A;  1NTM J;  1RF1 A;  2FYN C;  4D6T D;  1SQV J;  3GTS A;  3H6P A;  4BRY A;  2A45 I;  1YJ9 P;  3JSV C;  1T6A A;  3L73 E;  3DQY A;  2WPR A;  1VQK P;  1Q2N A;  3L36 A;  1N2D C;  2E75 D;  2HMJ A;  2R32 A;  3BRT B;  5E79 E;  1KQF B;  4ZMD A;  2XND H;  1VPC A;  3P8C E;  1SQB D;  1N7S A;  2MJZ A;  2Q5U A;  3L73 G;  4QDD A;  1YJN P;  1KMI Z;  1NYK A;  3OAK A;  1CI6 B;  4TT3 H;  1S1C X;  2VRS A;  1PGP A;  3V4W A;  3IF4 A;  3L72 D;  2ZYL A;  2PFX A;  4AIV A;  3WU2 H;  1XTC C;  5DJT B;  3I56 P;  1ZOY C;  1SQQ E;  2XRX A;  1DD3 A;  1SP4 A;  4GDO A;  3VMI D;  3EFG A;  1S5L H;  3M9H A;  3C9I A;  3CCJ P;  5AW2 B;  5AVW B;  5KLI B;  2JEE A;  1SQQ G;  1SVF A;  5AW0 B;  3L71 D;  1SQQ K;  1CW5 A;  1JY2 N;  1YJW P;  3F89 A;  3A5T A;  3BVH A;  1EZV E;  1E79 H;  1GK6 A;  4UB6 E;  1SQB E;  4NB8 D;  2J59 M;  1M57 D;  3WUU A;  4RJT A;  2WPQ A;  3TF5 A;  1AQ5 A;  4DT0 A;  1SQP D;  1N73 B;  3CCE P;  3M0A A;  2WMM A;  2BMQ A;  2PP6 A;  1EZV G;  3RL0 D;  4PD4 E;  2B87 B;  2KP8 A;  3AE2 C;  1ULJ A;  3RL0 C;  1FJP A;  4D6T J;  1KQG B;  4YXW H;  3AED C;  2CKF A;  3GHG B;  1JMM A;  3V2R A;  1KC8 Q;  3MUD C;  2Z5H A;  2AEF A;  4XE5 B;  1RH5 B;  3BCC G;  3GW6 A;  3L71 E;  2ZJS E;  1IFD A;  5AW3 B;  2NVG A;  1RHZ B;  2WT7 B;  1NOH A;  1K04 A;  1JY2 P;  1ZW0 A;  1FZC A;  3W67 A;  1M8O B;  3V4Q A;  3FOU A;  3L71 G;  2NPS D;  1SQP E;  2D2C C;  4GIF A;  3PTZ A;  1HBW A;  2NPS C;  3L75 J;  4L73 A;  2HG5 D;  1KB9 E;  3L72 J;  1BCC D;  1SQP G;  1JY3 O;  3V2P A;  3U1A A;  1RE4 C;  4QCK A;  2KZI A;  3P7K A;  1EZV I;  2KUB A;  2BMR A;  1GU4 A;  2B9B A;  3HUS C;  1VQP P;  3KPE A;  4HM0 A;  1GDT A;  4QUR A;  1LP1 A;  4PD4 I;  1VQ4 P;  2N1T D;  3GLM A;  1WMK A;  4KHX A;  2B1X A;  2R3C A;  5CCH D;  2N1T C;  4ASV A;  1L0L D;  1MFZ A;  3CCL P;  1NTK D;  3CCR P;  1S4X A;  1QX8 A;  3KZI H;  3I55 P;  1JNM A;  1LTB C;  2V7Q H;  1KYO D;  2HMN A;  2IBZ E;  3HD7 A;  3D89 A;  3N7N A;  1SFC B;  2O01 N;  1XTG B;  1IFJ A;  2OYH B;  2K9J A;  5APT A;  2IBZ G;  1GL2 D;  2W6J H;  2G8Y A;  4R4L A;  1J1D B;  2QJK B;  1MV8 A;  1LWU B;  5AW4 B;  2HMO A;  4WY4 A;  5APW A;  1QEX A;  2R3S A;  3VP8 A;  2GM4 A;  1KB9 I;  2KI7 B;  1URQ A;  3M0D A;  3L74 E;  3S9O A;  2B89 A;  2R44 A;  2H88 C;  1P84 I;  3D6Z A;  2KS1 B;  4A7P A;  1L0L E;  3MD0 A;  2M8R A;  3H1I D;  5APX A;  3CXH D;  1E5W A;  2QG4 A;  1RF1 C;  3L74 G;  2HMM A;  1KYO E;  1BCC J;  1L0L G;  1UUW A;  2BMO A;  2N9Y B;  1IK7 A;  4IL6 X;  3CPW O;  4C7N B;  1LTJ B;  1RFS A;  3VTP C;  4IFM A;  5AVZ B;  2QJP B;  1N7S D;  2WVR A;  1L0N D;  3PLN A;  3A0H H;  3EQ2 A;  2J5U A;  1OW6 A;  3HTK B;  3LIE A;  1RIE A;  1N7S C;  4HB1 A;  3AE7 C;  4H13 D;  2K88 A;  4BWN A;  2OYO A;  3B5N D;  3CWB D;  1G8K B;  2IBZ I;  2BAS A;  3HRN A;  5EFW B;  3CX5 D;  4WVZ A;  4NBE D;  3H1I E;  2PAJ A;  3CXH E;  3EFF K;  1HWT C;  1KV4 A;  1KD1 Q;  3H1I G;  2P2U A;  4HH2 A;  2IZ0 A;  4Z1M H;  1T3J A;  4OWF A;  3KXD A;  2O1K A;  3CME P;  2QPZ A;  3V2N A;  5AVU B;  1FS0 E;  1PZQ A;  3VOP A;  1FZG A;  2LKM A;  1KZU B;  1NTZ E;  5KLV D;  2I1J A;  1DIP A;  3GZX A;  3VMX A;  4JYC A;  4NBF D;  3VCP A;  1LTG C;  5APU A;  1PPJ D;  4IOI H;  2NUM A;  3M06 A;  1SLQ A;  1NTZ G;  1QGK B;  4Y28 J;  4HM4 A;  1NTZ K;  3TNU A;  4HM2 A;  3H1H D;  5GTH E;  3H1K E;  3BAT A;  1SQX J;  1VQM P;  1S72 P;  2HML A;  1BDC A;  5DJU B;  2YMK A;  3H1K G;  2GUV A;  1PGO A;  2E76 B;  2YIU B;  1FZC C;  2L5G B;  4QDF B;  1MZ9 A;  3C0D A;  1EDJ A;  2KNC A;  4N3Y B;  3CWB J;  1JMB A;  5KLV E;  2HOD A;  2UWJ E;  1LT1 A;  3V2Q A;  3M91 A;  3IFM A;  2M5A B;  4H0L B;  4HYT B;  5CBN A;  2IYP A;  3CCQ P;  4NPE A;  3Q2Y A;  5KLV G;  3R2P A;  2CK3 H;  3L70 J;  2M3E A;  3GOB A;  2IPP A;  5B66 H;  2O1J A;  3AE4 C;  2W6B A;  2JP3 A;  1Z56 A;  1UIX A;  1JY2 O;  1CI6 A;  4N78 D;  1PV3 A;  1YIJ P;  1HUC A;  3MGN A;  2M0B A;  2Q3E A;  3LW5 J;  3CCM P;  1LNQ A;  1M90 Q;  1EQ7 A;  2BEQ D;  1VQ9 P;  2FYN B;  3H32 A;  4GOF A;  2XR8 A;  3AEG C;  3I5C A;  5KAF E;  1VQO P;  3HD7 D;  2DE6 D;  2ZXX A;  3GG2 A;  2XZR A;  4AAY B;  3CX5 H;  2YKP A;  1AVY A;  3RK3 D;  2IZ1 A;  3PH0 A;  4LLH A;  1RQV A;  4AQR D;  4R4M A;  1FU1 A;  3H1H J;  1MFT A;  3RK3 C;  3KDP B;  2A45 G;  2FXP A;  1ZME C;  2R5D A;  4OH8 B;  1KQL A;  1N73 A;  1LGH B;  4N78 E;  1NHL A;  3TGU D;  1W2B O;  2QM8 A;  5BOK A;  1URQ D;  5CCH A;  3BAS A;  4EDF A;  2R5B A;  4WY4 C;  1TU3 F;  1W5C E;  2B87 A;  3TK1 A;  4IL6 H;  3LW5 H;  3H1L J;  4W7Z A;  1URQ C;  4DZO A;  2A06 G;  3M0D C;  1NU1 E;  1LTT C;  2Y0C A;  3WU2 E;  4JYB A;  2FYZ A;  3AE9 C;  1FZE A;  2QRX A;  3AZC A;  1NU1 G;  3K5B A;  5TJH A;  3FGA D;  1GL2 A;  4U3F E;  2H89 C;  1WQL A;  1NTM K;  5H2F H;  2WT7 A;  1SQV K;  1G2C A;  5AVY B;  5AW7 B;  1BE3 J;  4M3L A;  1PFI A;  1VQL P;  4U3F G;  4QDC A;  2FFD A;  3TGU E;  3AEA C;  1USE A;  1SQQ D;  4HM5 A;  1O7N A;  1UII A;  1YTZ I;  2O3J A;  3EQQ A;  3HE4 A;  1Y8A A;  3TGU G;  3D71 A;  1WRG A;  4H44 B;  2KB7 P;  3RL0 B;  2YO2 A;  5CJ4 A;  1J1E C;  3GL0 A;  1AV1 A;  3G4S P;  3CI9 A;  1YHQ P;  3N4X A;  1EZV D;  2E74 D;  3MZW B;  4P1B H;  2FBW C;  1OZH A;  2E75 C;  2JZA A;  1VF5 D;  2WTY A;  4PD4 D;  1FZA A;  3B5N A;  1OXZ A;  4PV1 D;  2ZT9 B;  1OWA A;  1VF5 C;  3A0B H;  1GU5 A;  3BCC D;  2D2C B;  3MIW A;  4PV1 C;  1ZLL A;  1KIL B;  3M9B A;  4DOJ A;  1ZRT D;  2XKM A;  2ZYD A;  3JC2 2;  1SFC A;  2LR2 A;  3L73 J;  4P1C H;  4RES B;  2HPC A;  2HLO A;  3PRJ A;  1R5L A;  3JCU H;  1S2E A;  2GUS A;  4DJG A;  1HH0 A;  3D70 A;  3E1I A;  3RK2 D;  1M7L A;  2JDI H;  3B8E B;  3QWO C;  3CLQ A;  1IJD B;  4GOE A;  4KT0 J;  2ZVO B;  3NXS A;  2KS1 A;  2P1J A;  3G9R A;  2K1A A;  1KB9 D;  3RBZ A;  4OGQ D;  3RK2 C;  2OYI A;  1NJI Q;  2N1T B;  3NFQ A;  1DH3 A;  3BCC E;  2XDJ A;  1USD A;  1SQQ J;  1M1J B;  4OGQ C;  3O6Q B;  1ZRT E;  1YYC A;  4PJ0 H;  4KJM A;  2FXM A;  3U1C A;  3L35 A;  1Y47 A;  3L75 G;  5KJ7 D;  1Q81 Q;  3V6I A;  1ZV8 A;  5E79 H;  1SQB J;  3SWY A;  2Q7C A;  4I7Z C;  2HR3 A;  1HJ0 A;  2BCC D;  1DEB A;  2IFM A;  1KOR A;  1X22 A;  3PJS K;  1OIP A;  1ZXG A;  3Q5R A;  2DE7 D;  2IBZ D;  1Q7Y Q;  1P84 E;  2RN0 A;  1JM1 A;  2JO6 A;  1GK4 A;  4C46 A;  2W90 A;  5KAI E;  4BRY B;  5C39 A;  5KLI C;  1NO4 A;  3L71 J;  2E43 A;  3CC7 P;  2CPB A;  3VMZ A;  4YTP C;  3H1J E;  2PRR A;  4JBZ A;  3AEF C;  3P8M C;  3A0H E;  3AE3 C;  3L74 D;  4UB6 H;  1K05 A;  3AE6 C;  1X79 B;  3H1J G;  1SQP J;  3OW2 O;  3V5B A;  2BCC E;  1YIT P;  1N73 C;  3GF3 A;  1H88 A;  1OVR A;  4TLF A;  1VQ6 P;  5CCH C;  2AEJ A;  1O7W A;  1LJ2 A;  2HMK A;  1KIL E;  2BCC G;  3AE1 C;  2RMZ A;  4L75 A;  3WUT A;  2AXT H;  3SFD C;  2QEX P;  4EOT A;  2AXC A;  1VQ5 P;  1U7M A;  1QVG O;  1OX3 A;  2KXP B;  1O7P A;  4IFF A;  3CC4 P;  5TIS E;  1RE3 A;  1GL2 C;  4EI2 A;  2NZ2 A;  3SFE C;  3Q5P A;  3F5H A;  2XSH A;  4NBD D;  1HTL C;  3O8Z A;  2I1K A;  1NAF A;  4UB8 H;  2FFD C;  3GTE A;  4LGD E;  4W7Y A;  3CD6 P;  2KOG A;  1PIX A;  2M5A A;  2Q3I A;  3KQG A;  1LTS C;  2OTJ P;  1FDO A;  3U59 A;  1KB9 H;  2GBX A;  4EMJ B;  3GL2 A;  3TDK A;  4AYC A;  3Q5S A;  2KYV A;  1IFN A;  3T97 A;  4C7R A;  2Q3W A;  3GF7 A;  3P32 A;  3GKE A;  4NPF X;  1S3J A;  3VMH D;  2NRG A;  3HE5 A;  1NTZ D;  3L74 J;  1FZF A;  2IDB A;  1FZC B;  4H13 C;  1L0L J;  1EDI A;  3B5N C;  2XNX A;  4L76 A;  2BEZ F;  1NTK J;  3Q3D A;  1G1I A;  2WSC J;  1QL2 A;  3AEB C;  3NTN A;  1SFC D;  4U7J A;  2I7F A;  3H1K D;  1KTM A;  1BSH A;  2OTL P;  1VQ8 P;  5CBO A;  1SFC C;  2L91 A;  2WIT A;  1BGY E;  2OQQ A;  3SWF A;  1QVF O;  1W2E A;  2KIK A;  3CCV P;  3TYY A;  1J1D C;  1JUN A;  3SWK A;  5CXM A;  2GA1 A;  2YXQ B;  1BGY G;  2IX7 C;  1GTW A;  2C0W A;  1LP1 B;  4XFJ A;  4EIJ A;  1FOS E;  3H1I J;  2KK7 A;  1SQX G;  5B5E E;  2QJY C;  1L4A B;  2OYI C;  3FX0 A;  1VCK A;  2E4Q A;  1SQX K;  2WSC H;  4GT1 A;  1JY3 N;  2P58 A;  2YMY A;  1LT9 A;  3EWK A;  2YVJ B;  1KYO H;  1ZR2 A;  1SS1 A;  4WB4 A;  3GCE A;  3VMG D;  2DW3 A;  1X0T A;  3TSI A;  4K3A A;  1L0N J;  2WSS H;  4WBA A;  3RK3 B;  5KTB A;  5GTI E;  2ZAE B;  4NBA D;  1GW3 A;  1H0T B;  1NGM B;  2KSE A;  3W68 A;  1YI2 P;  2GBW A;  4WY4 B;  2P67 A;  3VP9 A;  5APQ A;  2J58 A;  2M3B A;  3AE5 C;  3AE8 C;  3UIA A;  3CXH H;  2YFI A;  3B4S A;  5AEW A;  1N86 A;  2H7H A;  3MUD A;  1AJY A;  3S1K A;  5KKZ C;  5KJ7 A;  3H1K J;  3M9Q A;  2JWD A;  1FOS F;  5H2F E;  2A06 D;  2XU6 A;  1K8A Q;  4RKU J;  1HGZ A;  5CCG A;  2Y0D A;  1L2P A;  2JKV A;  2QM7 A;  2OTK E;  2NUK A;  1FC2 C;  1LTA C;  2WSF J;  1BDD A;  1RQU A;  1NU1 D;  1PL5 A;  2W6A A;  2N9B A;  1NTM D;  1KIL A;  1OMI A;  3E1R A;  5KLV J;  3CX5 I;  2YKO A;  1N7L A;  3LID A;  4U3F D;  3HD7 C;  1J1E B;  1IFP A;  2QA4 P;  1OVV A;  3IR9 A;  1PP9 E;  3CCS P;  2A06 E;  2E75 B;  2W27 A;  4ZKP A;  2Z4E A;  5AVQ B;  2JO1 A;  1J2J B;  1RE3 C;  1EXI A;  1NAY A;  2XSO A;  1PP9 G;  2FYU E;  2E4P A;  3VN0 A;  4I6M C;  2WSF H;  1IZN B;  1NTM E;  2C0X A;  3GHG A;  1M1J A;  2AEM A;  4XA4 A;  1SQV E;  2FYU G;  3VMA A;  1BE3 G;  1S5L E;  3O6Q A;  4H0L D;  1IC2 A;  3VYI A;  2FYU K;  1Q82 Q;  2Q1K A;  1QL1 A;  1RF0 A;  2LXC B;  1NTM G;  1G1J A;  1SQV G;  2P10 A;  4H0L C;  3FXD A;  2Y9Z A;  1OVU A;  5CMZ A;  2IFN A;  4HM1 A;  1M1K Q;  1IK9 A;  1WT6 A;  5AVV B;  1NKN A;  2OAR A;  1ULI A;  2YNY A;  5CJ0 A;  1FDI A;  3L4F A;  3H25 A;  1NU1 J;  1GD2 E;  1FZB A;  2RKL A;  3AEC C;  3RBX A;  4OGQ B;  1MKM A;  1IO4 A;  2KNC B;  2P7J A;  3BRV B;  4NBC D;  2KLV A;  4QMA A;  3A7O A;  5KAF H;  4JPZ B;  1X8Y A;  2HOD B;  4PJ0 E;  4U3F J;  5AVR B;  1VQN P;  4NPD A;  2WSE J;  5APV A;  1OW8 A;  2A45 H;  2E74 C;  2QVA A;  1NDO A;  1EG9 A;  1KFM A;  3TGU J;  2NVE A;  4I7Z B;  2ZVN B;  1JTH B;  4WWI A;  2FY8 A;  2NPS B;  4GKG A;  3L75 D;  1HJB A;  4ASW A;  3S4R A;  2OYH A;  4D6T E;  1EXJ A;  3OA7 A;  1U57 A;  3H32 B;  1LWU A;  2B88 A;  4D6T G;  1PGQ A;  4Y99 C;  3HUS B;  1LT9 C;  2W8Z A;  2C9N Y;  1UUV A;  2WSE H;  1ZN5 A;  1NWQ A;  3ZDM A;  3FWL A;  2Y9Y A;  3USS A;  1P84 D;  2FXO A;  3B71 A;  1JCC A;  5K5G B;  3VCA A;  4H44 D;  2JWA A;  3KZI E;  1SQB G;  2XV5 A;  1IFI A;  3L75 E;  1K9M Q;  1CZQ A;  3L72 E;  4C7N A;  1LTJ A;  1SQB K;  4H44 C;  1JEK A;  3PP5 A;  4NBB D;  3G6E P;  1FQT A;  2AXT E;  3H1J D;  1EDL A;  3L72 G;  3CL3 D;  1OFC X;  2ITA A;  3HTK A;  5CCG D;  5KJ7 C;  1GL2 B;  2ZT9 D;  3G71 P;  5AW1 B;  1G2C B;  5CCG C;  2Q6Q A;  2D2C D;  1NKZ B;  3IAO A;  1KIL D;  2ZT9 C;  2JR8 A;  2QSI A;  4UB8 E;  3A3Y B;  3BCC J;  2FFD B;  1RF1 B;  4MN4 C;  4CPG A; 
#chains in the Genus database with same CATH homology
 3CX5 E;  1NTM E;  3L73 E;  3DQY A;  1NTK E;  1SQV E;  2BCC E;  3L71 E;  4QDC A;  2E75 D;  2NWF A;  4HM8 A;  3GB4 A;  4D6T E;  3TGU E;  4H0L D;  2HMO A;  2HMJ A;  2YFJ A;  2NVG A;  2QPZ A;  4OGQ D;  4HKV A;  3L70 E;  1O7W A;  2E76 D;  4HM5 A;  2QJP C;  4NBH D;  4QUQ A;  1O7N A;  2HMK A;  2YFI A;  3BCC E;  4QDD A;  1NYK A;  5AEW A;  3FOU A;  3EQQ A;  1BE3 E;  3L74 E;  1SQP E;  1SJG A;  2I7F A;  1G8J B;  1NTZ E;  2YIU C;  4HJL A;  5KKZ C;  1ZRT E;  1UUV A;  1L0L E;  3GZX A;  2XR8 A;  3GL0 A;  1O7P A;  2DE6 D;  1BGY E;  4NBF D;  2ZYL A;  3VCP A;  2HMM A;  4AIV A;  2NUM A;  1KB9 E;  2B24 A;  4HM1 A;  3EN1 A;  4AAY B;  2XRX A;  4NBG D;  1SQQ E;  1KYO E;  2E74 D;  4QCK A;  3VMI D;  2NUK A;  4P1B H;  4HM4 A;  4HM2 A;  4QUP A;  1UUW A;  2BMO A;  5CXM A;  1ULI A;  3VCA A;  2XSH A;  2JZA A;  1RFS A;  4H44 D;  3H1K E;  4NBD D;  1VF5 D;  2BMR A;  3L75 E;  1O7H A;  3L72 E;  1Q90 C;  4PV1 D;  1PPJ E;  1VM9 A;  4HM0 A;  3GTE A;  5BOK A;  2HML A;  4NBB D;  1BCC E;  4QUR A;  1EZV E;  1FQT A;  2QJY C;  2DE7 D;  1VCK A;  2E4Q A;  4HM6 A;  4NBC D;  1SQB E;  1RIE A;  4NB8 D;  2NVF A;  2QJK C;  5HL4 A;  1P84 E;  4H13 D;  3H1H E;  4QDF B;  3C0D A;  2B1X A;  1G8K B;  2GBX A;  4EMJ B;  3GL2 A;  1NU1 E;  2YFL A;  1JM1 A;  2YVJ B;  2JO6 A;  1SQX E;  2BMQ A;  3GCE A;  5KLV E;  4HM3 A;  3VMG D;  3GZY A;  4QDF A;  1PP9 E;  4NBE D;  4PD4 E;  3H1I E;  3CXH E;  1L0N E;  1NDO A;  4HM7 A;  2ZT9 D;  2FYN C;  4P1C H;  3AZC A;  2A06 E;  5KLI C;  1EG9 A;  1O7G A;  1ULJ A;  2Q3W A;  5AEU A;  3GTS A;  3H1J E;  3H1L E;  1O7M A;  2NVE A;  2HMN A;  4U3F E;  2D2C D;  2IBZ E;  2DE5 D;  1WQL A;  2XSO A;  3GKE A;  4NBA D;  3GOB A;  3D89 A;  3N0Q A;  2FYU E;  2CKF A;  4NB9 D;  2E4P A;  3CWB E;  3VMH D;  2GBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...