1NTZE

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntzE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntzE02
1UUWA 5HL4A 1L0NE 2NWFA 5KKZC 3GZYA 4HJLA 2XSOA 2FYNC 4QDFB 2HMMA 2NUMA 4HKVA 2E74D 3FOUA 3GOBA 4P1BH 2IBZE 2QJKC 2B24A 2DE7D 4HM2A 4NB9D 1ULJA 2E4QA 2YFJA 2A06E 2D2CD 2NVGA 4NBFD 3N0QA 4QDCA 2E76D 3VCAA 2JO6A 4QDDA 2QPZA 1BE3E 3VMHD 2BMRA 1SQVE 1SQXE 3H1LE 1EZVE 2E4PA 5AEWA 2HMNA 2FYUE 2ZYLA 1L0LE 1O7WA 1VF5D 2NVEA 2BCCE 3DQYA 1O7PA 2DE5D 1VCKA 1NU1E 4PD4E 1O7GA 2XRXA 1SJGA 3GL2A 1Q90C 3GTEA 1ULIA 2QJPC 3AZCA 4U3FE 2QJYC 4HM3A 1SQBE 1JM1A 2HMOA 2GBWA 2JZAA 1FQTA 5BOKA 4HM0A 4NBDD 4QDFA 3GL0A 1RFSA 4NBCD 2BMQA 2XR8A 1NTME 1KB9E 2GBXA 1PP9E 3H1IE 2YFLA 2HMLA 3BCCE 3GCEA 2NUKA 3CWBE 3L70E 1NDOA 4HM1A 4QCKA 5KLIC 3VCPA 4P1CH 3CXHE 2YVJB 3H1HE 4QUPA 2I7FA 4NBHD 4NBAD 1O7HA 4QURA 4PV1D 1SQPE 1BGYE 4D6TE 4EMJB 1SQQE 1PPJE 2YFIA 5KLVE 2B1XA 4H13D 3VMID 3GKEA 2XSHA 2E75D 1UUVA 2BMOA 1G8KB 1KYOE 1O7MA 1NTKE 3L71E 3L74E 4HM5A 3GTSA 2HMKA 3H1KE 4HM8A 4OGQD 4NBGD 4NB8D 3CX5E 3H1JE 3L72E 1O7NA 4HM7A 1RIEA 4H0LD 1BCCE 2YIUC 2Q3WA 1NTZE 1G8JB 3EQQA 3GB4A 4HM6A 3GZXA 2ZT9D 4AAYB 4NBBD 3D89A 1WQLA 2DE6D 3TGUE 3C0DA 1ZRTE 2CKFA 4H44D 3L75E 4HM4A 4QUQA 3VMGD 1VM9A 4NBED 2HMJA 4AIVA 3EN1A 1EG9A 5CXMA 5AEUA 1P84E 2NVFA 3L73E 1NYKA
chains in the Genus database with same CATH superfamily
3HD7D 1JMMA 3KHUA 3CLQA 2KXPB 3H1IJ 1FZAA 3TNUB 1LGHB 1FZFA 1S2EA 2E43A 2R3CA 3TGUG 5KAFE 2P2UA 1NAFA 2AEJA 1NJIQ 2KZIA 2B87A 2FXOA 2L5GB 4I2LC 1QVFO 4U3FD 3RGUA 1SFCC 3GG2A 1IC2A 3BCCJ 1SFCA 2QJYC 4YXDC 1OW8A 2Q1KA 1LWUB 1RF1A 3CCSP 3AE8C 2YMKA 1YQ4C 1MZ9A 3H1HE 1SQPD 4GKGA 4UB6H 1SQQE 2NPSD 1AFOA 2QG4A 1NU1D 2GM4A 1R5SA 1DH3A 1FE6A 1FZCC 3L74E 2HLOA 1KD1Q 3BCCG 3HD7A 1FZGA 3C9IA 3A5TA 3CXHH 4NBGD 4NB8D 4GIFA 4PV1B 3L72E 3T97B 1NTZE 2ZFCA 1FZBA 4YTPC 2KLVA 1R8EA 3IAOA 1WQLA 2DE6D 2YXQB 1OWAA 1U7MA 1DIPA 3EN1A 1UUWA 3V2QA 4ZNCA 2YIUB 2K1AA 2HMMA 3AE6C 3FOUA 4P1BH 5KAFH 5AVZB 1VQ4P 2DE7D 2KLUA 1S5LE 1FOSE 1QL2A 4YPCA 5KLIB 3CD6P 2O01J 1AQTA 2FY8A 2HYNA 2R3SA 3VMHD 1DEEG 2RMZA 1G1JA 3AE1C 2YKQA 2I1KA 2PGDA 1DEBA 5KLVJ 5CCGC 1KYOD 2KB7P 4PD4E 1SJGA 4HKZH 1W2BO 3AEFC 4Z1MH 3GHGB 1PP9G 1RF0A 1BCCG 4HM0A 3L71G 2Y0DA 4PD4I 3HUSB 2QEXP 3A0BH 2YKOA 3N4XA 1JO5A 1JMBA 3RK3D 1ZXGA 1QLED 3TNUA 3A0HE 3BASA 5KAIH 1SQVD 3L70G 2LR2A 4XFJA 1HH0A 4OGQD 5APTA 1KTMA 1NO4A 3GB4A 2OYHA 3O8ZA 5APSA 1FJPA 2KYVA 3S1KA 1E79H 3M0DA 2W83C 4C7NA 2XU6A 4N78D 1NGMB 2LKMA 1NAYA 1NTMJ 1L0LD 1GU4A 1VDFA 3CCUP 3HRNA 1HTLC 4WY4A 2P58A 1TU3F 1YYCA 2D2CD 3MP7B 2OTKE 2QSIA 2QVAA 2C9LY 1NH4A 5KTBA 1NTZJ 1SQXE 3M9BA 3RK3E 3CX5D 4R4MA 3GW6A 4JYBA 1VF5D 5KAIE 3A0HH 2E5TA 3H1KD 2XRXA 3GL2A 3EFGA 4Y99C 2ITAA 3EFFK 2IYOA 3HE4B 1VQNP 2Y9YA 4W80A 1RQUA 1EDKA 5KJ7D 3VN0A 3D71A 1RFSA 4RESB 1KB9E 1ZRTD 1J1DB 1EDIA 3QWOC 1JEKA 1U57A 4JYCA 1BGYD 4LC1A 5AVTB 3CWBG 4EMJB 3CCQP 1NTZG 3P8CD 1SQPG 2WSSH 5AW3B 5B5EH 1LP1B 3F89A 4H0LB 4O9BA 2HMKA 4IL6E 1ZV8A 1XTGB 3W67A 4IFMA 1NTMG 3PP5A 2IFNA 1S3JA 3C0DA 3IF4A 1KN7A 3GF3A 4HM4A 5AEUA 3L73E 3JC22 4N3YB 3V4WA 4PV1C 1FC2C 1EZVI 2YO3A 3JCUH 1VPCA 1K73Q 1T8ZA 1VQOP 5AW5B 4OVNF 2FXMA 2PFXA 4HJGH 5DJTB 3O6QB 3WUTA 4HM2A 1URQD 1SQXJ 2N9BA 3TYYA 4BWNA 1OFCX 3AE9C 2M3BA 1KFNA 2JR8A 1QVGO 2XNDH 4CPGA 1K9MQ 3V2PA 3L75J 2BMRA 3H1LE 1KZUB 5AW7B 1JTHA 4LLHA 4UB6E 2ZAEB 1LTJA 1OVVA 2ZVOB 3OAKA 3Q1MA 1KB9H 2Q5UA 1NTKD 1IFPA 2E74B 1ZN5A 1QL1A 1YBKA 1LT9B 2A45I 2V4HA 2WSEH 3CCVP 2W8ZA 1RQVA 3PHLA 1WT6A 1MFTA 2R5BA 1OXZA 1SFCB 2N1TC 2Z5IA 1O7HA 3CCJP 2IBZD 2AEMA 2RH0A 1FZCA 1YI2P 3L74J 3FGAD 3HD7C 3KDPB 2M8RA 2J5UA 2M3EA 2RN0A 1LT9A 2MKVA 2R32A 3TF5A 1O7NA 2WSCJ 3EQQA 3NMDA 1SQVJ 2PAJA 2Y0CA 4H44D 2DW3A 3SSUA 2NRGA 5APYA 2A45G 2XSOA 1P84I 3HTKA 5APUA 5AW6B 1M1JB 3VCAA 3C1LA 1FBMA 2YNYA 1SQVK 2GA1A 1QEXA 2E4PA 2ZYLA 4KT0J 3B71A 1O7WA 2QJKB 3AE3C 1M1JC 4OH8B 2D2CB 3VP8A 1X22A 2B87B 1KILC 1JM1A 4GODA 2GBWA 5BOKA 1OX3A 4U3FG 3WMM0 1IFJA 3KQGA 3SWYA 1RHZB 5H2FE 5KLVG 1N73A 3I55P 1IFIA 3L36A 1BGYG 2FYNB 5KLVE 4GOEA 1CZQA 2KP8A 2K9JA 1J1EB 1PGPA 2BCCD 1N2DC 1RF1B 1MFZA 5AW9B 3Q2YA 2OYHC 3Q5SA 1URQA 3WU2H 5KJ7A 2QJYB 2E5YA 3PTZA 3D70A 1NTZK 1EG9A 4NPDA 3C8VA 1NYKA 3S4RA 2N1TB 3KYQA 2NWFA 1ZMEC 3P32A 4XE5B 3HD7B 2NUMA 1ZW0A 1GU5A 3CCRP 3L35A 2QJKC 2B24A 1KQSO 1SQQK 2E4QA 4HH2A 4NBFD 2KZJA 3N0QA 4JBZA 3USSA 4AQRD 4QDDA 3TGUD 1SQPK 3U59A 1SQVE 1YQ3C 5AEWA 1N7SC 1VL2A 1DD4A 1JM0A 1AA0A 3HUSA 5H2FH 1N7SA 2NPSC 1AJYA 1Q86Q 3DQYA 2YKPA 3V5BA 5AW2B 2FBWC 1Q90C 2KNCA 2P7JA 4HM3A 4IFFA 1FDOA 1NTKG 1RF1C 1YITP 5C39A 1NTME 2B9BA 1NVOA 1M57D 1EZVD 5CBOA 5KLIC 3RK2B 2HFED 1RE4A 2AXTH 1H88A 1BSNA 4I7ZB 1RE4C 3SWKA 3A2AA 3Q5PA 4HM5A 1YIJP 4EI2A 3OJAB 4HM7A 3R4YA 5AW0B 1VQPP 1PPJG 1S4XA 1JCDA 1JY2N 5AVYB 2OGUA 2KI7B 2H7HA 3AEEC 1A02J 2WMMA 3TDKA 1KQGB 2XZRA 2N9YB 2W90A 2OARA 3L37A 2WWWA 1HJ0A 1BE3G 1CW5A 1Q82Q 2IBZE 3FX0A 3MUDC 3RBXA 4D6TG 1AVYA 4AUWA 4L74A 5TISH 1GW4A 1NTMK 2P1JA 4Y99B 3QH9A 1YHQP 3E1RA 1L0LJ 3L72G 3L73G 4C7NB 2OYIC 3HE5A 1BDDA 3K5BA 2OYIA 5CJ4A 5M1BA 3L75D 1LTGC 2FYUJ 2HODA 1SQBE 1EXJA 1JTHB 4OGQB 1JCCA 3WU2E 3CWBJ 4LGDE 3CX5H 4H0LC 5B66H 4NBHD 4PV1D 1SQPE 3H1KJ 3VMAA 4UB8E 1SQBK 2XSHA 2E75D 1DD3A 1LT9C 3VOPA 1KORA 3V2NA 4D6TD 2XV5A 5GTIE 4WBAA 1N8RQ 1S9KE 1ZLLA 1GZLA 1IZNB 2K3RA 2KK7A 2GUSA 3TGUE 3ZDMA 5BVZA 1VM9A 2BCCJ 4NBED 1J1DC 5CXMA 2Z4EA 3RL0D 5AW1B 1WMKA 3M0DC 1X79B 3RL0B 2QJPB 4L75A 4EYYQ 2KS1B 3BVHA 3A3YB 4I7ZC 4HKVA 3WUUA 3MZWB 2PRRA 1H0TB 1FAVA 5AVXB 3HE5B 1H8AA 3MIWA 2IBZG 2E42A 1SQBD 4IL6H 3H32B 1BE3E 1W5CE 5CJ0A 3RK2D 3V2RA 3VYIA 5AVSB 2HPCA 3PJSK 3H1ID 2AXCA 3L70D 4DOJA 1L0LE 1AVOA 2XDJA 1MUUA 2J59M 3BATA 3H1LD 5APQA 2ZJSE 3AZCA 2WT7A 3VMXA 2BEZF 5EFWB 1VQ7P 2HMOA 1M56D 2BEQD 2MJZA 4QDFA 3GL0A 2FYUG 3MTUE 2ZYGA 2XR8A 2Q7CA 2YFLA 1GTWA 1LTAC 2NUKA 3IFMA 4QUPA 1X8YA 3L73J 3H1JJ 3L71J 1RY3A 2FYUK 1N73C 2L91A 3GKEA 3P8MC 3H1JG 1K05A 4JPZB 1SQBG 1SQQG 1G1IA 1SVFA 2M5AB 3H1JE 1RE3C 2WPVB 1URQC 3H1HG 3I5CA 3RL0C 1VF5B 1BCCE 2K37A 4OWFA 2R44A 1NKNA 1JB0J 4OGQC 5KJ7C 1BE3J 1KB9D 4I6MC 1VQ8P 2FYZA 3ABVC 5APXA 2A06G 2E76B 2P10A 3T97A 3P8CE 3KPEA 1L0NE 2XKMA 3M91A 2Q9IA 4QDFB 1N86A 2IZ1A 3H1KG 4KJMA 2W6JH 4C46A 3MUDA 4L73A 2AEFA 2IYPA 2Z5HA 2D2CC 3FWNA 3KZIH 1AQ5A 3B5ND 1QX8A 3AECC 1LWUA 4K35A 2Y0EA 3L72J 3CWBD 1KILB 3FWLA 2CK3H 2JP3A 1T2KD 3VP9A 4MN4C 2BCCE 3PH0A 2WSCH 2PP6A 3IN6A 5GTHH 1ULIA 2QJPC 2YMYA 2FFDA 3B5NA 2JEEA 1JY2O 1LTIC 1LTTC 4GDOA 2POHA 3UIAA 3BCCE 2O1KA 5GTIH 2K9YA 4WWIA 4QURA 1BGYE 1KYOH 2OYHB 2YFIA 1L0NJ 2Y9ZA 1GD2E 2XNXA 2HPCB 1NTKE 1T3UA 2E76C 1OW7A 3LIDA 1FOSF 1KMIZ 3IR9A 1T6AA 1YJ9P 1S5LH 3RL0g 1G8JB 1EXIA 3GZXA 2SPZA 1USEA 1VQMP 4GT1A 3AE7C 3V4QA 3VMGD 2KS1A 5GTHE 1KQLA 3U1AA 2G8YA 3M9HA 1IJDB 1KV4A 2FYNC 2ZYAA 2JDIH 3LW5H 1EZVG 3LW5J 1BDCA 1ULJA 3RK3B 4I1LA 1Q90D 4HB1A 3TK1A 5CBNA 1URQB 4EIJA 3CXHD 2C0XA 4GOFA 1PGJA 3KXDA 3M0AA 2B88A 1M1JA 3G3ZA 4U7JA 1M8OB 3G4SP 3RK3C 1NU1E 1SQBJ 3ITKA 4U3FJ 4RO0A 1AV1A 1L4AC 2M5AA 4WVZA 1H89A 2BMQA 4NBCD 1Y9BA 3GCEA 2FYUD 3SFEC 2I7FA 3Q5RA 3AEGC 2GUVA 1PPJE 5AW4B 2LXBA 3PRJA 5KLVK 2ZT9B 1DX7A 1IO4A 5TISE 2NPSB 1SQXG 3OW2O 3GMAA 1XTCC 3A0BE 4HM6A 2ZT9D 2IBZI 1K04A 1PGQA 2K9JB 1CI6A 4WB4A 3W68A 1EQ7A 1N73B 2CKFA 1A02F 4PD4H 5BU5A 3B4SA 1P84E 2NVFA 1EDLA 3M06A 4XA4A 5KKZC 2FKWB 1HVVA 1S72P 1E5WA 1KILE 1HUCA 4NPEA 5K5GB 1GDTA 1Z56A 1K8AQ 2O1JA 4QDCA 1PV3A 5AW8B 2E76D 2QPZA 2C0WA 3VTPC 3GLMA 1PP9D 1SQXD 2FYUE 2NPSA 4RKUJ 3VMZA 1O7PA 1JY3N 3AEAC 2J58A 2H89C 1CI6B 1NTKK 2JZAA 4TT3H 3L73D 5E79H 3GF7A 1NWQA 1PFIA 1PP9E 1SP4A 4JF7A 4HM1A 1T2KC 2CPBA 3GHGC 3NFQA 2KNCB 2K88A 4KHXA 2V7QH 1ZP0C 4YXWH 2B1XA 5CMZA 1PIXA 4M3LA 2JO1A 2JWAA 1NHLA 1YTZT 5APVA 3CCEP 3CX5E 4BXLA 1KFMA 3EQ2A 3BRVB 4IFDK 4H13C 1L0LG 1L4AB 1IK9A 3HTKB 1L0ND 2ZXEB 1HGZA 3H1LG 1LNQA 2KUBA 1OIPA 4AIVA 4HM8A 4D6TJ 3CC7P 3II6A 3CC2P 3JSVC 1GW3A 3G71P 1JOCA 2LXCB 1LTJB 3I56P 3G6EP 5CHXA 2N1TD 3NTNA 4K3AA 1T3JA 1W2EA 4WY4D 2I8DA 2KOGA 1LP1A 1JY2P 3G9RA 2HMNA 1GL2A 1YJNP 3H32A 1R5LA 1U7JA 1P84H 2B89A 3GTEA 1ZR4A 3B5NC 1RF0C 3L74D 1FS0E 1L4AA 5E79E 1J2JB 3NXSA 1L0NG 2C9NY 2NZ2A 2A06D 2KSEA 1Y47A 1IFMA 2O01N 1JY3O 1N7LA 1WRGA 2N1TA 1HGVA 1PGOA 1MV8A 1NKZB 1KB9I 3S9OA 2WSFH 4H13D 1NTKJ 2E75C 1G8KB 3V6IA 1O7MA 1X9VA 4ZKPA 1BGYJ 2ZXXA 1G2CB 2H88C 4H0LD 2YXRB 1L0LK 3D6ZA 4AAYB 3H1JD 3O6QA 2IX7C 3L75E 4QUQA 2O01H 1GMJA 3B8EB 1Y8AA 3H1HD 2WPRA 2WPSA 5TJHA 5HL4A 1YJWP 3H25A 4PD4D 1GL2D 3F5HA 1VQ6P 1S1CX 3A7OA 3BRTB 3RBZA 3L75G 3GOBA 1FZEA 2YFJA 1N7SB 4R4LA 1S9KD 2RKLA 2NVGA 2Q3EA 2VRSA 1VF5C 2IPPA 1NOHA 1OMIA 4TLFA 2M0BA 1SLQA 4Y28J 4ZKUA 3FXDA 4H44B 4BRYB 1GK4A 1OZHA 4U3FE 1HF9A 1FDMA 3AE4C 3R2PA 4RJTA 4B86A 3SWFA 3FXEA 1S5LX 1G2CA 1L0NK 1L4AD 2WZ7A 2WITA 1SQVG 2HMLA 3L70E 4QCKA 2E74C 2YVJB 1JY3P 1HWTC 1FJKA 5B5EE 3TSIA 3VMYA 2BMOA 1KYOE 3L71E 3MGNA 2OTLP 3CMAP 4C7RA 3WUVA 2WTYA 1MKMA 3B5NB 1UIIA 2H8PD 3L4FA 1JNMA 1ZOYC 4PJ0H 2O3JA 3D89A 4ZMDA 2ZT9C 3JCUE 3E7KA 1H0TA 1QGKB 1GL2B 3CL3D 1PZQA 3P7KA 1PPJD 2QM7A 3GZYA 4PJ0E 1VQLP 2V7QJ 1PP9J 1SQXK 2JKVA 2OYOA 3AE2C 1SQQJ 1KQFB 2QE7H 2OYIB 1NYHA 2P67A 2JO6A 3LIEA 1D7MA 5KKZB 4JQ0D 1LWUC 2JJLA 2IZ0A 2NVEA 1Q7YQ 4DJGA 5CCHA 2DE5D 1VCKA 2FFDC 4ASWA 3L74G 2W6AA 4AYCA 1NU1J 3AE5C 3H1IE 1JUNA 1NDOA 1KYOI 3VCPA 4P1CH 1ZR2A 1PL5A 5AVRB 2KIKA 2OQQA 1OW6A 3VMID 2W27A 1UUVA 3KZIE 3MD0A 4H44C 3GTSA 1SQPJ 3H1KE 1NTMD 1LT1A 3D6YA 1J1EC 1P84D 3M9QA 3CMEP 4NBBD 1ZRTE 3H6PA 1BCCD 2QRXA 1HJBA 5CCGD 4DT0A 5L8RJ 3CCMP 4HJLA 1FU1A 2IDBA 1FDIA 4H13B 2JWDA 4HYTB 4IL6X 2WPQA 1HBWA 2QA4P 4NB9D 5BU8B 1SFCD 2OTJP 3CPWO 3MHVA 3H1LJ 5AVUB 1OVRA 2AXTE 2FXPA 1LTJC 3CI9A 1GL2C 1OVUA 1N7SD 1LJ2A 3TGUJ 3N7NA 1KILD 3H1IG 1M7LA 4NBDD 2Q3IA 4W7YA 5DJUB 2Q6QA 1UIXA 1LTSC 3CXHE 4NBAD 2WQYC 1NU1G 1VQ5P 3OA7A 3BCCD 4UB8H 3CXHI 2WSFJ 1USDA 5B66E 1BE3D 3E1IA 3RK2C 1NU1K 1EC5A 2FFDB 3H1HJ 1CSBA 2YIUC 1Q2NA 2Q3WA 1EDJA 4EOTA 2WT7B 3AEBC 1RH5B 1SQQD 1IK7A 2E75B 4QMAA 2IFMA 1LTBC 4DZOA 4IOIH 2WSEJ 1M90Q 2E74D 4N78E 1NTZD 3CC4P 3L72D 2A06E 1M1KQ 4BRYA 4WY4C 4N6JA 2HR3A 3EWKA 3PLNA 1X0TA 3HUSC 1BSHA 3CX5I 3HE4A 1EZVE 4A7PA 2ZYDA 1FZCB 5CCHC 4ASVA 4NPFX 5CCGA 2I1JA 1O7GA 1GK6A 1Q81Q 2W6BA 3L71D 2G3AA 3AEDC 1FQTA 2QIWA 2WVRA 5AVWB 4EDFA 1KILA 2QM8A 1YTZI 2GBXA 3L70J 2ZVNB 1L2PA 3GHGA 3Q3DA 5KLVD 3CWBE 2A45H 2CPSA 4D6TE 2BCCG 1VQ9P 1BCCJ 5AVVB 2UWJE 1VQKP 3SFDC 2HG5D 1KC8Q 4L76A 4W7ZA 5APWA 1RIEA 1SS1A 1RE3A 1IFNA 2H43A 2R5DA 2HODB 2BASA 2YO2A 5AVQB 4DCKA 4WY4B 2HMJA 5CCHD 3U1CA 2KSJA 1IFDA 3CCLP
chains in the Genus database with same CATH topology
1UUWA 5HL4A 1L0NE 2NWFA 5KKZC 3GZYA 4HJLA 2XSOA 2FYNC 4QDFB 2HMMA 2NUMA 4HKVA 2E74D 3FOUA 3GOBA 4P1BH 2IBZE 2QJKC 2B24A 2DE7D 4HM2A 4NB9D 1ULJA 2E4QA 2YFJA 2A06E 2D2CD 2NVGA 4NBFD 3N0QA 4QDCA 2E76D 3VCAA 2JO6A 4QDDA 2QPZA 1BE3E 3VMHD 2BMRA 1SQVE 1SQXE 3H1LE 1EZVE 2E4PA 5AEWA 2HMNA 2FYUE 2ZYLA 1L0LE 1O7WA 1VF5D 2NVEA 2BCCE 3DQYA 1O7PA 2DE5D 1VCKA 1NU1E 4PD4E 1O7GA 2XRXA 1SJGA 3GL2A 1Q90C 3GTEA 1ULIA 2QJPC 3AZCA 4U3FE 2QJYC 4HM3A 1SQBE 1JM1A 2HMOA 2GBWA 2JZAA 1FQTA 5BOKA 4HM0A 4NBDD 4QDFA 3GL0A 1RFSA 4NBCD 2BMQA 2XR8A 1NTME 1KB9E 2GBXA 1PP9E 3H1IE 2YFLA 2HMLA 3BCCE 3GCEA 2NUKA 3CWBE 3L70E 1NDOA 4HM1A 4QCKA 5KLIC 3VCPA 4P1CH 3CXHE 2YVJB 3H1HE 4QUPA 2I7FA 4NBHD 4NBAD 1O7HA 4QURA 4PV1D 1SQPE 1BGYE 4D6TE 4EMJB 1SQQE 1PPJE 2YFIA 5KLVE 2B1XA 4H13D 3VMID 3GKEA 2XSHA 2E75D 1UUVA 2BMOA 1G8KB 1KYOE 1O7MA 1NTKE 3L71E 3L74E 4HM5A 3GTSA 2HMKA 3H1KE 4HM8A 4OGQD 4NBGD 4NB8D 3CX5E 3H1JE 3L72E 1O7NA 4HM7A 1RIEA 4H0LD 1BCCE 2YIUC 2Q3WA 1NTZE 1G8JB 3EQQA 3GB4A 4HM6A 3GZXA 2ZT9D 4AAYB 4NBBD 3D89A 1WQLA 2DE6D 3TGUE 3C0DA 1ZRTE 2CKFA 4H44D 3L75E 4HM4A 4QUQA 3VMGD 1VM9A 4NBED 2HMJA 4AIVA 3EN1A 1EG9A 5CXMA 5AEUA 1P84E 2NVFA 3L73E 1NYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUW A;  5HL4 A;  1L0N E;  2NWF A;  5KKZ C;  3GZY A;  4HJL A;  2XSO A;  2FYN C;  4QDF B;  2HMM A;  2NUM A;  4HKV A;  2E74 D;  3FOU A;  3GOB A;  4P1B H;  2IBZ E;  2QJK C;  2B24 A;  2DE7 D;  4HM2 A;  4NB9 D;  1ULJ A;  2E4Q A;  2YFJ A;  2A06 E;  2D2C D;  2NVG A;  4NBF D;  3N0Q A;  4QDC A;  2E76 D;  3VCA A;  2JO6 A;  4QDD A;  2QPZ A;  1BE3 E;  3VMH D;  2BMR A;  1SQV E;  1SQX E;  3H1L E;  1EZV E;  2E4P A;  5AEW A;  2HMN A;  2FYU E;  2ZYL A;  1L0L E;  1O7W A;  1VF5 D;  2NVE A;  2BCC E;  3DQY A;  1O7P A;  2DE5 D;  1VCK A;  1NU1 E;  4PD4 E;  1O7G A;  2XRX A;  1SJG A;  3GL2 A;  1Q90 C;  3GTE A;  1ULI A;  2QJP C;  3AZC A;  4U3F E;  2QJY C;  4HM3 A;  1SQB E;  1JM1 A;  2HMO A;  2GBW A;  2JZA A;  1FQT A;  5BOK A;  4HM0 A;  4NBD D;  4QDF A;  3GL0 A;  1RFS A;  4NBC D;  2BMQ A;  2XR8 A;  1NTM E;  1KB9 E;  2GBX A;  1PP9 E;  3H1I E;  2YFL A;  2HML A;  3BCC E;  3GCE A;  2NUK A;  3CWB E;  3L70 E;  1NDO A;  4HM1 A;  4QCK A;  5KLI C;  3VCP A;  4P1C H;  3CXH E;  2YVJ B;  3H1H E;  4QUP A;  2I7F A;  4NBH D;  4NBA D;  1O7H A;  4QUR A;  4PV1 D;  1SQP E;  1BGY E;  4D6T E;  4EMJ B;  1SQQ E;  1PPJ E;  2YFI A;  5KLV E;  2B1X A;  4H13 D;  3VMI D;  3GKE A;  2XSH A;  2E75 D;  1UUV A;  2BMO A;  1G8K B;  1KYO E;  1O7M A;  1NTK E;  3L71 E;  3L74 E;  4HM5 A;  3GTS A;  2HMK A;  3H1K E;  4HM8 A;  4OGQ D;  4NBG D;  4NB8 D;  3CX5 E;  3H1J E;  3L72 E;  1O7N A;  4HM7 A;  1RIE A;  4H0L D;  1BCC E;  2YIU C;  2Q3W A;  1NTZ E;  1G8J B;  3EQQ A;  3GB4 A;  4HM6 A;  3GZX A;  2ZT9 D;  4AAY B;  4NBB D;  3D89 A;  1WQL A;  2DE6 D;  3TGU E;  3C0D A;  1ZRT E;  2CKF A;  4H44 D;  3L75 E;  4HM4 A;  4QUQ A;  3VMG D;  1VM9 A;  4NBE D;  2HMJ A;  4AIV A;  3EN1 A;  1EG9 A;  5CXM A;  5AEU A;  1P84 E;  2NVF A;  3L73 E;  1NYK A; 
#chains in the Genus database with same CATH topology
 3HD7 D;  1JMM A;  3KHU A;  3CLQ A;  2KXP B;  3H1I J;  1FZA A;  3TNU B;  1LGH B;  1FZF A;  1S2E A;  2E43 A;  2R3C A;  3TGU G;  5KAF E;  2P2U A;  1NAF A;  2AEJ A;  1NJI Q;  2KZI A;  2B87 A;  2FXO A;  2L5G B;  4I2L C;  1QVF O;  4U3F D;  3RGU A;  1SFC C;  3GG2 A;  1IC2 A;  3BCC J;  1SFC A;  2QJY C;  4YXD C;  1OW8 A;  2Q1K A;  1LWU B;  1RF1 A;  3CCS P;  3AE8 C;  2YMK A;  1YQ4 C;  1MZ9 A;  3H1H E;  1SQP D;  4GKG A;  4UB6 H;  1SQQ E;  2NPS D;  1AFO A;  2QG4 A;  1NU1 D;  2GM4 A;  1R5S A;  1DH3 A;  1FE6 A;  1FZC C;  3L74 E;  2HLO A;  1KD1 Q;  3BCC G;  3HD7 A;  1FZG A;  3C9I A;  3A5T A;  3CXH H;  4NBG D;  4NB8 D;  4GIF A;  4PV1 B;  3L72 E;  3T97 B;  1NTZ E;  2ZFC A;  1FZB A;  4YTP C;  2KLV A;  1R8E A;  3IAO A;  1WQL A;  2DE6 D;  2YXQ B;  1OWA A;  1U7M A;  1DIP A;  3EN1 A;  1UUW A;  3V2Q A;  4ZNC A;  2YIU B;  2K1A A;  2HMM A;  3AE6 C;  3FOU A;  4P1B H;  5KAF H;  5AVZ B;  1VQ4 P;  2DE7 D;  2KLU A;  1S5L E;  1FOS E;  1QL2 A;  4YPC A;  5KLI B;  3CD6 P;  2O01 J;  1AQT A;  2FY8 A;  2HYN A;  2R3S A;  3VMH D;  1DEE G;  2RMZ A;  1G1J A;  3AE1 C;  2YKQ A;  2I1K A;  2PGD A;  1DEB A;  5KLV J;  5CCG C;  1KYO D;  2KB7 P;  4PD4 E;  1SJG A;  4HKZ H;  1W2B O;  3AEF C;  4Z1M H;  3GHG B;  1PP9 G;  1RF0 A;  1BCC G;  4HM0 A;  3L71 G;  2Y0D A;  4PD4 I;  3HUS B;  2QEX P;  3A0B H;  2YKO A;  3N4X A;  1JO5 A;  1JMB A;  3RK3 D;  1ZXG A;  1QLE D;  3TNU A;  3A0H E;  3BAS A;  5KAI H;  1SQV D;  3L70 G;  2LR2 A;  4XFJ A;  1HH0 A;  4OGQ D;  5APT A;  1KTM A;  1NO4 A;  3GB4 A;  2OYH A;  3O8Z A;  5APS A;  1FJP A;  2KYV A;  3S1K A;  1E79 H;  3M0D A;  2W83 C;  4C7N A;  2XU6 A;  4N78 D;  1NGM B;  2LKM A;  1NAY A;  1NTM J;  1L0L D;  1GU4 A;  1VDF A;  3CCU P;  3HRN A;  1HTL C;  4WY4 A;  2P58 A;  1TU3 F;  1YYC A;  2D2C D;  3MP7 B;  2OTK E;  2QSI A;  2QVA A;  2C9L Y;  1NH4 A;  5KTB A;  1NTZ J;  1SQX E;  3M9B A;  3RK3 E;  3CX5 D;  4R4M A;  3GW6 A;  4JYB A;  1VF5 D;  5KAI E;  3A0H H;  2E5T A;  3H1K D;  2XRX A;  3GL2 A;  3EFG A;  4Y99 C;  2ITA A;  3EFF K;  2IYO A;  3HE4 B;  1VQN P;  2Y9Y A;  4W80 A;  1RQU A;  1EDK A;  5KJ7 D;  3VN0 A;  3D71 A;  1RFS A;  4RES B;  1KB9 E;  1ZRT D;  1J1D B;  1EDI A;  3QWO C;  1JEK A;  1U57 A;  4JYC A;  1BGY D;  4LC1 A;  5AVT B;  3CWB G;  4EMJ B;  3CCQ P;  1NTZ G;  3P8C D;  1SQP G;  2WSS H;  5AW3 B;  5B5E H;  1LP1 B;  3F89 A;  4H0L B;  4O9B A;  2HMK A;  4IL6 E;  1ZV8 A;  1XTG B;  3W67 A;  4IFM A;  1NTM G;  3PP5 A;  2IFN A;  1S3J A;  3C0D A;  3IF4 A;  1KN7 A;  3GF3 A;  4HM4 A;  5AEU A;  3L73 E;  3JC2 2;  4N3Y B;  3V4W A;  4PV1 C;  1FC2 C;  1EZV I;  2YO3 A;  3JCU H;  1VPC A;  1K73 Q;  1T8Z A;  1VQO P;  5AW5 B;  4OVN F;  2FXM A;  2PFX A;  4HJG H;  5DJT B;  3O6Q B;  3WUT A;  4HM2 A;  1URQ D;  1SQX J;  2N9B A;  3TYY A;  4BWN A;  1OFC X;  3AE9 C;  2M3B A;  1KFN A;  2JR8 A;  1QVG O;  2XND H;  4CPG A;  1K9M Q;  3V2P A;  3L75 J;  2BMR A;  3H1L E;  1KZU B;  5AW7 B;  1JTH A;  4LLH A;  4UB6 E;  2ZAE B;  1LTJ A;  1OVV A;  2ZVO B;  3OAK A;  3Q1M A;  1KB9 H;  2Q5U A;  1NTK D;  1IFP A;  2E74 B;  1ZN5 A;  1QL1 A;  1YBK A;  1LT9 B;  2A45 I;  2V4H A;  2WSE H;  3CCV P;  2W8Z A;  1RQV A;  3PHL A;  1WT6 A;  1MFT A;  2R5B A;  1OXZ A;  1SFC B;  2N1T C;  2Z5I A;  1O7H A;  3CCJ P;  2IBZ D;  2AEM A;  2RH0 A;  1FZC A;  1YI2 P;  3L74 J;  3FGA D;  3HD7 C;  3KDP B;  2M8R A;  2J5U A;  2M3E A;  2RN0 A;  1LT9 A;  2MKV A;  2R32 A;  3TF5 A;  1O7N A;  2WSC J;  3EQQ A;  3NMD A;  1SQV J;  2PAJ A;  2Y0C A;  4H44 D;  2DW3 A;  3SSU A;  2NRG A;  5APY A;  2A45 G;  2XSO A;  1P84 I;  3HTK A;  5APU A;  5AW6 B;  1M1J B;  3VCA A;  3C1L A;  1FBM A;  2YNY A;  1SQV K;  2GA1 A;  1QEX A;  2E4P A;  2ZYL A;  4KT0 J;  3B71 A;  1O7W A;  2QJK B;  3AE3 C;  1M1J C;  4OH8 B;  2D2C B;  3VP8 A;  1X22 A;  2B87 B;  1KIL C;  1JM1 A;  4GOD A;  2GBW A;  5BOK A;  1OX3 A;  4U3F G;  3WMM 0;  1IFJ A;  3KQG A;  3SWY A;  1RHZ B;  5H2F E;  5KLV G;  1N73 A;  3I55 P;  1IFI A;  3L36 A;  1BGY G;  2FYN B;  5KLV E;  4GOE A;  1CZQ A;  2KP8 A;  2K9J A;  1J1E B;  1PGP A;  2BCC D;  1N2D C;  1RF1 B;  1MFZ A;  5AW9 B;  3Q2Y A;  2OYH C;  3Q5S A;  1URQ A;  3WU2 H;  5KJ7 A;  2QJY B;  2E5Y A;  3PTZ A;  3D70 A;  1NTZ K;  1EG9 A;  4NPD A;  3C8V A;  1NYK A;  3S4R A;  2N1T B;  3KYQ A;  2NWF A;  1ZME C;  3P32 A;  4XE5 B;  3HD7 B;  2NUM A;  1ZW0 A;  1GU5 A;  3CCR P;  3L35 A;  2QJK C;  2B24 A;  1KQS O;  1SQQ K;  2E4Q A;  4HH2 A;  4NBF D;  2KZJ A;  3N0Q A;  4JBZ A;  3USS A;  4AQR D;  4QDD A;  3TGU D;  1SQP K;  3U59 A;  1SQV E;  1YQ3 C;  5AEW A;  1N7S C;  1VL2 A;  1DD4 A;  1JM0 A;  1AA0 A;  3HUS A;  5H2F H;  1N7S A;  2NPS C;  1AJY A;  1Q86 Q;  3DQY A;  2YKP A;  3V5B A;  5AW2 B;  2FBW C;  1Q90 C;  2KNC A;  2P7J A;  4HM3 A;  4IFF A;  1FDO A;  1NTK G;  1RF1 C;  1YIT P;  5C39 A;  1NTM E;  2B9B A;  1NVO A;  1M57 D;  1EZV D;  5CBO A;  5KLI C;  3RK2 B;  2HFE D;  1RE4 A;  2AXT H;  1H88 A;  1BSN A;  4I7Z B;  1RE4 C;  3SWK A;  3A2A A;  3Q5P A;  4HM5 A;  1YIJ P;  4EI2 A;  3OJA B;  4HM7 A;  3R4Y A;  5AW0 B;  1VQP P;  1PPJ G;  1S4X A;  1JCD A;  1JY2 N;  5AVY B;  2OGU A;  2KI7 B;  2H7H A;  3AEE C;  1A02 J;  2WMM A;  3TDK A;  1KQG B;  2XZR A;  2N9Y B;  2W90 A;  2OAR A;  3L37 A;  2WWW A;  1HJ0 A;  1BE3 G;  1CW5 A;  1Q82 Q;  2IBZ E;  3FX0 A;  3MUD C;  3RBX A;  4D6T G;  1AVY A;  4AUW A;  4L74 A;  5TIS H;  1GW4 A;  1NTM K;  2P1J A;  4Y99 B;  3QH9 A;  1YHQ P;  3E1R A;  1L0L J;  3L72 G;  3L73 G;  4C7N B;  2OYI C;  3HE5 A;  1BDD A;  3K5B A;  2OYI A;  5CJ4 A;  5M1B A;  3L75 D;  1LTG C;  2FYU J;  2HOD A;  1SQB E;  1EXJ A;  1JTH B;  4OGQ B;  1JCC A;  3WU2 E;  3CWB J;  4LGD E;  3CX5 H;  4H0L C;  5B66 H;  4NBH D;  4PV1 D;  1SQP E;  3H1K J;  3VMA A;  4UB8 E;  1SQB K;  2XSH A;  2E75 D;  1DD3 A;  1LT9 C;  3VOP A;  1KOR A;  3V2N A;  4D6T D;  2XV5 A;  5GTI E;  4WBA A;  1N8R Q;  1S9K E;  1ZLL A;  1GZL A;  1IZN B;  2K3R A;  2KK7 A;  2GUS A;  3TGU E;  3ZDM A;  5BVZ A;  1VM9 A;  2BCC J;  4NBE D;  1J1D C;  5CXM A;  2Z4E A;  3RL0 D;  5AW1 B;  1WMK A;  3M0D C;  1X79 B;  3RL0 B;  2QJP B;  4L75 A;  4EYY Q;  2KS1 B;  3BVH A;  3A3Y B;  4I7Z C;  4HKV A;  3WUU A;  3MZW B;  2PRR A;  1H0T B;  1FAV A;  5AVX B;  3HE5 B;  1H8A A;  3MIW A;  2IBZ G;  2E42 A;  1SQB D;  4IL6 H;  3H32 B;  1BE3 E;  1W5C E;  5CJ0 A;  3RK2 D;  3V2R A;  3VYI A;  5AVS B;  2HPC A;  3PJS K;  3H1I D;  2AXC A;  3L70 D;  4DOJ A;  1L0L E;  1AVO A;  2XDJ A;  1MUU A;  2J59 M;  3BAT A;  3H1L D;  5APQ A;  2ZJS E;  3AZC A;  2WT7 A;  3VMX A;  2BEZ F;  5EFW B;  1VQ7 P;  2HMO A;  1M56 D;  2BEQ D;  2MJZ A;  4QDF A;  3GL0 A;  2FYU G;  3MTU E;  2ZYG A;  2XR8 A;  2Q7C A;  2YFL A;  1GTW A;  1LTA C;  2NUK A;  3IFM A;  4QUP A;  1X8Y A;  3L73 J;  3H1J J;  3L71 J;  1RY3 A;  2FYU K;  1N73 C;  2L91 A;  3GKE A;  3P8M C;  3H1J G;  1K05 A;  4JPZ B;  1SQB G;  1SQQ G;  1G1I A;  1SVF A;  2M5A B;  3H1J E;  1RE3 C;  2WPV B;  1URQ C;  3H1H G;  3I5C A;  3RL0 C;  1VF5 B;  1BCC E;  2K37 A;  4OWF A;  2R44 A;  1NKN A;  1JB0 J;  4OGQ C;  5KJ7 C;  1BE3 J;  1KB9 D;  4I6M C;  1VQ8 P;  2FYZ A;  3ABV C;  5APX A;  2A06 G;  2E76 B;  2P10 A;  3T97 A;  3P8C E;  3KPE A;  1L0N E;  2XKM A;  3M91 A;  2Q9I A;  4QDF B;  1N86 A;  2IZ1 A;  3H1K G;  4KJM A;  2W6J H;  4C46 A;  3MUD A;  4L73 A;  2AEF A;  2IYP A;  2Z5H A;  2D2C C;  3FWN A;  3KZI H;  1AQ5 A;  3B5N D;  1QX8 A;  3AEC C;  1LWU A;  4K35 A;  2Y0E A;  3L72 J;  3CWB D;  1KIL B;  3FWL A;  2CK3 H;  2JP3 A;  1T2K D;  3VP9 A;  4MN4 C;  2BCC E;  3PH0 A;  2WSC H;  2PP6 A;  3IN6 A;  5GTH H;  1ULI A;  2QJP C;  2YMY A;  2FFD A;  3B5N A;  2JEE A;  1JY2 O;  1LTI C;  1LTT C;  4GDO A;  2POH A;  3UIA A;  3BCC E;  2O1K A;  5GTI H;  2K9Y A;  4WWI A;  4QUR A;  1BGY E;  1KYO H;  2OYH B;  2YFI A;  1L0N J;  2Y9Z A;  1GD2 E;  2XNX A;  2HPC B;  1NTK E;  1T3U A;  2E76 C;  1OW7 A;  3LID A;  1FOS F;  1KMI Z;  3IR9 A;  1T6A A;  1YJ9 P;  1S5L H;  3RL0 g;  1G8J B;  1EXI A;  3GZX A;  2SPZ A;  1USE A;  1VQM P;  4GT1 A;  3AE7 C;  3V4Q A;  3VMG D;  2KS1 A;  5GTH E;  1KQL A;  3U1A A;  2G8Y A;  3M9H A;  1IJD B;  1KV4 A;  2FYN C;  2ZYA A;  2JDI H;  3LW5 H;  1EZV G;  3LW5 J;  1BDC A;  1ULJ A;  3RK3 B;  4I1L A;  1Q90 D;  4HB1 A;  3TK1 A;  5CBN A;  1URQ B;  4EIJ A;  3CXH D;  2C0X A;  4GOF A;  1PGJ A;  3KXD A;  3M0A A;  2B88 A;  1M1J A;  3G3Z A;  4U7J A;  1M8O B;  3G4S P;  3RK3 C;  1NU1 E;  1SQB J;  3ITK A;  4U3F J;  4RO0 A;  1AV1 A;  1L4A C;  2M5A A;  4WVZ A;  1H89 A;  2BMQ A;  4NBC D;  1Y9B A;  3GCE A;  2FYU D;  3SFE C;  2I7F A;  3Q5R A;  3AEG C;  2GUV A;  1PPJ E;  5AW4 B;  2LXB A;  3PRJ A;  5KLV K;  2ZT9 B;  1DX7 A;  1IO4 A;  5TIS E;  2NPS B;  1SQX G;  3OW2 O;  3GMA A;  1XTC C;  3A0B E;  4HM6 A;  2ZT9 D;  2IBZ I;  1K04 A;  1PGQ A;  2K9J B;  1CI6 A;  4WB4 A;  3W68 A;  1EQ7 A;  1N73 B;  2CKF A;  1A02 F;  4PD4 H;  5BU5 A;  3B4S A;  1P84 E;  2NVF A;  1EDL A;  3M06 A;  4XA4 A;  5KKZ C;  2FKW B;  1HVV A;  1S72 P;  1E5W A;  1KIL E;  1HUC A;  4NPE A;  5K5G B;  1GDT A;  1Z56 A;  1K8A Q;  2O1J A;  4QDC A;  1PV3 A;  5AW8 B;  2E76 D;  2QPZ A;  2C0W A;  3VTP C;  3GLM A;  1PP9 D;  1SQX D;  2FYU E;  2NPS A;  4RKU J;  3VMZ A;  1O7P A;  1JY3 N;  3AEA C;  2J58 A;  2H89 C;  1CI6 B;  1NTK K;  2JZA A;  4TT3 H;  3L73 D;  5E79 H;  3GF7 A;  1NWQ A;  1PFI A;  1PP9 E;  1SP4 A;  4JF7 A;  4HM1 A;  1T2K C;  2CPB A;  3GHG C;  3NFQ A;  2KNC B;  2K88 A;  4KHX A;  2V7Q H;  1ZP0 C;  4YXW H;  2B1X A;  5CMZ A;  1PIX A;  4M3L A;  2JO1 A;  2JWA A;  1NHL A;  1YTZ T;  5APV A;  3CCE P;  3CX5 E;  4BXL A;  1KFM A;  3EQ2 A;  3BRV B;  4IFD K;  4H13 C;  1L0L G;  1L4A B;  1IK9 A;  3HTK B;  1L0N D;  2ZXE B;  1HGZ A;  3H1L G;  1LNQ A;  2KUB A;  1OIP A;  4AIV A;  4HM8 A;  4D6T J;  3CC7 P;  3II6 A;  3CC2 P;  3JSV C;  1GW3 A;  3G71 P;  1JOC A;  2LXC B;  1LTJ B;  3I56 P;  3G6E P;  5CHX A;  2N1T D;  3NTN A;  4K3A A;  1T3J A;  1W2E A;  4WY4 D;  2I8D A;  2KOG A;  1LP1 A;  1JY2 P;  3G9R A;  2HMN A;  1GL2 A;  1YJN P;  3H32 A;  1R5L A;  1U7J A;  1P84 H;  2B89 A;  3GTE A;  1ZR4 A;  3B5N C;  1RF0 C;  3L74 D;  1FS0 E;  1L4A A;  5E79 E;  1J2J B;  3NXS A;  1L0N G;  2C9N Y;  2NZ2 A;  2A06 D;  2KSE A;  1Y47 A;  1IFM A;  2O01 N;  1JY3 O;  1N7L A;  1WRG A;  2N1T A;  1HGV A;  1PGO A;  1MV8 A;  1NKZ B;  1KB9 I;  3S9O A;  2WSF H;  4H13 D;  1NTK J;  2E75 C;  1G8K B;  3V6I A;  1O7M A;  1X9V A;  4ZKP A;  1BGY J;  2ZXX A;  1G2C B;  2H88 C;  4H0L D;  2YXR B;  1L0L K;  3D6Z A;  4AAY B;  3H1J D;  3O6Q A;  2IX7 C;  3L75 E;  4QUQ A;  2O01 H;  1GMJ A;  3B8E B;  1Y8A A;  3H1H D;  2WPR A;  2WPS A;  5TJH A;  5HL4 A;  1YJW P;  3H25 A;  4PD4 D;  1GL2 D;  3F5H A;  1VQ6 P;  1S1C X;  3A7O A;  3BRT B;  3RBZ A;  3L75 G;  3GOB A;  1FZE A;  2YFJ A;  1N7S B;  4R4L A;  1S9K D;  2RKL A;  2NVG A;  2Q3E A;  2VRS A;  1VF5 C;  2IPP A;  1NOH A;  1OMI A;  4TLF A;  2M0B A;  1SLQ A;  4Y28 J;  4ZKU A;  3FXD A;  4H44 B;  4BRY B;  1GK4 A;  1OZH A;  4U3F E;  1HF9 A;  1FDM A;  3AE4 C;  3R2P A;  4RJT A;  4B86 A;  3SWF A;  3FXE A;  1S5L X;  1G2C A;  1L0N K;  1L4A D;  2WZ7 A;  2WIT A;  1SQV G;  2HML A;  3L70 E;  4QCK A;  2E74 C;  2YVJ B;  1JY3 P;  1HWT C;  1FJK A;  5B5E E;  3TSI A;  3VMY A;  2BMO A;  1KYO E;  3L71 E;  3MGN A;  2OTL P;  3CMA P;  4C7R A;  3WUV A;  2WTY A;  1MKM A;  3B5N B;  1UII A;  2H8P D;  3L4F A;  1JNM A;  1ZOY C;  4PJ0 H;  2O3J A;  3D89 A;  4ZMD A;  2ZT9 C;  3JCU E;  3E7K A;  1H0T A;  1QGK B;  1GL2 B;  3CL3 D;  1PZQ A;  3P7K A;  1PPJ D;  2QM7 A;  3GZY A;  4PJ0 E;  1VQL P;  2V7Q J;  1PP9 J;  1SQX K;  2JKV A;  2OYO A;  3AE2 C;  1SQQ J;  1KQF B;  2QE7 H;  2OYI B;  1NYH A;  2P67 A;  2JO6 A;  3LIE A;  1D7M A;  5KKZ B;  4JQ0 D;  1LWU C;  2JJL A;  2IZ0 A;  2NVE A;  1Q7Y Q;  4DJG A;  5CCH A;  2DE5 D;  1VCK A;  2FFD C;  4ASW A;  3L74 G;  2W6A A;  4AYC A;  1NU1 J;  3AE5 C;  3H1I E;  1JUN A;  1NDO A;  1KYO I;  3VCP A;  4P1C H;  1ZR2 A;  1PL5 A;  5AVR B;  2KIK A;  2OQQ A;  1OW6 A;  3VMI D;  2W27 A;  1UUV A;  3KZI E;  3MD0 A;  4H44 C;  3GTS A;  1SQP J;  3H1K E;  1NTM D;  1LT1 A;  3D6Y A;  1J1E C;  1P84 D;  3M9Q A;  3CME P;  4NBB D;  1ZRT E;  3H6P A;  1BCC D;  2QRX A;  1HJB A;  5CCG D;  4DT0 A;  5L8R J;  3CCM P;  4HJL A;  1FU1 A;  2IDB A;  1FDI A;  4H13 B;  2JWD A;  4HYT B;  4IL6 X;  2WPQ A;  1HBW A;  2QA4 P;  4NB9 D;  5BU8 B;  1SFC D;  2OTJ P;  3CPW O;  3MHV A;  3H1L J;  5AVU B;  1OVR A;  2AXT E;  2FXP A;  1LTJ C;  3CI9 A;  1GL2 C;  1OVU A;  1N7S D;  1LJ2 A;  3TGU J;  3N7N A;  1KIL D;  3H1I G;  1M7L A;  4NBD D;  2Q3I A;  4W7Y A;  5DJU B;  2Q6Q A;  1UIX A;  1LTS C;  3CXH E;  4NBA D;  2WQY C;  1NU1 G;  1VQ5 P;  3OA7 A;  3BCC D;  4UB8 H;  3CXH I;  2WSF J;  1USD A;  5B66 E;  1BE3 D;  3E1I A;  3RK2 C;  1NU1 K;  1EC5 A;  2FFD B;  3H1H J;  1CSB A;  2YIU C;  1Q2N A;  2Q3W A;  1EDJ A;  4EOT A;  2WT7 B;  3AEB C;  1RH5 B;  1SQQ D;  1IK7 A;  2E75 B;  4QMA A;  2IFM A;  1LTB C;  4DZO A;  4IOI H;  2WSE J;  1M90 Q;  2E74 D;  4N78 E;  1NTZ D;  3CC4 P;  3L72 D;  2A06 E;  1M1K Q;  4BRY A;  4WY4 C;  4N6J A;  2HR3 A;  3EWK A;  3PLN A;  1X0T A;  3HUS C;  1BSH A;  3CX5 I;  3HE4 A;  1EZV E;  4A7P A;  2ZYD A;  1FZC B;  5CCH C;  4ASV A;  4NPF X;  5CCG A;  2I1J A;  1O7G A;  1GK6 A;  1Q81 Q;  2W6B A;  3L71 D;  2G3A A;  3AED C;  1FQT A;  2QIW A;  2WVR A;  5AVW B;  4EDF A;  1KIL A;  2QM8 A;  1YTZ I;  2GBX A;  3L70 J;  2ZVN B;  1L2P A;  3GHG A;  3Q3D A;  5KLV D;  3CWB E;  2A45 H;  2CPS A;  4D6T E;  2BCC G;  1VQ9 P;  1BCC J;  5AVV B;  2UWJ E;  1VQK P;  3SFD C;  2HG5 D;  1KC8 Q;  4L76 A;  4W7Z A;  5APW A;  1RIE A;  1SS1 A;  1RE3 A;  1IFN A;  2H43 A;  2R5D A;  2HOD B;  2BAS A;  2YO2 A;  5AVQ B;  4DCK A;  4WY4 B;  2HMJ A;  5CCH D;  3U1C A;  2KSJ A;  1IFD A;  3CCL P; 
#chains in the Genus database with same CATH homology
 1UUW A;  5HL4 A;  1L0N E;  2NWF A;  5KKZ C;  3GZY A;  4HJL A;  2XSO A;  2FYN C;  4QDF B;  2HMM A;  2NUM A;  4HKV A;  2E74 D;  3FOU A;  3GOB A;  4P1B H;  2IBZ E;  2QJK C;  2B24 A;  2DE7 D;  4HM2 A;  4NB9 D;  1ULJ A;  2E4Q A;  2YFJ A;  2A06 E;  2D2C D;  2NVG A;  4NBF D;  3N0Q A;  4QDC A;  2E76 D;  3VCA A;  2JO6 A;  4QDD A;  2QPZ A;  1BE3 E;  3VMH D;  2BMR A;  1SQV E;  1SQX E;  3H1L E;  1EZV E;  2E4P A;  5AEW A;  2HMN A;  2FYU E;  2ZYL A;  1L0L E;  1O7W A;  1VF5 D;  2NVE A;  2BCC E;  3DQY A;  1O7P A;  2DE5 D;  1VCK A;  1NU1 E;  4PD4 E;  1O7G A;  2XRX A;  1SJG A;  3GL2 A;  1Q90 C;  3GTE A;  1ULI A;  2QJP C;  3AZC A;  4U3F E;  2QJY C;  4HM3 A;  1SQB E;  1JM1 A;  2HMO A;  2GBW A;  2JZA A;  1FQT A;  5BOK A;  4HM0 A;  4NBD D;  4QDF A;  3GL0 A;  1RFS A;  4NBC D;  2BMQ A;  2XR8 A;  1NTM E;  1KB9 E;  2GBX A;  1PP9 E;  3H1I E;  2YFL A;  2HML A;  3BCC E;  3GCE A;  2NUK A;  3CWB E;  3L70 E;  1NDO A;  4HM1 A;  4QCK A;  5KLI C;  3VCP A;  4P1C H;  3CXH E;  2YVJ B;  3H1H E;  4QUP A;  2I7F A;  4NBH D;  4NBA D;  1O7H A;  4QUR A;  4PV1 D;  1SQP E;  1BGY E;  4D6T E;  4EMJ B;  1SQQ E;  1PPJ E;  2YFI A;  5KLV E;  2B1X A;  4H13 D;  3VMI D;  3GKE A;  2XSH A;  2E75 D;  1UUV A;  2BMO A;  1G8K B;  1KYO E;  1O7M A;  1NTK E;  3L71 E;  3L74 E;  4HM5 A;  3GTS A;  2HMK A;  3H1K E;  4HM8 A;  4OGQ D;  4NBG D;  4NB8 D;  3CX5 E;  3H1J E;  3L72 E;  1O7N A;  4HM7 A;  1RIE A;  4H0L D;  1BCC E;  2YIU C;  2Q3W A;  1NTZ E;  1G8J B;  3EQQ A;  3GB4 A;  4HM6 A;  3GZX A;  2ZT9 D;  4AAY B;  4NBB D;  3D89 A;  1WQL A;  2DE6 D;  3TGU E;  3C0D A;  1ZRT E;  2CKF A;  4H44 D;  3L75 E;  4HM4 A;  4QUQ A;  3VMG D;  1VM9 A;  4NBE D;  2HMJ A;  4AIV A;  3EN1 A;  1EG9 A;  5CXM A;  5AEU A;  1P84 E;  2NVF A;  3L73 E;  1NYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...