1NTZE

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntzE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntzE02
2B1XA 2YFIA 1RFSA 2FYNC 3AZCA 4HJLA 2HMJA 3H1JE 1BE3E 1WQLA 4EMJB 1SQQE 1VF5D 3H1HE 1PPJE 3L73E 4HM6A 1O7PA 4HM7A 3BCCE 1BCCE 3L71E 4HM8A 1G8JB 3VCPA 1VM9A 4QDFB 2CKFA 1JM1A 4OGQD 1EZVE 1SQXE 4H13D 2NVEA 2QPZA 2D2CD 2E74D 2E4PA 4PV1D 4NBFD 1SJGA 1KB9E 2ZYLA 2NWFA 2Q3WA 1O7MA 5KLVE 4NBBD 2HMLA 2NVGA 3FOUA 2NUKA 4D6TE 3VMGD 4QCKA 2BMOA 3CX5E 1O7WA 1NU1E 3L74E 2I7FA 5AEWA 1SQPE 4NBDD 3N0QA 3TGUE 3GB4A 3L72E 4HM2A 4NBHD 1PP9E 1ULIA 2FYUE 2IBZE 4NBED 4AAYB 3GOBA 2E4QA 1Q90C 4AIVA 4NB8D 4NBCD 4NBGD 2YIUC 4QDDA 3GL0A 3GZYA 2YFJA 3H1IE 3GKEA 3C0DA 2QJYC 1UUWA 4PD4E 1EG9A 2YVJB 3DQYA 4QUPA 4QURA 2HMOA 1O7NA 4H44D 1UUVA 4U3FE 2XRXA 2E76D 3GZXA 3VMID 1L0LE 1VCKA 1SQBE 1ZRTE 1NTME 1G8KB 2XR8A 3L70E 2XSHA 2BMRA 5BOKA 2E75D 4P1CH 2JZAA 4NBAD 4HM4A 2JO6A 3GTEA 2ZT9D 3VCAA 4HKVA 4QUQA 2GBXA 5KKZC 3CWBE 1KYOE 3D89A 4QDCA 2NVFA 1NYKA 3GCEA 3GTSA 3CXHE 2B24A 1O7GA 2DE6D 1P84E 3EN1A 3H1LE 3VMHD 4HM5A 5KLIC 5AEUA 4H0LD 5CXMA 3H1KE 2BCCE 1O7HA 3GL2A 1FQTA 1NTZE 3L75E 1ULJA 3EQQA 4P1BH 2QJPC 2GBWA 1SQVE 2DE5D 1NTKE 2DE7D 4QDFA 5HL4A 4NB9D 1NDOA 2XSOA 2HMMA 1L0NE 2NUMA 1BGYE 2QJKC 2HMNA 2YFLA 1RIEA 2A06E 2BMQA 4HM0A 4HM1A 4HM3A 2HMKA
chains in the Genus database with same CATH superfamily
3CWBJ 2FYNC 1JY2N 1M8OB 3GHGA 2IBZG 1YBKA 5KAIH 4H13B 4OGQD 3AE1C 2R5DA 3MHVA 2O1JA 2ZT9C 1SJGA 1WMKA 2KLVA 2NUKA 1EC5A 1AVOA 1D7MA 5E79E 3RBZA 2FFDA 2R5BA 1K05A 3MGNA 3GB4A 3LW5H 4U3FG 1Q90C 2KI7B 3H32A 2C0WA 4WY4B 3P8CD 1KZUB 3Q3DA 1UUVA 2XRXA 3H1KD 3IFMA 1VCKA 3L36A 3BVHA 5TISH 4P1CH 3B8EB 4HM4A 3A0HH 4RESB 1BGYD 4DZOA 3L75G 2BASA 3RL0g 2RN0A 1URQD 4WB4A 1SQVG 3H1LE 3GG2A 2OQQA 3ABVC 3LIDA 4HH2A 2WSFH 3EQQA 1YJ9P 2A45G 3Q2YA 3KZIH 5L8RJ 1TU3F 3EWKA 1HWTC 1IFMA 1L0NE 1K04A 1IFPA 2JDIH 2J59M 2JP3A 1OWAA 1LTJA 4BWNA 2IBZI 1ZMEC 1WQLA 3L73E 4L76A 3QH9A 1FBMA 1S9KD 1BSHA 5B5EE 5AVZB 4HM8A 3L71E 3HTKB 2OYHA 1JEKA 3V2QA 5AVYB 2QM8A 2B89A 2YO3A 2J5UA 2N1TC 5AW8B 1RQUA 2H88C 2NWFA 1LTSC 2L91A 2FYZA 3I5CA 4M3LA 4NPDA 1N7SD 1LT9C 1NU1E 4O9BA 3HRNA 2YXRB 2N1TB 5BU8B 4HM2A 2KS1A 2PFXA 1NTMK 5AVTB 4R4MA 2IBZE 1EDJA 2W27A 1LNQA 2BCCG 3VOPA 1N73C 4H44B 3CXHD 2BEQD 2KZJA 3D70A 3MD0A 2IFMA 1PFIA 3C1LA 2E76D 4LC1A 1MZ9A 2NZ2A 2Z5HA 1L0LK 1NTKD 2W90A 1N73B 1QL1A 3GTEA 4OGQC 4PD4H 4Y99C 5CBOA 4N78E 1ZR2A 1CSBA 2Y0CA 5CBNA 1NOHA 4ASWA 3VMHD 1NAFA 1T2KC 5B66H 5H2FH 1ULJA 1M1JB 3TK1A 1J1EC 2A45I 4D6TG 4ZNCA 1LJ2A 3V5BA 3H1HG 2QJKC 2HMNA 1K8AQ 1FAVA 4C7NB 3WU2E 3D6ZA 3S1KA 4IL6H 1VF5B 1FZCC 4YTPC 2ITAA 1EQ7A 4HM6A 1O7PA 4HM7A 4N3YB 1VL2A 5KLVG 2Q7CA 2JWDA 3H1KJ 1FDMA 4OH8B 1RE3A 2HPCA 5BVZA 4NBFD 2GUVA 1G1IA 2AEMA 1FZCB 1H0TA 1BGYJ 1FZBA 1JCCA 2LR2A 2WSEH 3RK2D 2BMOA 1T6AA 1OIPA 1EXIA 1ULIA 4UB6H 2OTKE 4JPZB 1SQBG 3H1IE 3C0DA 4IFFA 3JCUE 5CCGA 4GOEA 3AE3C 3PLNA 1S5LH 5AW6B 1KFNA 4HYTB 2N9YB 2LXBA 1VQ7P 1FDOA 4HKVA 2C9NY 1SQVK 1Q2NA 4K3AA 3FWNA 5KKZC 3V6IA 3WUTA 1NTZG 1GD2E 2M8RA 3GCEA 3AECC 1SFCA 3H1JD 2B24A 1LGHB 2YMKA 4KJMA 3E1RA 4HM5A 2Q1KA 1LTBC 3G71P 3T97A 2BCCE 3W67A 2Y0DA 5APWA 3CI9A 2GBWA 5AW0B 2Q3EA 1BE3G 1OX3A 1IFDA 2IYPA 2BMQA 5AVSB 1BCCG 3MZWB 2FXOA 3H1IJ 1NHLA 3AE5C 3HD7B 3GLMA 5AVUB 1EDIA 2E76C 3TF5A 1VM9A 3L72D 1SS1A 2NVEA 2ZYAA 2WTYA 1NTKJ 1LP1A 4HJGH 1SQPG 2Y9ZA 2MJZA 4R4LA 2NVGA 2POHA 3VYIA 4D6TE 1O7WA 3CWBG 2YKOA 2O01J 4RKUJ 1AFOA 1Y9BA 4DJGA 2FYUE 5CCHC 3B71A 2P10A 1KQFB 1GU5A 5KAFH 2YVJB 4W7ZA 3GZXA 3WMM0 2E75B 4PJ0E 2P67A 4TLFA 1GL2B 3GF3A 3GTSA 4IFDK 3QWOC 1URQA 3KYQA 1H89A 5KLIC 1PPJD 2HR3A 1KB9I 3RK2C 3BCCD 5AW2B 5CXMA 2MKVA 1YI2P 3A5TA 4P1BH 3OAKA 2YIUB 1FZGA 1DD3A 3M9QA 2YFLA 2QM7A 3O6QA 4C7RA 2K1AA 5DJUB 3CC2P 1YJWP 4N6JA 3HE5A 1BSNA 4KT0J 4OVNF 2NRGA 1U7MA 1OFCX 2CKFA 2D2CB 3BRVB 1H8AA 2QPZA 3V2NA 1VQ6P 2Z5IA 1KB9E 3RL0C 1M56D 1SQXK 1RH5B 2HMLA 2W6AA 2PP6A 1R8EA 3VMGD 3NTNA 3H1JJ 2B87B 2YNYA 1ZW0A 3RL0B 1S72P 3H32B 4NBED 4AUWA 2M3EA 5AW7B 1VQLP 3BRTB 5CJ0A 2FKWB 3CX5H 1WT6A 3SWFA 1FS0E 4NPFX 4UB8E 5GTHH 2M0BA 1LT1A 2AXTE 2CK3H 2JO6A 1JMMA 2JKVA 3CWBE 2CPSA 2OTJP 1OW8A 2XU6A 5CCGD 1EXJA 1LTJC 1X8YA 3R4YA 1VQMP 1L0NG 2P1JA 3S4RA 1LWUA 1SQQK 3MUDA 3WUVA 3II6A 2XDJA 1DD4A 1X0TA 2W8ZA 2OYHC 4QDFA 1JTHB 1NDOA 1ZV8A 2M5AB 3Q1MA 2WZ7A 4NPEA 2K88A 4BRYA 4HM1A 3L71G 5C39A 3PJSK 1PGOA 3AZCA 3CD6P 1SFCD 3AEEC 2E42A 3L74D 5CJ4A 2Y0EA 2H8PD 2NPSC 1NKZB 3M0DA 1PP9D 4PV1D 1HTLC 1OZHA 1O7MA 4PD4D 3AEFC 2QE7H 3A7OA 2QG4A 1KC8Q 3HE4A 3AE9C 1DEEG 2K9YA 5GTIH 2NPSB 2HODA 1NTMD 1HGZA 3L70D 3BCCJ 1JM0A 3CCRP 3B5NB 2OYIB 1P84I 3PHLA 4YXDC 2WSSH 1SP4A 2FYNB 2IZ0A 3H1KG 1Q86Q 4EOTA 5AVXB 2KNCA 3LW5J 1EG9A 2IDBA 3Q5PA 3DQYA 3AE7C 2R44A 3FXDA 1KORA 1L0LD 3CC7P 5AW1B 4YXWH 1ZRTD 4GIFA 1QLED 2ZT9B 2J58A 1M57D 1IK9A 4B86A 3VCAA 2A06D 3U1CA 2G3AA 3N7NA 1JY2P 1Y47A 1FJKA 1GMJA 1JY3N 2M3BA 2DE6D 1P84E 1KILA 4H0LD 1RE4A 3F5HA 3L35A 1YIJP 1AJYA 2JR8A 1KYOH 1UIIA 1L4AA 1RE3C 1NWQA 1XTCC 3AE2C 2WSFJ 1NO4A 1PL5A 3A0BE 2C9LY 3CCLP 4JBZA 1IO4A 4ZMDA 2C0XA 2K9JA 2E74D 2ZVOB 5KJ7C 1IFIA 5BU5A 3V2PA 5AW4B 2R3SA 4ZKUA 4U3FD 2Q5UA 1Q7YQ 3KDPB 3H1IG 3GOBA 2WPRA 4NBCD 2QJYC 5E79H 4W7YA 2Q3IA 1RF1A 2OTLP 1NTKG 1YHQP 2GM4A 1L2PA 1SFCC 1MFZA 1L0LE 1SVFA 3L75D 3SSUA 1ZRTE 3L74J 1FDIA 1SQVD 3VMAA 3VP9A 1PP9J 2ZXXA 4PV1C 1NYKA 1LT9B 1S1CX 1M7LA 3P8CE 3IAOA 1VQNP 2QSIA 3F89A 3H1KE 2BEZF 1FU1A 1UIXA 1OW6A 3AEAC 1EZVD 1NTMJ 3CCMP 3L70J 1LTAC 1HUCA 2XSOA 2YKQA 2WPQA 1BGYE 2E5TA 3M9HA 3NFQA 2PGDA 4OGQB 1NU1K 1L0LJ 4Y99B 3CL3D 1GK6A 4K35A 3BATA 2ZYLA 2WT7B 4NBBD 1FZAA 4WY4A 5B5EH 1G1JA 2FYUG 1CW5A 1J1EB 1S9KE 4H0LC 3CXHI 2QJKB 2WSEJ 3GW6A 2KXPB 1USDA 3I55P 1URQC 2W83C 2OARA 5DJTB 2XZRA 2RKLA 1U57A 1DX7A 3SFEC 1J1DC 3H1JG 3RK3D 4YPCA 5CMZA 2E74C 4QUQA 1W5CE 1URQB 1NKNA 2W6BA 3CXHE 4C46A 2KUBA 1RHZB 1J1DB 3WUUA 2JO1A 3C8VA 4I7ZC 1PGJA 4U3FJ 1O7HA 1FQTA 4I2LC 1KN7A 3HTKA 5CHXA 1NTKE 2DE7D 2YXQB 3D71A 2IX7C 1IJDB 1W2BO 1FZFA 2QA4P 3CX5D 2HG5D 1BDDA 1YTZT 1KILD 1N7SC 4L74A 5M1BA 3SWKA 1PGPA 2N1TA 3L75J 5KKZB 1SQXD 1L4AD 3WU2H 1SQVJ 1KQGB 2XKMA 2FXPA 1CI6B 1N7SB 2R3CA 2OGUA 1SQBD 1N2DC 2LKMA 3N0QA 4XE5B 4AQRD 3K5BA 4WWIA 1N73A 2A45H 4A7PA 1YTZI 3HUSC 3FWLA 3R2PA 2E76B 2HMOA 2PAJA 3CMAP 1FOSE 1A02F 2G8YA 1NTZD 4Y28J 3SFDC 1WRGA 1LWUC 3RK3E 1M1JA 5AVQB 2JZAA 3JCUH 4ZKPA 1PPJG 3HUSB 3BCCG 2O1KA 4L75A 3D89A 2I1JA 4RJTA 4GOFA 3N4XA 3P8MC 1SQQD 1VQOP 4WBAA 1JCDA 1MKMA 1BCCD 3NMDA 2QRXA 3M0DC 4BRYB 1OVVA 1RIEA 1MUUA 2KIKA 1FZCA 1RFSA 1AV1A 1PV3A 3H1JE 1FZEA 2XNXA 1X79B 3GHGC 3H6PA 1SQPD 1LTGC 1HJBA 5APXA 2ZAEB 3TGUD 1SQXE 4H13D 3RK3C 1M90Q 3G9RA 2FYUK 4HKZH 4IOIH 1NYHA 1HF9A 3GHGB 5KLIB 3Q5SA 3RK2B 4GT1A 5KLVK 1VPCA 3KHUA 2E5YA 2FY8A 1GW4A 2I7FA 5AEWA 2FFDC 5EFWB 2WSCH 3L72E 4AAYB 1KQLA 5APVA 1KYOD 2IFNA 3D6YA 3GKEA 5APTA 1Q81Q 3LIEA 1EDKA 4WVZA 4WY4D 1GW3A 2FFDB 4OWFA 3VN0A 1ZXGA 5AW5B 1KILC 1RE4C 1KFMA 3TNUA 1Q90D 1AVYA 1SQBK 2CPBA 2QIWA 1L4AC 1SQXJ 2JEEA 3I56P 2I8DA 4QDCA 2HYNA 1NVOA 1NAYA 3V4QA 1IFNA 4PJ0H 3HD7A 3CCEP 1FC2C 1M1KQ 3BASA 3TSIA 1YQ3C 5KAIE 1NTZK 1JMBA 3L72J 3L74G 4HM0A 2B1XA 2H89C 4EMJB 2L5GB 3AEGC 1PPJE 3BCCE 1NJIQ 1G8JB 2KK7A 3CC4P 4XFJA 1DIPA 1S4XA 2ZFCA 4W80A 1QX8A 1NTMG 1T3UA 3L70G 2H7HA 1LTJB 1AA0A 3FOUA 1RF1C 1JUNA 3A3YB 1SQQJ 2OYHB 1JB0J 2YMYA 1H88A 5CCHA 1KB9H 2N1TD 1R5SA 1SQPK 3JC22 1GDTA 2QEXP 4NB8D 1L0LG 1GU4A 3VMZA 3FGAD 2GA1A 1GL2A 5TISE 3A0HE 5K5GB 1ZOYC 2YKPA 4EDFA 2O01N 3AEDC 3H1LD 4H44D 3FX0A 2UWJE 3AE8C 3VMID 2A06G 2KS1B 2XR8A 1AQ5A 1EDLA 5APQA 4GDOA 2V7QH 3TGUJ 4H13C 1VQ4P 1L0ND 3KZIE 4UB8H 2JWAA 1Y8AA 1O7GA 3EN1A 3U59A 3L73D 2AXTH 1BGYG 2OYOA 3L71D 1VQ9P 1QL2A 4GKGA 5TJHA 1ZR4A 2H43A 2WPVB 1G2CA 3G6EP 1T2KD 3ITKA 4WY4C 1IZNB 1VF5D 1NU1D 3AE4C 1QVFO 2B87A 4AYCA 3VMXA 4PD4I 5AW9B 1Z56A 2IBZD 3VMYA 4EI2A 4L73A 2RH0A 1KTMA 1VQ8P 3CMEP 3JSVC 3L74E 3USSA 4I1LA 4DOJA 4NBDD 5AVWB 3A2AA 2HPCB 3GMAA 1PP9E 3KPEA 1N7LA 1H0TB 4N78D 2K37A 2KYVA 1KD1Q 3P32A 4PD4E 1JY3P 4QURA 4KHXA 5CCGC 1U7JA 1X22A 3TDKA 3UIAA 1JO5A 1NTME 1S3JA 3L70E 3AE6C 5AVRB 2YO2A 5B66E 5H2FE 1JTHA 2M5AA 3PH0A 1EZVG 3M9BA 3PP5A 1N86A 3L37A 4IL6E 4JF7A 4JYCA 5HL4A 2QJYB 3EFGA 2HMMA 3P7KA 1P84H 1IC2A 2A06E 4MN4C 1DEBA 1SFCB 3E1IA 1L0NK 1VQPP 2HMJA 4HJLA 1GK4A 4H44C 2IZ1A 2WPSA 3KQGA 3T97B 1RF0A 3H1LJ 1Q82Q 2NPSA 3HD7D 4XA4A 1GZLA 3OA7A 4PV1B 3A0BH 2E4PA 3B5NA 2OYIA 1K9MQ 3H1ID 3VTPC 2Q3WA 1L0NJ 4UB6E 2KOGA 1E79H 2B9BA 3L4FA 1OVRA 3L73J 1S5LE 2W6JH 1AQTA 2KB7P 3L71J 4NBHD 1USEA 2IPPA 2Q6QA 1M1JC 1LP1B 2KSEA 4NBGD 5APYA 1MV8A 1NGMB 2FXMA 2P58A 2KZIA 4U3FE 2Z4EA 1JY2O 4I6MC 4QMAA 1VF5C 2BCCD 2KLUA 1NU1J 2XSHA 2BMRA 5CCHD 1LTTC 2E75D 3Q5RA 4GODA 3G3ZA 3MTUE 1GL2D 4HB1A 1EZVI 1SLQA 5AW3B 2IYOA 2SPZA 3EFFK 3MP7B 4H0LB 2Q9IA 3U1AA 3C9IA 4CPGA 3GL2A 3L75E 4BXLA 1SQVE 2DE5D 1X9VA 3O8ZA 5APSA 2WITA 4NB9D 1DH3A 1FJPA 1YYCA 1ZP0C 1VDFA 2LXCB 2YFIA 3AEBC 1PIXA 4D6TD 1SQXG 2P7JA 1RQVA 1JY3O 1ZLLA 2HLOA 3H1HD 2DW3A 2PRRA 2E74B 1EZVE 2FYUD 2D2CD 5KJ7A 3O6QB 2WQYC 5KLVD 1IFJA 3HE5B 4RO0A 1PZQA 3L72G 4IL6X 4I7ZB 5KAFE 4QCKA 1HH0A 4LGDE 3RL0D 3M91A 4U7JA 2B88A 1A02J 3GL0A 3MIWA 2YFJA 3PRJA 1E5WA 4QUPA 3EQ2A 1LT9A 2RMZA 1J2JB 2ZYDA 2E43A 3CCUP 1OVUA 1VQ5P 3TNUB 3CCQP 1T8ZA 3HD7C 1T3JA 3B4SA 3RBXA 1SQQG 4ASVA 1YJNP 1NTKK 3H25A 3RGUA 2GBXA 2QVAA 2N9BA 2JJLA 1S5LX 5AEUA 2ZJSE 2XV5A 1KV4A 2R32A 2WVRA 1IK7A 3MUDC 4EYYQ 3CX5I 3CXHH 1KB9D 1RY3A 5AVVB 3TGUG 2WT7A 4C7NA 1BE3D 3TYYA 1LWUB 3H1HE 1R5LA 1YITP 3VCPA 2AEJA 4QDFB 1CZQA 2BCCJ 1HJ0A 1HGVA 2E75C 1FE6A 3NXSA 3S9OA 5KLVE 1GTWA 1GL2C 2O01H 2Y9YA 3CCJP 1JNMA 1VQKP 2ZXEB 4JQ0D 3CX5E 3CPWO 1KILE 2NPSD 1JOCA 2ZYGA 2HFED 3IR9A 1HBWA 3B5ND 1QEXA 4AIVA 3CWBD 2YIUC 5GTHE 1MFTA 3M06A 3GZYA 2WSCJ 1UUWA 3CLQA 3HE4B 2WWWA 3SWYA 1O7NA 3G4SP 2HODB 2GUSA 4D6TJ 3W68A 1PGQA 1SQBE 1G8KB 3RK3B 3H1HJ 2ZT9D 2D2CC 4LLHA 2FYUJ 1W2EA 3VP8A 2KNCB 1QGKB 1KQSO 2NVFA 4DT0A 5KLVJ 2XNDH 1LTIC 2ZVNB 3GF7A 1OXZA 1XTGB 1NTZE 3IN6A 2QJPC 1KMIZ 1K73Q 1FOSF 1OMIA 1G2CB 1CI6A 3OJAB 1BE3E 1N7SA 1KILB 1SQQE 2QJPB 2K3RA 1BCCE 2O3JA 1L4AB 5GTIE 1JM1A 4Z1MH 1SQBJ 4JYBA 4DCKA 5KTBA 3PTZA 3M0AA 1PP9G 2I1KA 1S2EA 4TT3H 1KYOI 1SQPE 3TGUE 2K9JB 3OW2O 3H1LG 1NTZJ 5KJ7D 2E4QA 3V4WA 4QDDA 3HUSA 1YQ4C 1OW7A 3ZDMA 3IF4A 1P84D 2KP8A 1BE3J 1ZN5A 2FBWC 2KSJA 3KXDA 5BOKA 3V2RA 1BDCA 1BCCJ 4NBAD 3L73G 1QVGO 2P2UA 2AXCA 5APUA 1KYOE 4EIJA 1RF1B 1HVVA 4IFMA 2V7QJ 2AEFA 2V4HA 1RF0C 1N8RQ 1NH4A 3CCSP 1SQPJ 3FXEA 2WMMA 1NU1G 3CCVP 2NUMA 3B5NC 2OYIC 4HM3A 3E7KA 2VRSA 2HMKA
chains in the Genus database with same CATH topology
2B1XA 2YFIA 1RFSA 2FYNC 3AZCA 4HJLA 2HMJA 3H1JE 1BE3E 1WQLA 4EMJB 1SQQE 1VF5D 3H1HE 1PPJE 3L73E 4HM6A 1O7PA 4HM7A 3BCCE 1BCCE 3L71E 4HM8A 1G8JB 3VCPA 1VM9A 4QDFB 2CKFA 1JM1A 4OGQD 1EZVE 1SQXE 4H13D 2NVEA 2QPZA 2D2CD 2E74D 2E4PA 4PV1D 4NBFD 1SJGA 1KB9E 2ZYLA 2NWFA 2Q3WA 1O7MA 5KLVE 4NBBD 2HMLA 2NVGA 3FOUA 2NUKA 4D6TE 3VMGD 4QCKA 2BMOA 3CX5E 1O7WA 1NU1E 3L74E 2I7FA 5AEWA 1SQPE 4NBDD 3N0QA 3TGUE 3GB4A 3L72E 4HM2A 4NBHD 1PP9E 1ULIA 2FYUE 2IBZE 4NBED 4AAYB 3GOBA 2E4QA 1Q90C 4AIVA 4NB8D 4NBCD 4NBGD 2YIUC 4QDDA 3GL0A 3GZYA 2YFJA 3H1IE 3GKEA 3C0DA 2QJYC 1UUWA 4PD4E 1EG9A 2YVJB 3DQYA 4QUPA 4QURA 2HMOA 1O7NA 4H44D 1UUVA 4U3FE 2XRXA 2E76D 3GZXA 3VMID 1L0LE 1VCKA 1SQBE 1ZRTE 1NTME 1G8KB 2XR8A 3L70E 2XSHA 2BMRA 5BOKA 2E75D 4P1CH 2JZAA 4NBAD 4HM4A 2JO6A 3GTEA 2ZT9D 3VCAA 4HKVA 4QUQA 2GBXA 5KKZC 3CWBE 1KYOE 3D89A 4QDCA 2NVFA 1NYKA 3GCEA 3GTSA 3CXHE 2B24A 1O7GA 2DE6D 1P84E 3EN1A 3H1LE 3VMHD 4HM5A 5KLIC 5AEUA 4H0LD 5CXMA 3H1KE 2BCCE 1O7HA 3GL2A 1FQTA 1NTZE 3L75E 1ULJA 3EQQA 4P1BH 2QJPC 2GBWA 1SQVE 2DE5D 1NTKE 2DE7D 4QDFA 5HL4A 4NB9D 1NDOA 2XSOA 2HMMA 1L0NE 2NUMA 1BGYE 2QJKC 2HMNA 2YFLA 1RIEA 2A06E 2BMQA 4HM0A 4HM1A 4HM3A 2HMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1X A;  2YFI A;  1RFS A;  2FYN C;  3AZC A;  4HJL A;  2HMJ A;  3H1J E;  1BE3 E;  1WQL A;  4EMJ B;  1SQQ E;  1VF5 D;  3H1H E;  1PPJ E;  3L73 E;  4HM6 A;  1O7P A;  4HM7 A;  3BCC E;  1BCC E;  3L71 E;  4HM8 A;  1G8J B;  3VCP A;  1VM9 A;  4QDF B;  2CKF A;  1JM1 A;  4OGQ D;  1EZV E;  1SQX E;  4H13 D;  2NVE A;  2QPZ A;  2D2C D;  2E74 D;  2E4P A;  4PV1 D;  4NBF D;  1SJG A;  1KB9 E;  2ZYL A;  2NWF A;  2Q3W A;  1O7M A;  5KLV E;  4NBB D;  2HML A;  2NVG A;  3FOU A;  2NUK A;  4D6T E;  3VMG D;  4QCK A;  2BMO A;  3CX5 E;  1O7W A;  1NU1 E;  3L74 E;  2I7F A;  5AEW A;  1SQP E;  4NBD D;  3N0Q A;  3TGU E;  3GB4 A;  3L72 E;  4HM2 A;  4NBH D;  1PP9 E;  1ULI A;  2FYU E;  2IBZ E;  4NBE D;  4AAY B;  3GOB A;  2E4Q A;  1Q90 C;  4AIV A;  4NB8 D;  4NBC D;  4NBG D;  2YIU C;  4QDD A;  3GL0 A;  3GZY A;  2YFJ A;  3H1I E;  3GKE A;  3C0D A;  2QJY C;  1UUW A;  4PD4 E;  1EG9 A;  2YVJ B;  3DQY A;  4QUP A;  4QUR A;  2HMO A;  1O7N A;  4H44 D;  1UUV A;  4U3F E;  2XRX A;  2E76 D;  3GZX A;  3VMI D;  1L0L E;  1VCK A;  1SQB E;  1ZRT E;  1NTM E;  1G8K B;  2XR8 A;  3L70 E;  2XSH A;  2BMR A;  5BOK A;  2E75 D;  4P1C H;  2JZA A;  4NBA D;  4HM4 A;  2JO6 A;  3GTE A;  2ZT9 D;  3VCA A;  4HKV A;  4QUQ A;  2GBX A;  5KKZ C;  3CWB E;  1KYO E;  3D89 A;  4QDC A;  2NVF A;  1NYK A;  3GCE A;  3GTS A;  3CXH E;  2B24 A;  1O7G A;  2DE6 D;  1P84 E;  3EN1 A;  3H1L E;  3VMH D;  4HM5 A;  5KLI C;  5AEU A;  4H0L D;  5CXM A;  3H1K E;  2BCC E;  1O7H A;  3GL2 A;  1FQT A;  1NTZ E;  3L75 E;  1ULJ A;  3EQQ A;  4P1B H;  2QJP C;  2GBW A;  1SQV E;  2DE5 D;  1NTK E;  2DE7 D;  4QDF A;  5HL4 A;  4NB9 D;  1NDO A;  2XSO A;  2HMM A;  1L0N E;  2NUM A;  1BGY E;  2QJK C;  2HMN A;  2YFL A;  1RIE A;  2A06 E;  2BMQ A;  4HM0 A;  4HM1 A;  4HM3 A;  2HMK A; 
#chains in the Genus database with same CATH topology
 3CWB J;  2FYN C;  1JY2 N;  1M8O B;  3GHG A;  2IBZ G;  1YBK A;  5KAI H;  4H13 B;  4OGQ D;  3AE1 C;  2R5D A;  3MHV A;  2O1J A;  2ZT9 C;  1SJG A;  1WMK A;  2KLV A;  2NUK A;  1EC5 A;  1AVO A;  1D7M A;  5E79 E;  3RBZ A;  2FFD A;  2R5B A;  1K05 A;  3MGN A;  3GB4 A;  3LW5 H;  4U3F G;  1Q90 C;  2KI7 B;  3H32 A;  2C0W A;  4WY4 B;  3P8C D;  1KZU B;  3Q3D A;  1UUV A;  2XRX A;  3H1K D;  3IFM A;  1VCK A;  3L36 A;  3BVH A;  5TIS H;  4P1C H;  3B8E B;  4HM4 A;  3A0H H;  4RES B;  1BGY D;  4DZO A;  3L75 G;  2BAS A;  3RL0 g;  2RN0 A;  1URQ D;  4WB4 A;  1SQV G;  3H1L E;  3GG2 A;  2OQQ A;  3ABV C;  3LID A;  4HH2 A;  2WSF H;  3EQQ A;  1YJ9 P;  2A45 G;  3Q2Y A;  3KZI H;  5L8R J;  1TU3 F;  3EWK A;  1HWT C;  1IFM A;  1L0N E;  1K04 A;  1IFP A;  2JDI H;  2J59 M;  2JP3 A;  1OWA A;  1LTJ A;  4BWN A;  2IBZ I;  1ZME C;  1WQL A;  3L73 E;  4L76 A;  3QH9 A;  1FBM A;  1S9K D;  1BSH A;  5B5E E;  5AVZ B;  4HM8 A;  3L71 E;  3HTK B;  2OYH A;  1JEK A;  3V2Q A;  5AVY B;  2QM8 A;  2B89 A;  2YO3 A;  2J5U A;  2N1T C;  5AW8 B;  1RQU A;  2H88 C;  2NWF A;  1LTS C;  2L91 A;  2FYZ A;  3I5C A;  4M3L A;  4NPD A;  1N7S D;  1LT9 C;  1NU1 E;  4O9B A;  3HRN A;  2YXR B;  2N1T B;  5BU8 B;  4HM2 A;  2KS1 A;  2PFX A;  1NTM K;  5AVT B;  4R4M A;  2IBZ E;  1EDJ A;  2W27 A;  1LNQ A;  2BCC G;  3VOP A;  1N73 C;  4H44 B;  3CXH D;  2BEQ D;  2KZJ A;  3D70 A;  3MD0 A;  2IFM A;  1PFI A;  3C1L A;  2E76 D;  4LC1 A;  1MZ9 A;  2NZ2 A;  2Z5H A;  1L0L K;  1NTK D;  2W90 A;  1N73 B;  1QL1 A;  3GTE A;  4OGQ C;  4PD4 H;  4Y99 C;  5CBO A;  4N78 E;  1ZR2 A;  1CSB A;  2Y0C A;  5CBN A;  1NOH A;  4ASW A;  3VMH D;  1NAF A;  1T2K C;  5B66 H;  5H2F H;  1ULJ A;  1M1J B;  3TK1 A;  1J1E C;  2A45 I;  4D6T G;  4ZNC A;  1LJ2 A;  3V5B A;  3H1H G;  2QJK C;  2HMN A;  1K8A Q;  1FAV A;  4C7N B;  3WU2 E;  3D6Z A;  3S1K A;  4IL6 H;  1VF5 B;  1FZC C;  4YTP C;  2ITA A;  1EQ7 A;  4HM6 A;  1O7P A;  4HM7 A;  4N3Y B;  1VL2 A;  5KLV G;  2Q7C A;  2JWD A;  3H1K J;  1FDM A;  4OH8 B;  1RE3 A;  2HPC A;  5BVZ A;  4NBF D;  2GUV A;  1G1I A;  2AEM A;  1FZC B;  1H0T A;  1BGY J;  1FZB A;  1JCC A;  2LR2 A;  2WSE H;  3RK2 D;  2BMO A;  1T6A A;  1OIP A;  1EXI A;  1ULI A;  4UB6 H;  2OTK E;  4JPZ B;  1SQB G;  3H1I E;  3C0D A;  4IFF A;  3JCU E;  5CCG A;  4GOE A;  3AE3 C;  3PLN A;  1S5L H;  5AW6 B;  1KFN A;  4HYT B;  2N9Y B;  2LXB A;  1VQ7 P;  1FDO A;  4HKV A;  2C9N Y;  1SQV K;  1Q2N A;  4K3A A;  3FWN A;  5KKZ C;  3V6I A;  3WUT A;  1NTZ G;  1GD2 E;  2M8R A;  3GCE A;  3AEC C;  1SFC A;  3H1J D;  2B24 A;  1LGH B;  2YMK A;  4KJM A;  3E1R A;  4HM5 A;  2Q1K A;  1LTB C;  3G71 P;  3T97 A;  2BCC E;  3W67 A;  2Y0D A;  5APW A;  3CI9 A;  2GBW A;  5AW0 B;  2Q3E A;  1BE3 G;  1OX3 A;  1IFD A;  2IYP A;  2BMQ A;  5AVS B;  1BCC G;  3MZW B;  2FXO A;  3H1I J;  1NHL A;  3AE5 C;  3HD7 B;  3GLM A;  5AVU B;  1EDI A;  2E76 C;  3TF5 A;  1VM9 A;  3L72 D;  1SS1 A;  2NVE A;  2ZYA A;  2WTY A;  1NTK J;  1LP1 A;  4HJG H;  1SQP G;  2Y9Z A;  2MJZ A;  4R4L A;  2NVG A;  2POH A;  3VYI A;  4D6T E;  1O7W A;  3CWB G;  2YKO A;  2O01 J;  4RKU J;  1AFO A;  1Y9B A;  4DJG A;  2FYU E;  5CCH C;  3B71 A;  2P10 A;  1KQF B;  1GU5 A;  5KAF H;  2YVJ B;  4W7Z A;  3GZX A;  3WMM 0;  2E75 B;  4PJ0 E;  2P67 A;  4TLF A;  1GL2 B;  3GF3 A;  3GTS A;  4IFD K;  3QWO C;  1URQ A;  3KYQ A;  1H89 A;  5KLI C;  1PPJ D;  2HR3 A;  1KB9 I;  3RK2 C;  3BCC D;  5AW2 B;  5CXM A;  2MKV A;  1YI2 P;  3A5T A;  4P1B H;  3OAK A;  2YIU B;  1FZG A;  1DD3 A;  3M9Q A;  2YFL A;  2QM7 A;  3O6Q A;  4C7R A;  2K1A A;  5DJU B;  3CC2 P;  1YJW P;  4N6J A;  3HE5 A;  1BSN A;  4KT0 J;  4OVN F;  2NRG A;  1U7M A;  1OFC X;  2CKF A;  2D2C B;  3BRV B;  1H8A A;  2QPZ A;  3V2N A;  1VQ6 P;  2Z5I A;  1KB9 E;  3RL0 C;  1M56 D;  1SQX K;  1RH5 B;  2HML A;  2W6A A;  2PP6 A;  1R8E A;  3VMG D;  3NTN A;  3H1J J;  2B87 B;  2YNY A;  1ZW0 A;  3RL0 B;  1S72 P;  3H32 B;  4NBE D;  4AUW A;  2M3E A;  5AW7 B;  1VQL P;  3BRT B;  5CJ0 A;  2FKW B;  3CX5 H;  1WT6 A;  3SWF A;  1FS0 E;  4NPF X;  4UB8 E;  5GTH H;  2M0B A;  1LT1 A;  2AXT E;  2CK3 H;  2JO6 A;  1JMM A;  2JKV A;  3CWB E;  2CPS A;  2OTJ P;  1OW8 A;  2XU6 A;  5CCG D;  1EXJ A;  1LTJ C;  1X8Y A;  3R4Y A;  1VQM P;  1L0N G;  2P1J A;  3S4R A;  1LWU A;  1SQQ K;  3MUD A;  3WUV A;  3II6 A;  2XDJ A;  1DD4 A;  1X0T A;  2W8Z A;  2OYH C;  4QDF A;  1JTH B;  1NDO A;  1ZV8 A;  2M5A B;  3Q1M A;  2WZ7 A;  4NPE A;  2K88 A;  4BRY A;  4HM1 A;  3L71 G;  5C39 A;  3PJS K;  1PGO A;  3AZC A;  3CD6 P;  1SFC D;  3AEE C;  2E42 A;  3L74 D;  5CJ4 A;  2Y0E A;  2H8P D;  2NPS C;  1NKZ B;  3M0D A;  1PP9 D;  4PV1 D;  1HTL C;  1OZH A;  1O7M A;  4PD4 D;  3AEF C;  2QE7 H;  3A7O A;  2QG4 A;  1KC8 Q;  3HE4 A;  3AE9 C;  1DEE G;  2K9Y A;  5GTI H;  2NPS B;  2HOD A;  1NTM D;  1HGZ A;  3L70 D;  3BCC J;  1JM0 A;  3CCR P;  3B5N B;  2OYI B;  1P84 I;  3PHL A;  4YXD C;  2WSS H;  1SP4 A;  2FYN B;  2IZ0 A;  3H1K G;  1Q86 Q;  4EOT A;  5AVX B;  2KNC A;  3LW5 J;  1EG9 A;  2IDB A;  3Q5P A;  3DQY A;  3AE7 C;  2R44 A;  3FXD A;  1KOR A;  1L0L D;  3CC7 P;  5AW1 B;  4YXW H;  1ZRT D;  4GIF A;  1QLE D;  2ZT9 B;  2J58 A;  1M57 D;  1IK9 A;  4B86 A;  3VCA A;  2A06 D;  3U1C A;  2G3A A;  3N7N A;  1JY2 P;  1Y47 A;  1FJK A;  1GMJ A;  1JY3 N;  2M3B A;  2DE6 D;  1P84 E;  1KIL A;  4H0L D;  1RE4 A;  3F5H A;  3L35 A;  1YIJ P;  1AJY A;  2JR8 A;  1KYO H;  1UII A;  1L4A A;  1RE3 C;  1NWQ A;  1XTC C;  3AE2 C;  2WSF J;  1NO4 A;  1PL5 A;  3A0B E;  2C9L Y;  3CCL P;  4JBZ A;  1IO4 A;  4ZMD A;  2C0X A;  2K9J A;  2E74 D;  2ZVO B;  5KJ7 C;  1IFI A;  5BU5 A;  3V2P A;  5AW4 B;  2R3S A;  4ZKU A;  4U3F D;  2Q5U A;  1Q7Y Q;  3KDP B;  3H1I G;  3GOB A;  2WPR A;  4NBC D;  2QJY C;  5E79 H;  4W7Y A;  2Q3I A;  1RF1 A;  2OTL P;  1NTK G;  1YHQ P;  2GM4 A;  1L2P A;  1SFC C;  1MFZ A;  1L0L E;  1SVF A;  3L75 D;  3SSU A;  1ZRT E;  3L74 J;  1FDI A;  1SQV D;  3VMA A;  3VP9 A;  1PP9 J;  2ZXX A;  4PV1 C;  1NYK A;  1LT9 B;  1S1C X;  1M7L A;  3P8C E;  3IAO A;  1VQN P;  2QSI A;  3F89 A;  3H1K E;  2BEZ F;  1FU1 A;  1UIX A;  1OW6 A;  3AEA C;  1EZV D;  1NTM J;  3CCM P;  3L70 J;  1LTA C;  1HUC A;  2XSO A;  2YKQ A;  2WPQ A;  1BGY E;  2E5T A;  3M9H A;  3NFQ A;  2PGD A;  4OGQ B;  1NU1 K;  1L0L J;  4Y99 B;  3CL3 D;  1GK6 A;  4K35 A;  3BAT A;  2ZYL A;  2WT7 B;  4NBB D;  1FZA A;  4WY4 A;  5B5E H;  1G1J A;  2FYU G;  1CW5 A;  1J1E B;  1S9K E;  4H0L C;  3CXH I;  2QJK B;  2WSE J;  3GW6 A;  2KXP B;  1USD A;  3I55 P;  1URQ C;  2W83 C;  2OAR A;  5DJT B;  2XZR A;  2RKL A;  1U57 A;  1DX7 A;  3SFE C;  1J1D C;  3H1J G;  3RK3 D;  4YPC A;  5CMZ A;  2E74 C;  4QUQ A;  1W5C E;  1URQ B;  1NKN A;  2W6B A;  3CXH E;  4C46 A;  2KUB A;  1RHZ B;  1J1D B;  3WUU A;  2JO1 A;  3C8V A;  4I7Z C;  1PGJ A;  4U3F J;  1O7H A;  1FQT A;  4I2L C;  1KN7 A;  3HTK A;  5CHX A;  1NTK E;  2DE7 D;  2YXQ B;  3D71 A;  2IX7 C;  1IJD B;  1W2B O;  1FZF A;  2QA4 P;  3CX5 D;  2HG5 D;  1BDD A;  1YTZ T;  1KIL D;  1N7S C;  4L74 A;  5M1B A;  3SWK A;  1PGP A;  2N1T A;  3L75 J;  5KKZ B;  1SQX D;  1L4A D;  3WU2 H;  1SQV J;  1KQG B;  2XKM A;  2FXP A;  1CI6 B;  1N7S B;  2R3C A;  2OGU A;  1SQB D;  1N2D C;  2LKM A;  3N0Q A;  4XE5 B;  4AQR D;  3K5B A;  4WWI A;  1N73 A;  2A45 H;  4A7P A;  1YTZ I;  3HUS C;  3FWL A;  3R2P A;  2E76 B;  2HMO A;  2PAJ A;  3CMA P;  1FOS E;  1A02 F;  2G8Y A;  1NTZ D;  4Y28 J;  3SFD C;  1WRG A;  1LWU C;  3RK3 E;  1M1J A;  5AVQ B;  2JZA A;  3JCU H;  4ZKP A;  1PPJ G;  3HUS B;  3BCC G;  2O1K A;  4L75 A;  3D89 A;  2I1J A;  4RJT A;  4GOF A;  3N4X A;  3P8M C;  1SQQ D;  1VQO P;  4WBA A;  1JCD A;  1MKM A;  1BCC D;  3NMD A;  2QRX A;  3M0D C;  4BRY B;  1OVV A;  1RIE A;  1MUU A;  2KIK A;  1FZC A;  1RFS A;  1AV1 A;  1PV3 A;  3H1J E;  1FZE A;  2XNX A;  1X79 B;  3GHG C;  3H6P A;  1SQP D;  1LTG C;  1HJB A;  5APX A;  2ZAE B;  3TGU D;  1SQX E;  4H13 D;  3RK3 C;  1M90 Q;  3G9R A;  2FYU K;  4HKZ H;  4IOI H;  1NYH A;  1HF9 A;  3GHG B;  5KLI B;  3Q5S A;  3RK2 B;  4GT1 A;  5KLV K;  1VPC A;  3KHU A;  2E5Y A;  2FY8 A;  1GW4 A;  2I7F A;  5AEW A;  2FFD C;  5EFW B;  2WSC H;  3L72 E;  4AAY B;  1KQL A;  5APV A;  1KYO D;  2IFN A;  3D6Y A;  3GKE A;  5APT A;  1Q81 Q;  3LIE A;  1EDK A;  4WVZ A;  4WY4 D;  1GW3 A;  2FFD B;  4OWF A;  3VN0 A;  1ZXG A;  5AW5 B;  1KIL C;  1RE4 C;  1KFM A;  3TNU A;  1Q90 D;  1AVY A;  1SQB K;  2CPB A;  2QIW A;  1L4A C;  1SQX J;  2JEE A;  3I56 P;  2I8D A;  4QDC A;  2HYN A;  1NVO A;  1NAY A;  3V4Q A;  1IFN A;  4PJ0 H;  3HD7 A;  3CCE P;  1FC2 C;  1M1K Q;  3BAS A;  3TSI A;  1YQ3 C;  5KAI E;  1NTZ K;  1JMB A;  3L72 J;  3L74 G;  4HM0 A;  2B1X A;  2H89 C;  4EMJ B;  2L5G B;  3AEG C;  1PPJ E;  3BCC E;  1NJI Q;  1G8J B;  2KK7 A;  3CC4 P;  4XFJ A;  1DIP A;  1S4X A;  2ZFC A;  4W80 A;  1QX8 A;  1NTM G;  1T3U A;  3L70 G;  2H7H A;  1LTJ B;  1AA0 A;  3FOU A;  1RF1 C;  1JUN A;  3A3Y B;  1SQQ J;  2OYH B;  1JB0 J;  2YMY A;  1H88 A;  5CCH A;  1KB9 H;  2N1T D;  1R5S A;  1SQP K;  3JC2 2;  1GDT A;  2QEX P;  4NB8 D;  1L0L G;  1GU4 A;  3VMZ A;  3FGA D;  2GA1 A;  1GL2 A;  5TIS E;  3A0H E;  5K5G B;  1ZOY C;  2YKP A;  4EDF A;  2O01 N;  3AED C;  3H1L D;  4H44 D;  3FX0 A;  2UWJ E;  3AE8 C;  3VMI D;  2A06 G;  2KS1 B;  2XR8 A;  1AQ5 A;  1EDL A;  5APQ A;  4GDO A;  2V7Q H;  3TGU J;  4H13 C;  1VQ4 P;  1L0N D;  3KZI E;  4UB8 H;  2JWA A;  1Y8A A;  1O7G A;  3EN1 A;  3U59 A;  3L73 D;  2AXT H;  1BGY G;  2OYO A;  3L71 D;  1VQ9 P;  1QL2 A;  4GKG A;  5TJH A;  1ZR4 A;  2H43 A;  2WPV B;  1G2C A;  3G6E P;  1T2K D;  3ITK A;  4WY4 C;  1IZN B;  1VF5 D;  1NU1 D;  3AE4 C;  1QVF O;  2B87 A;  4AYC A;  3VMX A;  4PD4 I;  5AW9 B;  1Z56 A;  2IBZ D;  3VMY A;  4EI2 A;  4L73 A;  2RH0 A;  1KTM A;  1VQ8 P;  3CME P;  3JSV C;  3L74 E;  3USS A;  4I1L A;  4DOJ A;  4NBD D;  5AVW B;  3A2A A;  2HPC B;  3GMA A;  1PP9 E;  3KPE A;  1N7L A;  1H0T B;  4N78 D;  2K37 A;  2KYV A;  1KD1 Q;  3P32 A;  4PD4 E;  1JY3 P;  4QUR A;  4KHX A;  5CCG C;  1U7J A;  1X22 A;  3TDK A;  3UIA A;  1JO5 A;  1NTM E;  1S3J A;  3L70 E;  3AE6 C;  5AVR B;  2YO2 A;  5B66 E;  5H2F E;  1JTH A;  2M5A A;  3PH0 A;  1EZV G;  3M9B A;  3PP5 A;  1N86 A;  3L37 A;  4IL6 E;  4JF7 A;  4JYC A;  5HL4 A;  2QJY B;  3EFG A;  2HMM A;  3P7K A;  1P84 H;  1IC2 A;  2A06 E;  4MN4 C;  1DEB A;  1SFC B;  3E1I A;  1L0N K;  1VQP P;  2HMJ A;  4HJL A;  1GK4 A;  4H44 C;  2IZ1 A;  2WPS A;  3KQG A;  3T97 B;  1RF0 A;  3H1L J;  1Q82 Q;  2NPS A;  3HD7 D;  4XA4 A;  1GZL A;  3OA7 A;  4PV1 B;  3A0B H;  2E4P A;  3B5N A;  2OYI A;  1K9M Q;  3H1I D;  3VTP C;  2Q3W A;  1L0N J;  4UB6 E;  2KOG A;  1E79 H;  2B9B A;  3L4F A;  1OVR A;  3L73 J;  1S5L E;  2W6J H;  1AQT A;  2KB7 P;  3L71 J;  4NBH D;  1USE A;  2IPP A;  2Q6Q A;  1M1J C;  1LP1 B;  2KSE A;  4NBG D;  5APY A;  1MV8 A;  1NGM B;  2FXM A;  2P58 A;  2KZI A;  4U3F E;  2Z4E A;  1JY2 O;  4I6M C;  4QMA A;  1VF5 C;  2BCC D;  2KLU A;  1NU1 J;  2XSH A;  2BMR A;  5CCH D;  1LTT C;  2E75 D;  3Q5R A;  4GOD A;  3G3Z A;  3MTU E;  1GL2 D;  4HB1 A;  1EZV I;  1SLQ A;  5AW3 B;  2IYO A;  2SPZ A;  3EFF K;  3MP7 B;  4H0L B;  2Q9I A;  3U1A A;  3C9I A;  4CPG A;  3GL2 A;  3L75 E;  4BXL A;  1SQV E;  2DE5 D;  1X9V A;  3O8Z A;  5APS A;  2WIT A;  4NB9 D;  1DH3 A;  1FJP A;  1YYC A;  1ZP0 C;  1VDF A;  2LXC B;  2YFI A;  3AEB C;  1PIX A;  4D6T D;  1SQX G;  2P7J A;  1RQV A;  1JY3 O;  1ZLL A;  2HLO A;  3H1H D;  2DW3 A;  2PRR A;  2E74 B;  1EZV E;  2FYU D;  2D2C D;  5KJ7 A;  3O6Q B;  2WQY C;  5KLV D;  1IFJ A;  3HE5 B;  4RO0 A;  1PZQ A;  3L72 G;  4IL6 X;  4I7Z B;  5KAF E;  4QCK A;  1HH0 A;  4LGD E;  3RL0 D;  3M91 A;  4U7J A;  2B88 A;  1A02 J;  3GL0 A;  3MIW A;  2YFJ A;  3PRJ A;  1E5W A;  4QUP A;  3EQ2 A;  1LT9 A;  2RMZ A;  1J2J B;  2ZYD A;  2E43 A;  3CCU P;  1OVU A;  1VQ5 P;  3TNU B;  3CCQ P;  1T8Z A;  3HD7 C;  1T3J A;  3B4S A;  3RBX A;  1SQQ G;  4ASV A;  1YJN P;  1NTK K;  3H25 A;  3RGU A;  2GBX A;  2QVA A;  2N9B A;  2JJL A;  1S5L X;  5AEU A;  2ZJS E;  2XV5 A;  1KV4 A;  2R32 A;  2WVR A;  1IK7 A;  3MUD C;  4EYY Q;  3CX5 I;  3CXH H;  1KB9 D;  1RY3 A;  5AVV B;  3TGU G;  2WT7 A;  4C7N A;  1BE3 D;  3TYY A;  1LWU B;  3H1H E;  1R5L A;  1YIT P;  3VCP A;  2AEJ A;  4QDF B;  1CZQ A;  2BCC J;  1HJ0 A;  1HGV A;  2E75 C;  1FE6 A;  3NXS A;  3S9O A;  5KLV E;  1GTW A;  1GL2 C;  2O01 H;  2Y9Y A;  3CCJ P;  1JNM A;  1VQK P;  2ZXE B;  4JQ0 D;  3CX5 E;  3CPW O;  1KIL E;  2NPS D;  1JOC A;  2ZYG A;  2HFE D;  3IR9 A;  1HBW A;  3B5N D;  1QEX A;  4AIV A;  3CWB D;  2YIU C;  5GTH E;  1MFT A;  3M06 A;  3GZY A;  2WSC J;  1UUW A;  3CLQ A;  3HE4 B;  2WWW A;  3SWY A;  1O7N A;  3G4S P;  2HOD B;  2GUS A;  4D6T J;  3W68 A;  1PGQ A;  1SQB E;  1G8K B;  3RK3 B;  3H1H J;  2ZT9 D;  2D2C C;  4LLH A;  2FYU J;  1W2E A;  3VP8 A;  2KNC B;  1QGK B;  1KQS O;  2NVF A;  4DT0 A;  5KLV J;  2XND H;  1LTI C;  2ZVN B;  3GF7 A;  1OXZ A;  1XTG B;  1NTZ E;  3IN6 A;  2QJP C;  1KMI Z;  1K73 Q;  1FOS F;  1OMI A;  1G2C B;  1CI6 A;  3OJA B;  1BE3 E;  1N7S A;  1KIL B;  1SQQ E;  2QJP B;  2K3R A;  1BCC E;  2O3J A;  1L4A B;  5GTI E;  1JM1 A;  4Z1M H;  1SQB J;  4JYB A;  4DCK A;  5KTB A;  3PTZ A;  3M0A A;  1PP9 G;  2I1K A;  1S2E A;  4TT3 H;  1KYO I;  1SQP E;  3TGU E;  2K9J B;  3OW2 O;  3H1L G;  1NTZ J;  5KJ7 D;  2E4Q A;  3V4W A;  4QDD A;  3HUS A;  1YQ4 C;  1OW7 A;  3ZDM A;  3IF4 A;  1P84 D;  2KP8 A;  1BE3 J;  1ZN5 A;  2FBW C;  2KSJ A;  3KXD A;  5BOK A;  3V2R A;  1BDC A;  1BCC J;  4NBA D;  3L73 G;  1QVG O;  2P2U A;  2AXC A;  5APU A;  1KYO E;  4EIJ A;  1RF1 B;  1HVV A;  4IFM A;  2V7Q J;  2AEF A;  2V4H A;  1RF0 C;  1N8R Q;  1NH4 A;  3CCS P;  1SQP J;  3FXE A;  2WMM A;  1NU1 G;  3CCV P;  2NUM A;  3B5N C;  2OYI C;  4HM3 A;  3E7K A;  2VRS A;  2HMK A; 
#chains in the Genus database with same CATH homology
 2B1X A;  2YFI A;  1RFS A;  2FYN C;  3AZC A;  4HJL A;  2HMJ A;  3H1J E;  1BE3 E;  1WQL A;  4EMJ B;  1SQQ E;  1VF5 D;  3H1H E;  1PPJ E;  3L73 E;  4HM6 A;  1O7P A;  4HM7 A;  3BCC E;  1BCC E;  3L71 E;  4HM8 A;  1G8J B;  3VCP A;  1VM9 A;  4QDF B;  2CKF A;  1JM1 A;  4OGQ D;  1EZV E;  1SQX E;  4H13 D;  2NVE A;  2QPZ A;  2D2C D;  2E74 D;  2E4P A;  4PV1 D;  4NBF D;  1SJG A;  1KB9 E;  2ZYL A;  2NWF A;  2Q3W A;  1O7M A;  5KLV E;  4NBB D;  2HML A;  2NVG A;  3FOU A;  2NUK A;  4D6T E;  3VMG D;  4QCK A;  2BMO A;  3CX5 E;  1O7W A;  1NU1 E;  3L74 E;  2I7F A;  5AEW A;  1SQP E;  4NBD D;  3N0Q A;  3TGU E;  3GB4 A;  3L72 E;  4HM2 A;  4NBH D;  1PP9 E;  1ULI A;  2FYU E;  2IBZ E;  4NBE D;  4AAY B;  3GOB A;  2E4Q A;  1Q90 C;  4AIV A;  4NB8 D;  4NBC D;  4NBG D;  2YIU C;  4QDD A;  3GL0 A;  3GZY A;  2YFJ A;  3H1I E;  3GKE A;  3C0D A;  2QJY C;  1UUW A;  4PD4 E;  1EG9 A;  2YVJ B;  3DQY A;  4QUP A;  4QUR A;  2HMO A;  1O7N A;  4H44 D;  1UUV A;  4U3F E;  2XRX A;  2E76 D;  3GZX A;  3VMI D;  1L0L E;  1VCK A;  1SQB E;  1ZRT E;  1NTM E;  1G8K B;  2XR8 A;  3L70 E;  2XSH A;  2BMR A;  5BOK A;  2E75 D;  4P1C H;  2JZA A;  4NBA D;  4HM4 A;  2JO6 A;  3GTE A;  2ZT9 D;  3VCA A;  4HKV A;  4QUQ A;  2GBX A;  5KKZ C;  3CWB E;  1KYO E;  3D89 A;  4QDC A;  2NVF A;  1NYK A;  3GCE A;  3GTS A;  3CXH E;  2B24 A;  1O7G A;  2DE6 D;  1P84 E;  3EN1 A;  3H1L E;  3VMH D;  4HM5 A;  5KLI C;  5AEU A;  4H0L D;  5CXM A;  3H1K E;  2BCC E;  1O7H A;  3GL2 A;  1FQT A;  1NTZ E;  3L75 E;  1ULJ A;  3EQQ A;  4P1B H;  2QJP C;  2GBW A;  1SQV E;  2DE5 D;  1NTK E;  2DE7 D;  4QDF A;  5HL4 A;  4NB9 D;  1NDO A;  2XSO A;  2HMM A;  1L0N E;  2NUM A;  1BGY E;  2QJK C;  2HMN A;  2YFL A;  1RIE A;  2A06 E;  2BMQ A;  4HM0 A;  4HM1 A;  4HM3 A;  2HMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...