1NTZE

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntzE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntzE02
4HM6A 3L71E 2XSHA 2YFLA 1ULJA 3VMGD 4NB9D 4NBFD 1O7GA 1G8KB 4P1BH 3CX5E 4U3FE 1O7MA 2NUKA 2BCCE 2HMNA 4D6TE 3EQQA 4PD4E 4NBDD 4PV1D 1SQBE 4QUPA 2HMKA 4NBED 1P84E 2NVGA 1G8JB 1NTZE 1SQQE 1L0LE 1BCCE 3GCEA 3GZXA 1NTME 3GB4A 4NBGD 4P1CH 3BCCE 1EZVE 1O7NA 4HM7A 3H1HE 3N0QA 4QDDA 4HM8A 4NBAD 1KB9E 1EG9A 3L74E 3GZYA 2YVJB 2GBWA 4HM5A 3H1LE 2BMOA 2JO6A 4EMJB 3H1KE 1O7WA 1NU1E 1O7PA 3GOBA 3GKEA 3H1JE 2E75D 3AZCA 2JZAA 3L72E 1SQPE 5BOKA 2Q3WA 4HKVA 4HM0A 3GL0A 1UUVA 1FQTA 2DE7D 4H44D 4H0LD 3L75E 1Q90C 3VMHD 2NWFA 2XRXA 2B1XA 4H13D 3VCAA 3EN1A 4QDFB 4QCKA 5KLVE 1O7HA 1UUWA 4NBBD 2IBZE 2ZYLA 4NB8D 1PPJE 1SQXE 3CWBE 1NYKA 2E74D 5HL4A 4HM1A 5KLIC 2HMOA 5CXMA 4AIVA 2HMMA 5AEUA 4HM3A 2HMJA 3GL2A 2FYUE 1VCKA 2BMQA 1BGYE 4OGQD 3DQYA 3VMID 3VCPA 2GBXA 2ZT9D 3C0DA 3GTEA 2FYNC 2B24A 2DE5D 2CKFA 1PP9E 4NBCD 2NUMA 2QJYC 4HM2A 4QURA 1KYOE 2YFIA 3GTSA 3CXHE 4QUQA 3FOUA 2QPZA 4NBHD 5AEWA 1WQLA 2E76D 2E4PA 3D89A 1VF5D 4QDCA 2YFJA 2QJKC 3L70E 2DE6D 1NTKE 3L73E 1L0NE 2E4QA 2YIUC 4AAYB 2NVEA 2QJPC 1BE3E 1ZRTE 2XR8A 1VM9A 2XSOA 2NVFA 4HJLA 2HMLA 1SJGA 1RIEA 2A06E 1RFSA 3H1IE 4HM4A 5KKZC 1ULIA 2D2CD 1NDOA 4QDFA 1SQVE 1JM1A 3TGUE 2BMRA 2I7FA
chains in the Genus database with same CATH superfamily
1FZGA 3WUUA 1SQXD 3WUVA 1EZVI 4EIJA 3L71G 5KJ7D 2QE7H 3NXSA 1H0TB 3V2NA 2JR8A 2NPSB 2Y0CA 1RE3A 2MJZA 4R4LA 1SS1A 1LTIC 3H32B 2QJKB 5AVXB 2NZ2A 3L37A 1KB9E 1FZCB 1MFTA 3GZYA 2WSFH 1X0TA 1L0ND 1EQ7A 1QGKB 2QSIA 1GU5A 3MUDA 2OYIA 3VMXA 1EC5A 3PJSK 3D6ZA 3GHGC 4H13C 3TGUD 1JEKA 3HRNA 4OVNF 1L0LG 3CLQA 1NVOA 4NPEA 2WSCH 1OW6A 4D6TD 1PPJG 4OGQC 1FU1A 3DQYA 3EQ2A 2KXPB 2FYNC 1SQQK 3AECC 1YITP 2CKFA 4NBCD 3L72G 2YFIA 4AYCA 1QL2A 1JY2O 4PD4H 5C39A 2V4HA 2XNDH 1NTZJ 1EDIA 3O8ZA 3LIEA 3Q5PA 2NVEA 1SQPD 2NRGA 4KT0J 4C7RA 3GHGB 3L73G 1IFIA 4PJ0E 1EDLA 3AEEC 2KZJA 2ZXXA 3HE4B 1Q2NA 1X22A 3KPEA 2FYUJ 2N1TD 3D6YA 3O6QA 2B87B 1YJWP 2FYNB 2CPBA 3Q3DA 1P84E 2Q7CA 1FJKA 1W2BO 5AVSB 2E5YA 2B89A 1M57D 2JWAA 1EZVE 4QDDA 1RE3C 2WT7B 3H1LE 1CW5A 3F5HA 3P32A 3V5BA 1GZLA 4WB4A 1N8RQ 1T8ZA 1S5LX 3H25A 2XRXA 4QDFB 2E5TA 1OW7A 2G3AA 2AEFA 2HFED 2I8DA 3JSVC 1O7HA 2OYIC 2ZVOB 3H1HG 5K5GB 2KIKA 2JP3A 1SQXG 3L35A 2N9YB 3TNUA 1IFNA 2NUMA 4HM2A 1PIXA 1JMMA 3CXHE 2FXOA 3B71A 2YFJA 2V7QJ 1NTKE 4GT1A 1W5CE 1L0NG 2NVFA 5APVA 1YHQP 2HODB 1K8AQ 3G3ZA 4LC1A 1RE4A 2H8PD 1Q86Q 3OJAB 5E79E 3TGUG 2JJLA 4IFMA 3C1LA 3V2RA 5BU8B 2YKQA 3EQQA 3NTNA 1SQBE 2K37A 2OYHA 5AVRB 1G8JB 3TYYA 4D6TG 1L0LE 1BCCE 2K9YA 3GCEA 4PD4I 3CC4P 3L74E 3Q1MA 1USDA 1NOHA 2GBWA 4EMJB 3GOBA 2E75D 2KB7P 4AQRD 1CZQA 3L72E 5B5EE 1J1EB 3KYQA 1OMIA 2YO3A 3E1RA 3FXDA 4UB8H 1Q82Q 5KLVE 4WWIA 3BATA 2KS1B 2OYOA 5L8RJ 4W7ZA 2KP8A 3AE1C 1VCKA 4RJTA 1R5LA 1URQD 3W67A 1NU1G 1KQFB 1QVGO 1NTZK 2C0WA 3HUSB 4N78D 5GTIE 1PP9E 1LT1A 1FBMA 1KN7A 2JWDA 1FAVA 4NBHD 2M5AA 4JYBA 1URQB 4W80A 2AEMA 3CX5D 2V7QH 1KILA 3PLNA 2FY8A 2AXCA 4IL6X 1RHZB 3ABVC 2Y9ZA 2G8YA 1ZRTE 2JKVA 1A02J 1RIEA 1BGYG 2ZYGA 1KB9H 2A45H 4BRYA 1LNQA 1RQVA 2XSHA 3GF3A 4GKGA 2W83C 1RQUA 1RE4C 1VPCA 3B4SA 4NBDD 2RH0A 3IN6A 3WU2E 3TNUB 2KNCA 1K9MQ 2E43A 3RL0D 2OYHC 3H1HE 3HD7A 2IDBA 3CC2P 4WVZA 1PFIA 1GW4A 3H1KE 2FXMA 2RN0A 2Y9YA 2WWWA 3NMDA 1G2CA 3AEFC 5DJUB 3GL0A 3V4QA 3VP9A 3EN1A 5M1BA 4NB8D 1NTKJ 3MGNA 3PTZA 4HJGH 1GTWA 2HMMA 1JTHB 2YNYA 2B9BA 5AVVB 1LT9A 4PJ0H 4YXDC 1ZOYC 2OYHB 1ZP0C 3EWKA 3V2PA 3ZDMA 1GDTA 2M3BA 3OAKA 1T3UA 2XNXA 2B88A 1SQBJ 1P84H 2NPSA 1L0LJ 1BCCJ 2YIUC 3M9BA 5KAIE 1GMJA 1OXZA 4KHXA 1EDKA 1KILC 2D2CC 2N9BA 5KJ7A 3BCCD 3H32A 3L4FA 1LTTC 1FZCA 3V4WA 3D70A 3A3YB 3L72J 1JCCA 5KKZB 1IFJA 1AA0A 2W90A 5KLVJ 3CMAP 2IYPA 3CCSP 3RK3C 1VQ9P 5AVQB 3RBZA 1M1KQ 5CCHC 2YIUB 3CCMP 1NU1E 3HD7C 3D71A 1KILB 1FS0E 1PP9J 2ZYAA 3RGUA 5BOKA 2A06D 4H44C 3CXHH 2RKLA 3N4XA 1VQ4P 2E74C 3A0HE 4AUWA 4AIVA 1GW3A 2O1JA 3CCEP 3GL2A 2FYUE 1BGYE 4ZMDA 2ZT9C 1PZQA 1K73Q 2GBXA 3B5ND 1H89A 3P7KA 5AW9B 1LT9C 1XTGB 5E79H 2W6BA 3FWLA 1HH0A 4QUQA 3FOUA 2QPZA 3HD7B 5AEWA 1FC2C 4L76A 2PP6A 3B5NB 1A02F 2IBZG 1OX3A 3U1CA 3H1HJ 2N1TA 1FZAA 3V6IA 1SJGA 2NPSC 2C0XA 3VMAA 2BMRA 1YQ4C 5CJ0A 1LTGC 3VMGD 3CWBD 2WT7A 4UB8E 5KJ7C 1ZN5A 3Q5SA 3H1JD 2HMNA 1RF1A 1FZCC 3C8VA 5B5EH 4PV1D 4QUPA 2YXQB 4C7NA 1LT9B 4NBGD 2H7HA 2GM4A 2Y0EA 3V2QA 3VN0A 1LTAC 1BDCA 3M0AA 1L0NJ 3P8MC 1O7WA 1L4AD 2KSJA 1S3JA 2GUSA 1NTKK 5TISH 3U59A 3LIDA 5GTIH 1JOCA 1PGPA 1SVFA 1N7LA 4H0LD 4IOIH 2LXCB 4QCKA 2K3RA 1NTMG 4D6TJ 2Z5IA 1LTJA 3BCCG 4CPGA 2BCCD 2ZAEB 1ZW0A 1IC2A 4NPDA 2HMJA 4XA4A 2WITA 1SQBK 4QMAA 2HODA 1L0LK 3TDKA 5APSA 5CCGD 2SPZA 2WPQA 3VOPA 4GODA 2W8ZA 4QDCA 3M0DA 2BASA 3CXHI 3WU2H 3BRTB 1NJIQ 2QJPC 1T3JA 1RY3A 4N78E 1FJPA 1ULIA 1SQVE 1NU1J 2N1TC 1KD1Q 4I7ZC 5KLVK 1Y9BA 3CX5E 1YIJP 2NUKA 2HMKA 2KZIA 2C9LY 1RF1C 3M9HA 1HJ0A 3FX0A 4R4MA 1O7NA 2LXBA 2KS1A 1W2EA 2R3CA 1DH3A 1IFDA 2YVJB 1DIPA 1BGYJ 2QJPB 1O7PA 3GKEA 1ZXGA 2Q1KA 3AZCA 4B86A 3HUSA 3FGAD 1LTBC 2W6AA 2N1TB 4I7ZB 2NWFA 4OH8B 3CCJP 1KYOD 1Q90D 4N3YB 2IBZE 1URQA 1NYKA 2QM8A 1KQLA 4HM1A 2HMOA 5KAIH 3CWBG 2KLUA 1NAFA 1RF1B 1NTZD 1LTJC 3VMID 1H8AA 1S5LE 4C7NB 3GTEA 3H1JG 3RBXA 3S1KA 1Y47A 1D7MA 1FZEA 5KLIB 2P1JA 3AE8C 3L75G 1MUUA 1VF5D 4U3FD 1R8EA 1OWAA 2WSSH 3PH0A 1DD3A 1K05A 2Q5UA 2HLOA 2IFMA 3M0DC 4HM4A 5APQA 4LLHA 3L71E 3BVHA 4NBFD 1FE6A 1O7GA 1LTJB 1KV4A 1NHLA 1L0NK 2H89C 4NBED 2H88C 1YTZT 1M1JB 4XE5B 1HBWA 2BCCG 5AVZB 1YYCA 1YQ3C 1NTME 4N6JA 3VYIA 3C9IA 2OTJP 3BCCE 3EFFK 5CBOA 1J1EC 3A0HH 4HM8A 1IFPA 3KHUA 1JTHA 2E75C 1U57A 1BE3D 2QRXA 2JZAA 1KILE 2YKPA 2L5GB 3HUSC 2HPCA 1PPJE 1N73B 3I5CA 5HL4A 2P2UA 3SFDC 1JB0J 4L73A 5H2FE 1ZV8A 4HM3A 1URQC 3A0BE 1S4XA 2M3EA 1SQVJ 1VQ6P 3CPWO 3AE5C 2ITAA 2WTYA 1WRGA 1HUCA 1SQPG 2AXTE 3GTSA 1KB9D 3IR9A 3RK3E 3VMYA 2E75B 2QIWA 3HTKB 3L73E 5B66E 1NU1K 2R3SA 3R4YA 2Q3EA 1KFNA 3AE2C 2W6JH 2CK3H 5TISE 1N7SD 2K9JA 1USEA 4YTPC 2FYZA 4NPFX 1ULJA 4NB9D 4IL6E 2KSEA 2OTKE 3RK2D 1KFMA 1RH5B 2FYUK 2P10A 3EFGA 3E1IA 3RL0C 1IFMA 5AVTB 4P1CH 1NTZG 3RK2B 2O1KA 1IK7A 1AVYA 1OW8A 2BMOA 1E79H 2IZ0A 4JYCA 3H1JE 1DX7A 3W68A 4U3FG 1CI6B 4HB1A 1E5WA 5CCHA 3VMHD 3L75E 3B8EB 2JO1A 5AW8B 4NBBD 2ZYLA 1SQXE 4HKZH 3B5NA 1ZR2A 5EFWB 1LWUA 5AW5B 1HWTC 3MD0A 1P84D 3RL0B 3PRJA 2FKWB 2E42A 1U7MA 3G71P 1MKMA 3L71J 1EZVD 2ZXEB 1VQMP 3K5BA 1VQKP 3CX5H 2E4PA 3H1LD 3D89A 2RMZA 3NFQA 1PGQA 1L0NE 2E4QA 1NTMJ 4MN4C 2Q9IA 3BCCJ 3TSIA 4Z1MH 1BE3G 5KKZC 3PHLA 5AW4B 4DOJA 3TGUE 4EI2A 1SFCC 3FWNA 3CD6P 3AEGC 1K04A 1YTZI 4GIFA 5KAFH 2HPCB 1BSHA 1FDIA 4D6TE 3GF7A 4WBAA 1OIPA 2LR2A 1EXJA 1L4AA 1HF9A 3CXHD 2FFDB 4ZKPA 1SFCD 3BASA 2LKMA 1UIIA 1NTKD 2A45G 1IJDB 1S5LH 1JM0A 2IX7C 2XV5A 1SQPE 1SFCB 1ZMEC 2K9JB 1VDFA 1SQVK 1UUWA 3CC7P 1YBKA 3L73J 1HGZA 2XDJA 1VQNP 3L70D 1YI2P 3T97B 1JUNA 1SQBD 5CCGA 4EDFA 3B5NC 4DT0A 1BCCD 3C0DA 4IFDK 1LWUC 2M8RA 2DW3A 2KUBA 1QVFO 2PRRA 1KYOE 1GK6A 3L74D 2JDIH 4RKUJ 2WMMA 1NWQA 3CCRP 1Q81Q 1PL5A 3L72D 1SQQD 2ZJSE 3AE9C 2HMLA 3OW2O 3CWBJ 2QG4A 5KLVD 2YFLA 3H1JJ 4K3AA 1BSNA 3CCVP 4U3FE 4WY4D 3KDPB 1MFZA 1O7MA 4PV1C 4Y99C 5BVZA 1ZLLA 1LWUB 5AW0B 3L75J 3CX5I 1AFOA 4GOFA 1JMBA 1PP9D 5AW6B 4WY4B 1SQXJ 3BRVB 1BDDA 3AEAC 1M90Q 1KC8Q 4L74A 1FDMA 5H2FH 1L4AC 3WMM0 1CSBA 3A0BH 5AW3B 1KQGB 2WPVB 1ZRTD 3Q5RA 1N86A 3H1LG 3KZIE 1MZ9A 2K88A 1OFCX 2OARA 2Q3WA 4HKVA 4H0LC 2AXTH 3A5TA 2CPSA 1XTCC 2BCCJ 4PV1B 1X79B 1Y8AA 4Y99B 3P8CD 1KMIZ 5B66H 1GL2D 1JY3N 3TF5A 2Y0DA 5CJ4A 2IBZI 4I6MC 3IAOA 3MZWB 3TGUJ 3HE5B 2B24A 1NAYA 3H1ID 3H1HD 5AVUB 1NTMK 2IYOA 4UB6E 5CCGC 1L4AB 2ZVNB 4QURA 4IL6H 1DD4A 2E76D 1AQTA 3MP7B 3H1KD 3I56P 1T2KD 1X9VA 1AVOA 2XZRA 4PD4D 2GUVA 1M1JA 4H0LB 1OVUA 2XR8A 1NTKG 1PGJA 3QWOC 3GLMA 2E76B 4RO0A 1RFSA 1NDOA 1MV8A 4YPCA 1H88A 3AE3C 1T6AA 3A7OA 2AEJA 5KTBA 2O3JA 1FOSF 1SQPJ 3KQGA 3MTUE 4YXWH 3L70G 2K1AA 1WT6A 2WVRA 1SQBG 3GB4A 3CI9A 3A2AA 1VQPP 1BCCG 4NBAD 1N73A 4C46A 2A06G 3SWFA 1VQLP 1VQ5P 1S2EA 1IO4A 3L74G 2Q6QA 2FBWC 1AQ5A 4I1LA 1Q90C 2BEZF 1SQQG 2PAJA 4H13D 3M91A 3VCAA 1NKNA 2ZYDA 5CHXA 3WUTA 4ASVA 3HTKA 5KLIC 2WQYC 5CXMA 5KLVG 5AEUA 1OVRA 1WMKA 5KAFE 2YXRB 4OGQD 4H13B 4IFFA 3SFEC 3VCPA 1QLED 1JY2N 4U3FJ 3JCUH 4OGQB 1VF5C 1PP9G 1VQ8P 1YJ9P 1NU1D 1N7SA 4EYYQ 2DE6D 1NO4A 2YKOA 2HG5D 3IFMA 2W27A 2WSEJ 2PFXA 3Q2YA 1KZUB 1M1JC 2HR3A 4HM6A 2J58A 4P1BH 5DJTB 5APXA 1SQXK 2WZ7A 3II6A 2FYUD 1DEBA 1BGYD 1LP1A 5APTA 1R5SA 1Z56A 2NVGA 1CI6A 1YJNP 3MIWA 4LGDE 1KORA 2R44A 3S9OA 5AW2B 1VF5B 1DEEG 1OVVA 3G4SP 3MUDC 3IF4A 2KLVA 1S9KD 3H1IG 1BE3J 2QEXP 2JO6A 2P58A 1NGMB 3USSA 1N73C 1TU3F 3H1KG 1GD2E 1KYOH 2PGDA 3N7NA 2B1XA 4DZOA 1PGOA 1QEXA 3S4RA 1OZHA 2O01J 4A7PA 5GTHE 2OYIB 1AJYA 3CCUP 1FOSE 2OGUA 3SSUA 2JEEA 1LGHB 2WPSA 3VMZA 3L70E 1S1CX 1UIXA 3UIAA 3E7KA 3SWYA 1NYHA 2WSEH 2XSOA 1QL1A 1N7SC 3GG2A 1SQPK 3MHVA 4ASWA 2A06E 3CMEP 4RESB 1JM1A 2FFDA 1SLQA 1NKZB 3AE4C 5APYA 3RK2C 1G1IA 1IK9A 2UWJE 3KZIH 4M3LA 2IFNA 4BXLA 5APWA 1IZNB 2I1KA 1SQQE 1SFCA 1SP4A 3M06A 3QH9A 3R2PA 1M56D 2H43A 4GDOA 3T97A 3O6QB 1N7SB 4UB6H 4O9BA 4HM0A 2DE7D 1J1DC 1SQVD 2P67A 3CWBE 5CMZA 2O01H 3OA7A 2J59M 2QM7A 1PV3A 1LP1B 3H6PA 3CCLP 3AEDC 2FYUG 2QA4P 2R32A 1AV1A 4ZNCA 3H1LJ 2Q3IA 1QX8A 3AE7C 3P8CE 3VTPC 1KYOI 4L75A 2I1JA 3GMAA 1J1DB 1VM9A 2HYNA 4HJLA 4Y28J 4WY4A 1NH4A 3H1IE 1M7LA 2IBZD 4JPZB 2L91A 2OQQA 1JY3P 1G8KB 1FZFA 2FFDC 2BCCE 3AEBC 4PD4E 1LJ2A 1VQ7P 3GZXA 4TLFA 4HM7A 4JF7A 5TJHA 3N0QA 1RF0A 2POHA 1EG9A 3VP8A 1VL2A 1JNMA 4OWFA 1EXIA 2OTLP 3JCUE 3KXDA 1KQSO 4GOEA 3HE5A 1GL2A 3FXEA 1UUVA 2P7JA 1FDOA 3L71D 3L70J 2Z4EA 3SWKA 2XU6A 2BEQD 1ZR4A 1H0TA 1HVVA 2BMQA 5AVWB 3LW5J 1NTMD 4HYTB 3L74J 2DE5D 4EOTA 1Q7YQ 1LTSC 4XFJA 2YMYA 2QJYC 2R5BA 1JCDA 2O01N 2MKVA 5AW1B 5AW7B 2J5UA 4DJGA 1HJBA 2VRSA 2GA1A 1SQQJ 5AVYB 3F89A 4AAYB 1HTLC 1L0LD 1EDJA 1U7JA 3JC22 4JBZA 1KILD 2D2CD 3G6EP 2YMKA 2KYVA 3L36A 2I7FA 4ZKUA 1PPJD 4W7YA 1M8OB 4K35A 1JO5A 1SQVG 2M5AB 1GK4A 4JQ0D 4WY4C 2KOGA 1KB9I 2A45I 2D2CB 1L2PA 4HH2A 4I2LC 3G9RA 5BU5A 1NTZE 2QJYB 1N2DC 2ZFCA 3CL3D 4KJMA 1JY2P 2R5DA 3U1AA 2IPPA 3RK3D 4BRYB 3TK1A 2WSFJ 5CCHD 4HM5A 3L73D 1RF0C 4BWNA 3HD7D 5GTHH 3GHGA 3RK3B 1X8YA 3CCQP 1G1JA 1FQTA 3HE4A 2KNCB 4H44D 3AE6C 2WSCJ 3PP5A 2Z5HA 1FZBA 1S9KE 1GL2C 2B87A 1EZVG 2FXPA 2E74D 4TT3H 1J2JB 2WPRA 2YO2A 4U7JA 2QVAA 1VQOP 4H44B 2XKMA 1JY3O 3H1IJ 2KK7A 2ZT9D 3LW5H 1G2CB 2E74B 3GW6A 3RL0g 3H1KJ 2E76C 1WQLA 1GU4A 1T2KC 2ZT9B 4DCKA 2C9NY 2QJKC 2KI7B 5APUA 2IZ1A 5CBNA 3ITKA 1BE3E 2M0BA 1KTMA 3M9QA 1HGVA 1S72P 3L75D 1P84I 4QDFA 2NPSD 1GL2B 3I55P
chains in the Genus database with same CATH topology
4HM6A 3L71E 2XSHA 2YFLA 1ULJA 3VMGD 4NB9D 4NBFD 1O7GA 1G8KB 4P1BH 3CX5E 4U3FE 1O7MA 2NUKA 2BCCE 2HMNA 4D6TE 3EQQA 4PD4E 4NBDD 4PV1D 1SQBE 4QUPA 2HMKA 4NBED 1P84E 2NVGA 1G8JB 1NTZE 1SQQE 1L0LE 1BCCE 3GCEA 3GZXA 1NTME 3GB4A 4NBGD 4P1CH 3BCCE 1EZVE 1O7NA 4HM7A 3H1HE 3N0QA 4QDDA 4HM8A 4NBAD 1KB9E 1EG9A 3L74E 3GZYA 2YVJB 2GBWA 4HM5A 3H1LE 2BMOA 2JO6A 4EMJB 3H1KE 1O7WA 1NU1E 1O7PA 3GOBA 3GKEA 3H1JE 2E75D 3AZCA 2JZAA 3L72E 1SQPE 5BOKA 2Q3WA 4HKVA 4HM0A 3GL0A 1UUVA 1FQTA 2DE7D 4H44D 4H0LD 3L75E 1Q90C 3VMHD 2NWFA 2XRXA 2B1XA 4H13D 3VCAA 3EN1A 4QDFB 4QCKA 5KLVE 1O7HA 1UUWA 4NBBD 2IBZE 2ZYLA 4NB8D 1PPJE 1SQXE 3CWBE 1NYKA 2E74D 5HL4A 4HM1A 5KLIC 2HMOA 5CXMA 4AIVA 2HMMA 5AEUA 4HM3A 2HMJA 3GL2A 2FYUE 1VCKA 2BMQA 1BGYE 4OGQD 3DQYA 3VMID 3VCPA 2GBXA 2ZT9D 3C0DA 3GTEA 2FYNC 2B24A 2DE5D 2CKFA 1PP9E 4NBCD 2NUMA 2QJYC 4HM2A 4QURA 1KYOE 2YFIA 3GTSA 3CXHE 4QUQA 3FOUA 2QPZA 4NBHD 5AEWA 1WQLA 2E76D 2E4PA 3D89A 1VF5D 4QDCA 2YFJA 2QJKC 3L70E 2DE6D 1NTKE 3L73E 1L0NE 2E4QA 2YIUC 4AAYB 2NVEA 2QJPC 1BE3E 1ZRTE 2XR8A 1VM9A 2XSOA 2NVFA 4HJLA 2HMLA 1SJGA 1RIEA 2A06E 1RFSA 3H1IE 4HM4A 5KKZC 1ULIA 2D2CD 1NDOA 4QDFA 1SQVE 1JM1A 3TGUE 2BMRA 2I7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM6 A;  3L71 E;  2XSH A;  2YFL A;  1ULJ A;  3VMG D;  4NB9 D;  4NBF D;  1O7G A;  1G8K B;  4P1B H;  3CX5 E;  4U3F E;  1O7M A;  2NUK A;  2BCC E;  2HMN A;  4D6T E;  3EQQ A;  4PD4 E;  4NBD D;  4PV1 D;  1SQB E;  4QUP A;  2HMK A;  4NBE D;  1P84 E;  2NVG A;  1G8J B;  1NTZ E;  1SQQ E;  1L0L E;  1BCC E;  3GCE A;  3GZX A;  1NTM E;  3GB4 A;  4NBG D;  4P1C H;  3BCC E;  1EZV E;  1O7N A;  4HM7 A;  3H1H E;  3N0Q A;  4QDD A;  4HM8 A;  4NBA D;  1KB9 E;  1EG9 A;  3L74 E;  3GZY A;  2YVJ B;  2GBW A;  4HM5 A;  3H1L E;  2BMO A;  2JO6 A;  4EMJ B;  3H1K E;  1O7W A;  1NU1 E;  1O7P A;  3GOB A;  3GKE A;  3H1J E;  2E75 D;  3AZC A;  2JZA A;  3L72 E;  1SQP E;  5BOK A;  2Q3W A;  4HKV A;  4HM0 A;  3GL0 A;  1UUV A;  1FQT A;  2DE7 D;  4H44 D;  4H0L D;  3L75 E;  1Q90 C;  3VMH D;  2NWF A;  2XRX A;  2B1X A;  4H13 D;  3VCA A;  3EN1 A;  4QDF B;  4QCK A;  5KLV E;  1O7H A;  1UUW A;  4NBB D;  2IBZ E;  2ZYL A;  4NB8 D;  1PPJ E;  1SQX E;  3CWB E;  1NYK A;  2E74 D;  5HL4 A;  4HM1 A;  5KLI C;  2HMO A;  5CXM A;  4AIV A;  2HMM A;  5AEU A;  4HM3 A;  2HMJ A;  3GL2 A;  2FYU E;  1VCK A;  2BMQ A;  1BGY E;  4OGQ D;  3DQY A;  3VMI D;  3VCP A;  2GBX A;  2ZT9 D;  3C0D A;  3GTE A;  2FYN C;  2B24 A;  2DE5 D;  2CKF A;  1PP9 E;  4NBC D;  2NUM A;  2QJY C;  4HM2 A;  4QUR A;  1KYO E;  2YFI A;  3GTS A;  3CXH E;  4QUQ A;  3FOU A;  2QPZ A;  4NBH D;  5AEW A;  1WQL A;  2E76 D;  2E4P A;  3D89 A;  1VF5 D;  4QDC A;  2YFJ A;  2QJK C;  3L70 E;  2DE6 D;  1NTK E;  3L73 E;  1L0N E;  2E4Q A;  2YIU C;  4AAY B;  2NVE A;  2QJP C;  1BE3 E;  1ZRT E;  2XR8 A;  1VM9 A;  2XSO A;  2NVF A;  4HJL A;  2HML A;  1SJG A;  1RIE A;  2A06 E;  1RFS A;  3H1I E;  4HM4 A;  5KKZ C;  1ULI A;  2D2C D;  1NDO A;  4QDF A;  1SQV E;  1JM1 A;  3TGU E;  2BMR A;  2I7F A; 
#chains in the Genus database with same CATH topology
 1FZG A;  3WUU A;  1SQX D;  3WUV A;  1EZV I;  4EIJ A;  3L71 G;  5KJ7 D;  2QE7 H;  3NXS A;  1H0T B;  3V2N A;  2JR8 A;  2NPS B;  2Y0C A;  1RE3 A;  2MJZ A;  4R4L A;  1SS1 A;  1LTI C;  3H32 B;  2QJK B;  5AVX B;  2NZ2 A;  3L37 A;  1KB9 E;  1FZC B;  1MFT A;  3GZY A;  2WSF H;  1X0T A;  1L0N D;  1EQ7 A;  1QGK B;  2QSI A;  1GU5 A;  3MUD A;  2OYI A;  3VMX A;  1EC5 A;  3PJS K;  3D6Z A;  3GHG C;  4H13 C;  3TGU D;  1JEK A;  3HRN A;  4OVN F;  1L0L G;  3CLQ A;  1NVO A;  4NPE A;  2WSC H;  1OW6 A;  4D6T D;  1PPJ G;  4OGQ C;  1FU1 A;  3DQY A;  3EQ2 A;  2KXP B;  2FYN C;  1SQQ K;  3AEC C;  1YIT P;  2CKF A;  4NBC D;  3L72 G;  2YFI A;  4AYC A;  1QL2 A;  1JY2 O;  4PD4 H;  5C39 A;  2V4H A;  2XND H;  1NTZ J;  1EDI A;  3O8Z A;  3LIE A;  3Q5P A;  2NVE A;  1SQP D;  2NRG A;  4KT0 J;  4C7R A;  3GHG B;  3L73 G;  1IFI A;  4PJ0 E;  1EDL A;  3AEE C;  2KZJ A;  2ZXX A;  3HE4 B;  1Q2N A;  1X22 A;  3KPE A;  2FYU J;  2N1T D;  3D6Y A;  3O6Q A;  2B87 B;  1YJW P;  2FYN B;  2CPB A;  3Q3D A;  1P84 E;  2Q7C A;  1FJK A;  1W2B O;  5AVS B;  2E5Y A;  2B89 A;  1M57 D;  2JWA A;  1EZV E;  4QDD A;  1RE3 C;  2WT7 B;  3H1L E;  1CW5 A;  3F5H A;  3P32 A;  3V5B A;  1GZL A;  4WB4 A;  1N8R Q;  1T8Z A;  1S5L X;  3H25 A;  2XRX A;  4QDF B;  2E5T A;  1OW7 A;  2G3A A;  2AEF A;  2HFE D;  2I8D A;  3JSV C;  1O7H A;  2OYI C;  2ZVO B;  3H1H G;  5K5G B;  2KIK A;  2JP3 A;  1SQX G;  3L35 A;  2N9Y B;  3TNU A;  1IFN A;  2NUM A;  4HM2 A;  1PIX A;  1JMM A;  3CXH E;  2FXO A;  3B71 A;  2YFJ A;  2V7Q J;  1NTK E;  4GT1 A;  1W5C E;  1L0N G;  2NVF A;  5APV A;  1YHQ P;  2HOD B;  1K8A Q;  3G3Z A;  4LC1 A;  1RE4 A;  2H8P D;  1Q86 Q;  3OJA B;  5E79 E;  3TGU G;  2JJL A;  4IFM A;  3C1L A;  3V2R A;  5BU8 B;  2YKQ A;  3EQQ A;  3NTN A;  1SQB E;  2K37 A;  2OYH A;  5AVR B;  1G8J B;  3TYY A;  4D6T G;  1L0L E;  1BCC E;  2K9Y A;  3GCE A;  4PD4 I;  3CC4 P;  3L74 E;  3Q1M A;  1USD A;  1NOH A;  2GBW A;  4EMJ B;  3GOB A;  2E75 D;  2KB7 P;  4AQR D;  1CZQ A;  3L72 E;  5B5E E;  1J1E B;  3KYQ A;  1OMI A;  2YO3 A;  3E1R A;  3FXD A;  4UB8 H;  1Q82 Q;  5KLV E;  4WWI A;  3BAT A;  2KS1 B;  2OYO A;  5L8R J;  4W7Z A;  2KP8 A;  3AE1 C;  1VCK A;  4RJT A;  1R5L A;  1URQ D;  3W67 A;  1NU1 G;  1KQF B;  1QVG O;  1NTZ K;  2C0W A;  3HUS B;  4N78 D;  5GTI E;  1PP9 E;  1LT1 A;  1FBM A;  1KN7 A;  2JWD A;  1FAV A;  4NBH D;  2M5A A;  4JYB A;  1URQ B;  4W80 A;  2AEM A;  3CX5 D;  2V7Q H;  1KIL A;  3PLN A;  2FY8 A;  2AXC A;  4IL6 X;  1RHZ B;  3ABV C;  2Y9Z A;  2G8Y A;  1ZRT E;  2JKV A;  1A02 J;  1RIE A;  1BGY G;  2ZYG A;  1KB9 H;  2A45 H;  4BRY A;  1LNQ A;  1RQV A;  2XSH A;  3GF3 A;  4GKG A;  2W83 C;  1RQU A;  1RE4 C;  1VPC A;  3B4S A;  4NBD D;  2RH0 A;  3IN6 A;  3WU2 E;  3TNU B;  2KNC A;  1K9M Q;  2E43 A;  3RL0 D;  2OYH C;  3H1H E;  3HD7 A;  2IDB A;  3CC2 P;  4WVZ A;  1PFI A;  1GW4 A;  3H1K E;  2FXM A;  2RN0 A;  2Y9Y A;  2WWW A;  3NMD A;  1G2C A;  3AEF C;  5DJU B;  3GL0 A;  3V4Q A;  3VP9 A;  3EN1 A;  5M1B A;  4NB8 D;  1NTK J;  3MGN A;  3PTZ A;  4HJG H;  1GTW A;  2HMM A;  1JTH B;  2YNY A;  2B9B A;  5AVV B;  1LT9 A;  4PJ0 H;  4YXD C;  1ZOY C;  2OYH B;  1ZP0 C;  3EWK A;  3V2P A;  3ZDM A;  1GDT A;  2M3B A;  3OAK A;  1T3U A;  2XNX A;  2B88 A;  1SQB J;  1P84 H;  2NPS A;  1L0L J;  1BCC J;  2YIU C;  3M9B A;  5KAI E;  1GMJ A;  1OXZ A;  4KHX A;  1EDK A;  1KIL C;  2D2C C;  2N9B A;  5KJ7 A;  3BCC D;  3H32 A;  3L4F A;  1LTT C;  1FZC A;  3V4W A;  3D70 A;  3A3Y B;  3L72 J;  1JCC A;  5KKZ B;  1IFJ A;  1AA0 A;  2W90 A;  5KLV J;  3CMA P;  2IYP A;  3CCS P;  3RK3 C;  1VQ9 P;  5AVQ B;  3RBZ A;  1M1K Q;  5CCH C;  2YIU B;  3CCM P;  1NU1 E;  3HD7 C;  3D71 A;  1KIL B;  1FS0 E;  1PP9 J;  2ZYA A;  3RGU A;  5BOK A;  2A06 D;  4H44 C;  3CXH H;  2RKL A;  3N4X A;  1VQ4 P;  2E74 C;  3A0H E;  4AUW A;  4AIV A;  1GW3 A;  2O1J A;  3CCE P;  3GL2 A;  2FYU E;  1BGY E;  4ZMD A;  2ZT9 C;  1PZQ A;  1K73 Q;  2GBX A;  3B5N D;  1H89 A;  3P7K A;  5AW9 B;  1LT9 C;  1XTG B;  5E79 H;  2W6B A;  3FWL A;  1HH0 A;  4QUQ A;  3FOU A;  2QPZ A;  3HD7 B;  5AEW A;  1FC2 C;  4L76 A;  2PP6 A;  3B5N B;  1A02 F;  2IBZ G;  1OX3 A;  3U1C A;  3H1H J;  2N1T A;  1FZA A;  3V6I A;  1SJG A;  2NPS C;  2C0X A;  3VMA A;  2BMR A;  1YQ4 C;  5CJ0 A;  1LTG C;  3VMG D;  3CWB D;  2WT7 A;  4UB8 E;  5KJ7 C;  1ZN5 A;  3Q5S A;  3H1J D;  2HMN A;  1RF1 A;  1FZC C;  3C8V A;  5B5E H;  4PV1 D;  4QUP A;  2YXQ B;  4C7N A;  1LT9 B;  4NBG D;  2H7H A;  2GM4 A;  2Y0E A;  3V2Q A;  3VN0 A;  1LTA C;  1BDC A;  3M0A A;  1L0N J;  3P8M C;  1O7W A;  1L4A D;  2KSJ A;  1S3J A;  2GUS A;  1NTK K;  5TIS H;  3U59 A;  3LID A;  5GTI H;  1JOC A;  1PGP A;  1SVF A;  1N7L A;  4H0L D;  4IOI H;  2LXC B;  4QCK A;  2K3R A;  1NTM G;  4D6T J;  2Z5I A;  1LTJ A;  3BCC G;  4CPG A;  2BCC D;  2ZAE B;  1ZW0 A;  1IC2 A;  4NPD A;  2HMJ A;  4XA4 A;  2WIT A;  1SQB K;  4QMA A;  2HOD A;  1L0L K;  3TDK A;  5APS A;  5CCG D;  2SPZ A;  2WPQ A;  3VOP A;  4GOD A;  2W8Z A;  4QDC A;  3M0D A;  2BAS A;  3CXH I;  3WU2 H;  3BRT B;  1NJI Q;  2QJP C;  1T3J A;  1RY3 A;  4N78 E;  1FJP A;  1ULI A;  1SQV E;  1NU1 J;  2N1T C;  1KD1 Q;  4I7Z C;  5KLV K;  1Y9B A;  3CX5 E;  1YIJ P;  2NUK A;  2HMK A;  2KZI A;  2C9L Y;  1RF1 C;  3M9H A;  1HJ0 A;  3FX0 A;  4R4M A;  1O7N A;  2LXB A;  2KS1 A;  1W2E A;  2R3C A;  1DH3 A;  1IFD A;  2YVJ B;  1DIP A;  1BGY J;  2QJP B;  1O7P A;  3GKE A;  1ZXG A;  2Q1K A;  3AZC A;  4B86 A;  3HUS A;  3FGA D;  1LTB C;  2W6A A;  2N1T B;  4I7Z B;  2NWF A;  4OH8 B;  3CCJ P;  1KYO D;  1Q90 D;  4N3Y B;  2IBZ E;  1URQ A;  1NYK A;  2QM8 A;  1KQL A;  4HM1 A;  2HMO A;  5KAI H;  3CWB G;  2KLU A;  1NAF A;  1RF1 B;  1NTZ D;  1LTJ C;  3VMI D;  1H8A A;  1S5L E;  4C7N B;  3GTE A;  3H1J G;  3RBX A;  3S1K A;  1Y47 A;  1D7M A;  1FZE A;  5KLI B;  2P1J A;  3AE8 C;  3L75 G;  1MUU A;  1VF5 D;  4U3F D;  1R8E A;  1OWA A;  2WSS H;  3PH0 A;  1DD3 A;  1K05 A;  2Q5U A;  2HLO A;  2IFM A;  3M0D C;  4HM4 A;  5APQ A;  4LLH A;  3L71 E;  3BVH A;  4NBF D;  1FE6 A;  1O7G A;  1LTJ B;  1KV4 A;  1NHL A;  1L0N K;  2H89 C;  4NBE D;  2H88 C;  1YTZ T;  1M1J B;  4XE5 B;  1HBW A;  2BCC G;  5AVZ B;  1YYC A;  1YQ3 C;  1NTM E;  4N6J A;  3VYI A;  3C9I A;  2OTJ P;  3BCC E;  3EFF K;  5CBO A;  1J1E C;  3A0H H;  4HM8 A;  1IFP A;  3KHU A;  1JTH A;  2E75 C;  1U57 A;  1BE3 D;  2QRX A;  2JZA A;  1KIL E;  2YKP A;  2L5G B;  3HUS C;  2HPC A;  1PPJ E;  1N73 B;  3I5C A;  5HL4 A;  2P2U A;  3SFD C;  1JB0 J;  4L73 A;  5H2F E;  1ZV8 A;  4HM3 A;  1URQ C;  3A0B E;  1S4X A;  2M3E A;  1SQV J;  1VQ6 P;  3CPW O;  3AE5 C;  2ITA A;  2WTY A;  1WRG A;  1HUC A;  1SQP G;  2AXT E;  3GTS A;  1KB9 D;  3IR9 A;  3RK3 E;  3VMY A;  2E75 B;  2QIW A;  3HTK B;  3L73 E;  5B66 E;  1NU1 K;  2R3S A;  3R4Y A;  2Q3E A;  1KFN A;  3AE2 C;  2W6J H;  2CK3 H;  5TIS E;  1N7S D;  2K9J A;  1USE A;  4YTP C;  2FYZ A;  4NPF X;  1ULJ A;  4NB9 D;  4IL6 E;  2KSE A;  2OTK E;  3RK2 D;  1KFM A;  1RH5 B;  2FYU K;  2P10 A;  3EFG A;  3E1I A;  3RL0 C;  1IFM A;  5AVT B;  4P1C H;  1NTZ G;  3RK2 B;  2O1K A;  1IK7 A;  1AVY A;  1OW8 A;  2BMO A;  1E79 H;  2IZ0 A;  4JYC A;  3H1J E;  1DX7 A;  3W68 A;  4U3F G;  1CI6 B;  4HB1 A;  1E5W A;  5CCH A;  3VMH D;  3L75 E;  3B8E B;  2JO1 A;  5AW8 B;  4NBB D;  2ZYL A;  1SQX E;  4HKZ H;  3B5N A;  1ZR2 A;  5EFW B;  1LWU A;  5AW5 B;  1HWT C;  3MD0 A;  1P84 D;  3RL0 B;  3PRJ A;  2FKW B;  2E42 A;  1U7M A;  3G71 P;  1MKM A;  3L71 J;  1EZV D;  2ZXE B;  1VQM P;  3K5B A;  1VQK P;  3CX5 H;  2E4P A;  3H1L D;  3D89 A;  2RMZ A;  3NFQ A;  1PGQ A;  1L0N E;  2E4Q A;  1NTM J;  4MN4 C;  2Q9I A;  3BCC J;  3TSI A;  4Z1M H;  1BE3 G;  5KKZ C;  3PHL A;  5AW4 B;  4DOJ A;  3TGU E;  4EI2 A;  1SFC C;  3FWN A;  3CD6 P;  3AEG C;  1K04 A;  1YTZ I;  4GIF A;  5KAF H;  2HPC B;  1BSH A;  1FDI A;  4D6T E;  3GF7 A;  4WBA A;  1OIP A;  2LR2 A;  1EXJ A;  1L4A A;  1HF9 A;  3CXH D;  2FFD B;  4ZKP A;  1SFC D;  3BAS A;  2LKM A;  1UII A;  1NTK D;  2A45 G;  1IJD B;  1S5L H;  1JM0 A;  2IX7 C;  2XV5 A;  1SQP E;  1SFC B;  1ZME C;  2K9J B;  1VDF A;  1SQV K;  1UUW A;  3CC7 P;  1YBK A;  3L73 J;  1HGZ A;  2XDJ A;  1VQN P;  3L70 D;  1YI2 P;  3T97 B;  1JUN A;  1SQB D;  5CCG A;  4EDF A;  3B5N C;  4DT0 A;  1BCC D;  3C0D A;  4IFD K;  1LWU C;  2M8R A;  2DW3 A;  2KUB A;  1QVF O;  2PRR A;  1KYO E;  1GK6 A;  3L74 D;  2JDI H;  4RKU J;  2WMM A;  1NWQ A;  3CCR P;  1Q81 Q;  1PL5 A;  3L72 D;  1SQQ D;  2ZJS E;  3AE9 C;  2HML A;  3OW2 O;  3CWB J;  2QG4 A;  5KLV D;  2YFL A;  3H1J J;  4K3A A;  1BSN A;  3CCV P;  4U3F E;  4WY4 D;  3KDP B;  1MFZ A;  1O7M A;  4PV1 C;  4Y99 C;  5BVZ A;  1ZLL A;  1LWU B;  5AW0 B;  3L75 J;  3CX5 I;  1AFO A;  4GOF A;  1JMB A;  1PP9 D;  5AW6 B;  4WY4 B;  1SQX J;  3BRV B;  1BDD A;  3AEA C;  1M90 Q;  1KC8 Q;  4L74 A;  1FDM A;  5H2F H;  1L4A C;  3WMM 0;  1CSB A;  3A0B H;  5AW3 B;  1KQG B;  2WPV B;  1ZRT D;  3Q5R A;  1N86 A;  3H1L G;  3KZI E;  1MZ9 A;  2K88 A;  1OFC X;  2OAR A;  2Q3W A;  4HKV A;  4H0L C;  2AXT H;  3A5T A;  2CPS A;  1XTC C;  2BCC J;  4PV1 B;  1X79 B;  1Y8A A;  4Y99 B;  3P8C D;  1KMI Z;  5B66 H;  1GL2 D;  1JY3 N;  3TF5 A;  2Y0D A;  5CJ4 A;  2IBZ I;  4I6M C;  3IAO A;  3MZW B;  3TGU J;  3HE5 B;  2B24 A;  1NAY A;  3H1I D;  3H1H D;  5AVU B;  1NTM K;  2IYO A;  4UB6 E;  5CCG C;  1L4A B;  2ZVN B;  4QUR A;  4IL6 H;  1DD4 A;  2E76 D;  1AQT A;  3MP7 B;  3H1K D;  3I56 P;  1T2K D;  1X9V A;  1AVO A;  2XZR A;  4PD4 D;  2GUV A;  1M1J A;  4H0L B;  1OVU A;  2XR8 A;  1NTK G;  1PGJ A;  3QWO C;  3GLM A;  2E76 B;  4RO0 A;  1RFS A;  1NDO A;  1MV8 A;  4YPC A;  1H88 A;  3AE3 C;  1T6A A;  3A7O A;  2AEJ A;  5KTB A;  2O3J A;  1FOS F;  1SQP J;  3KQG A;  3MTU E;  4YXW H;  3L70 G;  2K1A A;  1WT6 A;  2WVR A;  1SQB G;  3GB4 A;  3CI9 A;  3A2A A;  1VQP P;  1BCC G;  4NBA D;  1N73 A;  4C46 A;  2A06 G;  3SWF A;  1VQL P;  1VQ5 P;  1S2E A;  1IO4 A;  3L74 G;  2Q6Q A;  2FBW C;  1AQ5 A;  4I1L A;  1Q90 C;  2BEZ F;  1SQQ G;  2PAJ A;  4H13 D;  3M91 A;  3VCA A;  1NKN A;  2ZYD A;  5CHX A;  3WUT A;  4ASV A;  3HTK A;  5KLI C;  2WQY C;  5CXM A;  5KLV G;  5AEU A;  1OVR A;  1WMK A;  5KAF E;  2YXR B;  4OGQ D;  4H13 B;  4IFF A;  3SFE C;  3VCP A;  1QLE D;  1JY2 N;  4U3F J;  3JCU H;  4OGQ B;  1VF5 C;  1PP9 G;  1VQ8 P;  1YJ9 P;  1NU1 D;  1N7S A;  4EYY Q;  2DE6 D;  1NO4 A;  2YKO A;  2HG5 D;  3IFM A;  2W27 A;  2WSE J;  2PFX A;  3Q2Y A;  1KZU B;  1M1J C;  2HR3 A;  4HM6 A;  2J58 A;  4P1B H;  5DJT B;  5APX A;  1SQX K;  2WZ7 A;  3II6 A;  2FYU D;  1DEB A;  1BGY D;  1LP1 A;  5APT A;  1R5S A;  1Z56 A;  2NVG A;  1CI6 A;  1YJN P;  3MIW A;  4LGD E;  1KOR A;  2R44 A;  3S9O A;  5AW2 B;  1VF5 B;  1DEE G;  1OVV A;  3G4S P;  3MUD C;  3IF4 A;  2KLV A;  1S9K D;  3H1I G;  1BE3 J;  2QEX P;  2JO6 A;  2P58 A;  1NGM B;  3USS A;  1N73 C;  1TU3 F;  3H1K G;  1GD2 E;  1KYO H;  2PGD A;  3N7N A;  2B1X A;  4DZO A;  1PGO A;  1QEX A;  3S4R A;  1OZH A;  2O01 J;  4A7P A;  5GTH E;  2OYI B;  1AJY A;  3CCU P;  1FOS E;  2OGU A;  3SSU A;  2JEE A;  1LGH B;  2WPS A;  3VMZ A;  3L70 E;  1S1C X;  1UIX A;  3UIA A;  3E7K A;  3SWY A;  1NYH A;  2WSE H;  2XSO A;  1QL1 A;  1N7S C;  3GG2 A;  1SQP K;  3MHV A;  4ASW A;  2A06 E;  3CME P;  4RES B;  1JM1 A;  2FFD A;  1SLQ A;  1NKZ B;  3AE4 C;  5APY A;  3RK2 C;  1G1I A;  1IK9 A;  2UWJ E;  3KZI H;  4M3L A;  2IFN A;  4BXL A;  5APW A;  1IZN B;  2I1K A;  1SQQ E;  1SFC A;  1SP4 A;  3M06 A;  3QH9 A;  3R2P A;  1M56 D;  2H43 A;  4GDO A;  3T97 A;  3O6Q B;  1N7S B;  4UB6 H;  4O9B A;  4HM0 A;  2DE7 D;  1J1D C;  1SQV D;  2P67 A;  3CWB E;  5CMZ A;  2O01 H;  3OA7 A;  2J59 M;  2QM7 A;  1PV3 A;  1LP1 B;  3H6P A;  3CCL P;  3AED C;  2FYU G;  2QA4 P;  2R32 A;  1AV1 A;  4ZNC A;  3H1L J;  2Q3I A;  1QX8 A;  3AE7 C;  3P8C E;  3VTP C;  1KYO I;  4L75 A;  2I1J A;  3GMA A;  1J1D B;  1VM9 A;  2HYN A;  4HJL A;  4Y28 J;  4WY4 A;  1NH4 A;  3H1I E;  1M7L A;  2IBZ D;  4JPZ B;  2L91 A;  2OQQ A;  1JY3 P;  1G8K B;  1FZF A;  2FFD C;  2BCC E;  3AEB C;  4PD4 E;  1LJ2 A;  1VQ7 P;  3GZX A;  4TLF A;  4HM7 A;  4JF7 A;  5TJH A;  3N0Q A;  1RF0 A;  2POH A;  1EG9 A;  3VP8 A;  1VL2 A;  1JNM A;  4OWF A;  1EXI A;  2OTL P;  3JCU E;  3KXD A;  1KQS O;  4GOE A;  3HE5 A;  1GL2 A;  3FXE A;  1UUV A;  2P7J A;  1FDO A;  3L71 D;  3L70 J;  2Z4E A;  3SWK A;  2XU6 A;  2BEQ D;  1ZR4 A;  1H0T A;  1HVV A;  2BMQ A;  5AVW B;  3LW5 J;  1NTM D;  4HYT B;  3L74 J;  2DE5 D;  4EOT A;  1Q7Y Q;  1LTS C;  4XFJ A;  2YMY A;  2QJY C;  2R5B A;  1JCD A;  2O01 N;  2MKV A;  5AW1 B;  5AW7 B;  2J5U A;  4DJG A;  1HJB A;  2VRS A;  2GA1 A;  1SQQ J;  5AVY B;  3F89 A;  4AAY B;  1HTL C;  1L0L D;  1EDJ A;  1U7J A;  3JC2 2;  4JBZ A;  1KIL D;  2D2C D;  3G6E P;  2YMK A;  2KYV A;  3L36 A;  2I7F A;  4ZKU A;  1PPJ D;  4W7Y A;  1M8O B;  4K35 A;  1JO5 A;  1SQV G;  2M5A B;  1GK4 A;  4JQ0 D;  4WY4 C;  2KOG A;  1KB9 I;  2A45 I;  2D2C B;  1L2P A;  4HH2 A;  4I2L C;  3G9R A;  5BU5 A;  1NTZ E;  2QJY B;  1N2D C;  2ZFC A;  3CL3 D;  4KJM A;  1JY2 P;  2R5D A;  3U1A A;  2IPP A;  3RK3 D;  4BRY B;  3TK1 A;  2WSF J;  5CCH D;  4HM5 A;  3L73 D;  1RF0 C;  4BWN A;  3HD7 D;  5GTH H;  3GHG A;  3RK3 B;  1X8Y A;  3CCQ P;  1G1J A;  1FQT A;  3HE4 A;  2KNC B;  4H44 D;  3AE6 C;  2WSC J;  3PP5 A;  2Z5H A;  1FZB A;  1S9K E;  1GL2 C;  2B87 A;  1EZV G;  2FXP A;  2E74 D;  4TT3 H;  1J2J B;  2WPR A;  2YO2 A;  4U7J A;  2QVA A;  1VQO P;  4H44 B;  2XKM A;  1JY3 O;  3H1I J;  2KK7 A;  2ZT9 D;  3LW5 H;  1G2C B;  2E74 B;  3GW6 A;  3RL0 g;  3H1K J;  2E76 C;  1WQL A;  1GU4 A;  1T2K C;  2ZT9 B;  4DCK A;  2C9N Y;  2QJK C;  2KI7 B;  5APU A;  2IZ1 A;  5CBN A;  3ITK A;  1BE3 E;  2M0B A;  1KTM A;  3M9Q A;  1HGV A;  1S72 P;  3L75 D;  1P84 I;  4QDF A;  2NPS D;  1GL2 B;  3I55 P; 
#chains in the Genus database with same CATH homology
 4HM6 A;  3L71 E;  2XSH A;  2YFL A;  1ULJ A;  3VMG D;  4NB9 D;  4NBF D;  1O7G A;  1G8K B;  4P1B H;  3CX5 E;  4U3F E;  1O7M A;  2NUK A;  2BCC E;  2HMN A;  4D6T E;  3EQQ A;  4PD4 E;  4NBD D;  4PV1 D;  1SQB E;  4QUP A;  2HMK A;  4NBE D;  1P84 E;  2NVG A;  1G8J B;  1NTZ E;  1SQQ E;  1L0L E;  1BCC E;  3GCE A;  3GZX A;  1NTM E;  3GB4 A;  4NBG D;  4P1C H;  3BCC E;  1EZV E;  1O7N A;  4HM7 A;  3H1H E;  3N0Q A;  4QDD A;  4HM8 A;  4NBA D;  1KB9 E;  1EG9 A;  3L74 E;  3GZY A;  2YVJ B;  2GBW A;  4HM5 A;  3H1L E;  2BMO A;  2JO6 A;  4EMJ B;  3H1K E;  1O7W A;  1NU1 E;  1O7P A;  3GOB A;  3GKE A;  3H1J E;  2E75 D;  3AZC A;  2JZA A;  3L72 E;  1SQP E;  5BOK A;  2Q3W A;  4HKV A;  4HM0 A;  3GL0 A;  1UUV A;  1FQT A;  2DE7 D;  4H44 D;  4H0L D;  3L75 E;  1Q90 C;  3VMH D;  2NWF A;  2XRX A;  2B1X A;  4H13 D;  3VCA A;  3EN1 A;  4QDF B;  4QCK A;  5KLV E;  1O7H A;  1UUW A;  4NBB D;  2IBZ E;  2ZYL A;  4NB8 D;  1PPJ E;  1SQX E;  3CWB E;  1NYK A;  2E74 D;  5HL4 A;  4HM1 A;  5KLI C;  2HMO A;  5CXM A;  4AIV A;  2HMM A;  5AEU A;  4HM3 A;  2HMJ A;  3GL2 A;  2FYU E;  1VCK A;  2BMQ A;  1BGY E;  4OGQ D;  3DQY A;  3VMI D;  3VCP A;  2GBX A;  2ZT9 D;  3C0D A;  3GTE A;  2FYN C;  2B24 A;  2DE5 D;  2CKF A;  1PP9 E;  4NBC D;  2NUM A;  2QJY C;  4HM2 A;  4QUR A;  1KYO E;  2YFI A;  3GTS A;  3CXH E;  4QUQ A;  3FOU A;  2QPZ A;  4NBH D;  5AEW A;  1WQL A;  2E76 D;  2E4P A;  3D89 A;  1VF5 D;  4QDC A;  2YFJ A;  2QJK C;  3L70 E;  2DE6 D;  1NTK E;  3L73 E;  1L0N E;  2E4Q A;  2YIU C;  4AAY B;  2NVE A;  2QJP C;  1BE3 E;  1ZRT E;  2XR8 A;  1VM9 A;  2XSO A;  2NVF A;  4HJL A;  2HML A;  1SJG A;  1RIE A;  2A06 E;  1RFS A;  3H1I E;  4HM4 A;  5KKZ C;  1ULI A;  2D2C D;  1NDO A;  4QDF A;  1SQV E;  1JM1 A;  3TGU E;  2BMR A;  2I7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...