1NTZE

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntzE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntzE02
4AIVA 3CXHE 3AZCA 3L73E 1Q90C 4QUQA 2HMLA 2I7FA 2XSHA 4HM1A 2NVEA 1BE3E 1P84E 3GOBA 4QDFA 4OGQD 2E4PA 3CWBE 2FYNC 5KKZC 2QJPC 2YIUC 4HM2A 1NTKE 3L71E 2B24A 4H0LD 3L70E 4NBBD 4HM6A 4NBGD 4H13D 5AEUA 2E74D 2GBXA 2XRXA 4HM7A 3TGUE 2NVFA 4QDFB 2GBWA 2HMOA 1BCCE 2HMJA 3GKEA 3DQYA 1SJGA 4HJLA 1VF5D 1SQXE 2XSOA 5KLVE 4PD4E 3L74E 2BMQA 4HM5A 4NB8D 3VMHD 2FYUE 2D2CD 5KLIC 4AAYB 2QJKC 4P1CH 1PP9E 1UUWA 2NVGA 5BOKA 3EQQA 4NB9D 4D6TE 1JM1A 4NBHD 3VCAA 1SQPE 1O7HA 1BGYE 4P1BH 2HMNA 1O7NA 3GB4A 3BCCE 1EG9A 2YVJB 3GTSA 1KYOE 3L75E 4NBCD 1ZRTE 4NBAD 4U3FE 1VM9A 1NYKA 2YFJA 3D89A 3H1HE 4NBDD 1G8KB 2E4QA 4H44D 1NDOA 2Q3WA 2YFLA 4NBED 4PV1D 5HL4A 3VCPA 2B1XA 1O7WA 3N0QA 4QDCA 1O7GA 1ULIA 4QCKA 3H1IE 3EN1A 4HKVA 1NU1E 4HM3A 1VCKA 1SQVE 2E75D 1SQBE 1NTZE 2IBZE 3GZYA 3C0DA 1WQLA 3GTEA 3GCEA 2DE6D 2XR8A 2JZAA 4QUPA 4QDDA 2QPZA 3FOUA 1KB9E 2NWFA 1L0LE 5CXMA 4HM0A 2YFIA 3H1JE 1G8JB 3VMID 3GL0A 2NUKA 3L72E 1O7PA 2HMKA 4EMJB 4QURA 1SQQE 2JO6A 2CKFA 2BMRA 1FQTA 4NBFD 2E76D 1O7MA 1RFSA 4HM8A 2DE7D 1L0NE 2BMOA 2HMMA 3GZXA 3GL2A 1NTME 1EZVE 1ULJA 1UUVA 3VMGD 2DE5D 3CX5E 3H1KE 2QJYC 1RIEA 2BCCE 4HM4A 3H1LE 2ZYLA 2NUMA 5AEWA 2ZT9D 2A06E 1PPJE
chains in the Genus database with same CATH superfamily
3B5NA 3H1JJ 1Q82Q 2KS1B 1NTMG 4HKZH 2LXCB 4W7ZA 1NAFA 3M9QA 1OVVA 1L0NJ 2R44A 5KKZC 3B5NB 3E7KA 1X0TA 3GHGC 1SQBJ 1PPJG 1VF5B 4HM7A 2WSEH 1HJBA 1U7MA 1S5LH 2R32A 4WBAA 1EXJA 2A06D 1JB0J 2JP3A 4HB1A 4ZNCA 1LTIC 3O8ZA 1D7MA 4GODA 3EQQA 1JM1A 3L70J 1BSNA 5AVSB 2RMZA 2YNYA 2KIKA 3H1HD 1BCCJ 1N73C 3N0QA 1GD2E 3QWOC 4PD4D 4R4LA 4W80A 3L74J 3LIDA 1OW6A 1T3UA 2QSIA 3HUSC 3CC7P 1J1EC 3AE1C 2OYIA 2JEEA 1KB9E 3Q5RA 2NWFA 1L0LE 2HLOA 3A0HH 3CMEP 1TU3F 4NBFD 4RKUJ 3P32A 1FZEA 4KT0J 3PHLA 2OYIB 1HUCA 1YQ4C 1NU1J 2ITAA 3AEAC 5BU8B 1SQVD 4TLFA 1JO5A 2HODA 2P1JA 4UB8H 1HH0A 3L37A 2NUMA 2ZT9D 1KMIZ 1KV4A 1KN7A 3CCQP 3CXHE 2AEJA 1NTZK 2YXRB 2W6AA 3CX5H 4ZKUA 3GOBA 4C46A 3H1LG 2W6BA 2IFNA 3MIWA 3GHGA 3CMAP 4NBBD 1VQ4P 3D6ZA 2PFXA 2NVFA 2Q6QA 2W90A 2GBWA 1EDIA 5KKZB 1BE3G 2BEQD 3BATA 3GHGB 2YKOA 1IC2A 3MZWB 3V4WA 1DX7A 1EDJA 2HPCA 4NB9D 3Q2YA 2D2CC 2M8RA 3GB4A 1KYOD 1OVRA 2KZIA 2OGUA 4NBAD 1GW4A 3WMM0 3D89A 4NBDD 2HPCB 2E4QA 3E1RA 1N73A 2Q3EA 1QEXA 4DCKA 1ULIA 5KTBA 1M90Q 1VDFA 3L75G 4HM3A 1NAYA 2A45H 2Z5IA 4ASWA 1N73B 1PGQA 3FOUA 2E75C 1RQVA 2E43A 5CXMA 2CPBA 1VQPP 3WU2E 1HTLC 1J1EB 3AE9C 3C9IA 1NTZG 1YIJP 1O7MA 4NPDA 4EOTA 1ULJA 4YXWH 4MN4C 3FGAD 1BDCA 1L0LJ 1PPJD 3H1JD 3WUUA 1FJKA 4JYCA 1VQ6P 2BCCG 5M1BA 1LTGC 3CL3D 2B24A 4K3AA 2O1KA 2FXMA 3L73G 4HYTB 5B5EE 5AW0B 3D70A 5KAIE 2D2CD 1PIXA 5KLIC 2WVRA 3IFMA 2C9NY 1BGYE 5CJ4A 1L4AC 4U3FE 2KP8A 1NYKA 2QM7A 3OA7A 3H1HE 2KLUA 5GTIH 2E5YA 4JYBA 2D2CB 1O7WA 1VQ8P 1AQ5A 1LNQA 2IDBA 3HD7C 2FBWC 4QCKA 2E75D 1K8AQ 5AVTB 1W2EA 1Q7YQ 1MFZA 1UIXA 4JPZB 1ZXGA 3G4SP 3B8EB 3W67A 3KZIE 1VPCA 2Q7CA 1M1KQ 2E75B 2HMMA 4HM8A 2AXCA 4IFFA 1NU1D 2MJZA 3VMGD 2YMKA 3LW5H 1HWTC 3L72G 3H1LD 2YKQA 1LTSC 5H2FE 3WU2H 3RL0C 2R5DA 3LW5J 3D71A 1BE3D 1AQTA 1MKMA 3SFEC 1LJ2A 2Q3IA 1HVVA 4H13C 1SQXE 2K9YA 3ABVC 3OJAB 4BXLA 3L36A 4LC1A 1OX3A 2FYUE 2FFDC 3I56P 1XTGB 1FZAA 4RJTA 3NXSA 3R2PA 1PP9E 5AW9B 3TYYA 1LTBC 1L4AD 1H8AA 2O01N 1O7HA 4TT3H 1VQLP 5B5EH 1L4AA 1KYOE 5AW2B 5KLIB 1YJNP 3JCUE 2JR8A 1DD3A 5KAIH 3HD7D 2KUBA 5KJ7C 4OVNF 2PAJA 3HD7A 1NTKK 1L4AB 1P84I 3BCCG 2O01H 4GKGA 3VP8A 5CCGC 1NTZD 4WB4A 1BGYJ 1X9VA 3HD7B 2O01J 1DIPA 2A45I 5AVRB 4IL6E 2KSJA 1LGHB 4PD4H 2P2UA 4XA4A 1FAVA 3H1HJ 3IN6A 2CKFA 1USEA 1RH5B 2QEXP 2OYOA 1KZUB 1KTMA 4IOIH 3CC2P 3AE5C 1GL2C 1H88A 2M0BA 1NTME 3TSIA 2OTLP 1PFIA 2E76C 2DE5D 3RL0D 1YHQP 3GW6A 2BCCD 1SQQG 1SQXK 2ZYLA 1KB9D 3KZIH 1FDMA 1PPJE 2FYUK 3A2AA 1MZ9A 1Q90C 2H88C 4QUQA 2J5UA 2C9LY 1VL2A 3RL0B 1S4XA 4DT0A 1X8YA 1QVFO 1Y9BA 1Q86Q 4EIJA 1VQMP 5AW1B 4NBGD 4H13D 5AEUA 2XRXA 1IFDA 2FXOA 3A5TA 1SJGA 3II6A 3CXHD 1LT1A 1USDA 3AE4C 1NTKG 2FFDA 4AAYB 5BOKA 1EZVI 4H13B 3TGUG 1VQNP 5GTHE 1JTHA 5KJ7D 2FFDB 2QM8A 3FX0A 1VM9A 2L91A 3CCJP 2JWDA 5KJ7A 4WWIA 4LGDE 1OW7A 5CCGD 1SQXJ 3VTPC 1NTMK 1JTHB 4D6TG 2ZFCA 3VMAA 2FYUJ 3SWKA 1MFTA 4L76A 5CCGA 1KQLA 3GMAA 1KYOH 1PP9J 2KI7B 2P67A 3JCUH 1JCCA 1LWUC 4EYYQ 2GA1A 3HTKA 5BU5A 4KHXA 2JDIH 3L72D 2HMKA 1GL2D 3SFDC 2Q9IA 1LTAC 2E76D 1PV3A 2I1JA 1GL2A 1IFJA 2BMOA 3HTKB 5APQA 1CI6B 1FS0E 2QJYC 2HG5D 3H1LE 1Q90D 5AVXB 1YITP 1GL2B 2E76B 3AZCA 2QA4P 3CCEP 1JEKA 1BE3E 1FOSF 2FYNC 5DJTB 2R3SA 1JUNA 1NTMJ 2RN0A 1BDDA 2SPZA 1ZW0A 3Q3DA 1VF5D 3FWLA 5AW6B 1E79H 3CWBG 4N6JA 1VQ7P 2BMQA 1ZV8A 2WWWA 3QH9A 1IFMA 2V7QJ 3SWYA 1ZP0C 4P1BH 3V4QA 3BCCD 3L75E 4NBCD 1ZRTD 5TJHA 3C8VA 3VMXA 5AVQB 1KQSO 1AJYA 2KOGA 4EDFA 4GOEA 1NTZE 1LWUA 3C0DA 1BGYD 1GDTA 4C7RA 4U3FD 2QIWA 4HM0A 3GL0A 2JO6A 1LWUB 4NPFX 5AVWB 1JOCA 4L75A 4PD4I 2FYZA 1SQPK 1RFSA 1R5SA 1IFNA 3VOPA 5CHXA 1FZCC 1NHLA 2BCCE 2XNDH 3M91A 4AIVA 4GIFA 3D6YA 2QJYB 2N9YB 3L73E 1ZR4A 3PJSK 4H0LC 1HGZA 5E79E 1NTKD 3M9BA 1K73Q 2LR2A 2AXTE 4HM6A 1NGMB 4RESB 1NOHA 1U57A 3H1LJ 3TGUD 3HE4A 2XZRA 2FYNB 3GKEA 4JBZA 1R5LA 1OVUA 2M3BA 1YYCA 1T2KC 1BE3J 4P1CH 3HE4B 2YKPA 1KORA 4B86A 4D6TD 1LT9C 1YI2P 1O7NA 3RK2C 2K3RA 1YQ3C 2AEFA 2Q3WA 3S9OA 1SQXD 1GK4A 1SQPG 2FKWB 2FYUD 1O7GA 3CCRP 3IF4A 1PP9D 3MUDC 1FDOA 3GTEA 2XR8A 1RF1C 1M57D 2QPZA 3L75J 4ZKPA 3VMID 3L72E 3ITKA 1MUUA 2PP6A 1SP4A 3AE6C 1SLQA 1FZCA 3A3YB 1N7SC 2W6JH 1ZLLA 2GUSA 3HUSA 1RHZB 1IZNB 1NTZJ 1IO4A 2VRSA 2Q5UA 1YBKA 1FZCB 5APVA 4H0LD 3VMZA 1KFMA 1IK9A 3V6IA 3HUSB 2YO3A 2N1TC 4YXDC 4YTPC 1NTMD 3GLMA 1RQUA 1WRGA 2IBZI 3WUTA 1KB9H 1M1JC 2QVAA 3A7OA 4H0LB 2B88A 2BCCJ 1DEEG 2HMJA 2IYPA 1T2KD 2B87A 2XSOA 2Z5HA 4KJMA 1EDKA 2PRRA 1WMKA 3L73J 3VP9A 3S4RA 2ZYAA 2P10A 4PV1C 2QJKC 3RK2D 2ZXXA 2A45G 1CSBA 5CBOA 1LT9A 3AE2C 1N7LA 3NMDA 2WSFJ 2ZYGA 2B87B 2HMNA 2OQQA 3BCCE 2HR3A 2Y0DA 1ZRTE 3CXHH 5APSA 2V4HA 3L4FA 1LT9B 1QGKB 2JO1A 1NDOA 4OH8B 3S1KA 2B1XA 5APUA 1JY3O 3RK2B 1NJIQ 4GOFA 1RY3A 2JWAA 3U1AA 3F89A 3MUDA 4AUWA 1AVOA 2IZ0A 1GU5A 3I55P 1RF1A 5KLVK 2K9JA 5C39A 3CC4P 5AVVB 2C0WA 2YXQB 2NUKA 1N7SD 1SQQE 1FQTA 1RF1B 1J2JB 3GZXA 1N7SA 1S72P 1S2EA 3EWKA 4L74A 2K9JB 2Q1KA 3RK3C 1RIEA 1N7SB 2CK3H 2N1TD 3L72J 3O6QA 3EQ2A 1EZVG 3BVHA 1GK6A 2OTJP 2FY8A 2XSHA 2N1TA 2NVEA 2KK7A 3H1KG 2RH0A 2M5AA 1NTKE 1M1JA 2HFED 2XKMA 3O6QB 3CCLP 4PJ0E 2N1TB 1RE4C 2WPRA 3TGUE 2WPSA 3M0DC 3VYIA 2FXPA 2M5AB 5AVUB 1LP1A 1M1JB 5CCHC 3L71G 3VMHD 1IJDB 4AYCA 2OARA 2WQYC 3PTZA 4D6TE 3VCAA 1SQPD 3P7KA 3CX5I 1LP1B 3GTSA 2YVJB 4RO0A 3AECC 5KLVG 1SQQK 4PV1B 4XE5B 2QJKB 1OFCX 1G8KB 2K88A 4GT1A 2E5TA 4UB6E 2Y0EA 1ZR2A 2O3JA 1DD4A 4BRYA 4Z1MH 4QUPA 2JJLA 1JY2O 3P8CE 3BCCJ 3L75D 1G8JB 1DEBA 1O7PA 4QURA 4BRYB 1A02F 4CPGA 1YTZT 2ZJSE 3RK3D 2BASA 1GU4A 2W8ZA 1VQOP 2OTKE 1KFNA 2KXPB 3V2RA 5KAFE 2IFMA 4U3FJ 3WUVA 1VQ9P 3RK3B 3AEEC 1SQVK 1SQQJ 3CPWO 2IYOA 2HMLA 4HM1A 1P84D 3CWBE 2CPSA 1L2PA 1Y47A 2A06G 1RE4A 3M0DA 5CCHD 5AW8B 3SSUA 4HJLA 5CCHA 1RE3C 5AVYB 3Q1MA 3L73D 3UIAA 3AEGC 1EXIA 1YJWP 3AE7C 2NPSC 4NBHD 1HGVA 3FWNA 1NTKJ 5H2FH 1W2BO 1OMIA 1RF0C 3TGUJ 5K5GB 3CXHI 2H89C 3G9RA 1W5CE 5BVZA 5DJUB 5CJ0A 1VCKA 1SQBE 4D6TJ 1EC5A 3PH0A 2P7JA 2DE6D 2JZAA 3KXDA 3AEBC 3N4XA 3PLNA 4UB6H 1SS1A 4K35A 4EMJB 3H1IG 5AW7B 1PZQA 2ZXEB 2ZYDA 1S5LE 1SQVG 1FZBA 1UIIA 1K9MQ 2MKVA 3MGNA 3CCUP 1IFPA 2KSEA 4N3YB 2R3CA 3OW2O 1CI6A 1KD1Q 1FC2C 2KB7P 1E5WA 1H0TA 4WY4C 2WTYA 3W68A 4HM2A 2XNXA 1JCDA 2IZ1A 2GM4A 4IL6H 4XFJA 5KAFH 1FDIA 2RKLA 1KQGB 1H0TB 2HMOA 4WVZA 1L0NK 3KQGA 1RE3A 1FZFA 5KLVD 2NPSD 3T97A 3A0HE 1SQBK 3LIEA 4GDOA 1J1DC 2NPSA 1FJPA 3CWBJ 1QX8A 1SQPE 1RF0A 3T97B 2NPSB 2V7QH 1FOSE 2G8YA 2QE7H 2W27A 4I1LA 1EDLA 3AEFC 3GZYA 1WQLA 2IPPA 4QDDA 3BASA 2W83C 3H32A 4Y28J 4DOJA 1JY3N 1KILE 1NKNA 2ZT9C 3B71A 2IBZG 3N7NA 2OYHC 3RK3E 5GTHH 3H32B 3EFGA 2LXBA 3H1JG 3B4SA 1Q81Q 3MHVA 3GG2A 3MD0A 4WY4D 1L0NG 4U7JA 1NU1K 2WSEJ 1SQQD 3PP5A 4QMAA 4WY4A 1SQBG 1P84E 3CLQA 1QL2A 1OWAA 3OAKA 4O9BA 3HRNA 4WY4B 1HJ0A 2NZ2A 3DQYA 1QL1A 3KPEA 4L73A 2E74C 2BEZF 4NB8D 2WZ7A 1QVGO 3L70G 3RL0g 2ZVNB 2ZAEB 1BCCG 4C7NA 2H8PD 1X79B 2DW3A 3H6PA 3L74G 1J1DB 4DJGA 1NKZB 1ZOYC 4C7NB 1FBMA 3H1ID 4I7ZC 1EQ7A 1SQPJ 3AE3C 1PGPA 3R4YA 3NFQA 4R4MA 3F5HA 1NU1G 2BMRA 2HODB 3SWFA 2OYHA 1ZMEC 2QG4A 3IR9A 3PRJA 3CD6P 1EZVE 1UUVA 2J58A 5CBNA 1JY2N 3H1KE 2ZT9B 4HM4A 4I6MC 2OYHB 1KYOI 3P8CD 3TDKA 3V2QA 5AEWA 4IL6X 5CMZA 1FU1A 4DZOA 4I2LC 4W7YA 3Q5PA 5GTIE 2UWJE 2YIUC 1L0LK 3L71E 2ZVOB 1OZHA 2E74D 4NPEA 1P84H 3I5CA 1S3JA 1OXZA 5KLVE 2IX7C 3GF3A 4HM5A 2XV5A 3H25A 3AEDC 1Z56A 2N9BA 1T6AA 3GF7A 3USSA 1S9KD 2NVGA 3CWBD 3G3ZA 4AQRD 2E74B 2XU6A 1NVOA 5AW3B 4LLHA 2YFJA 2WSSH 1JMMA 4OWFA 2I1KA 5E79H 4N78D 2WSFH 3V5BA 4H44C 4HKVA 1URQC 2AXTH 1G2CA 1DH3A 4JQ0D 2IBZD 3BRTB 1GTWA 3KYQA 4A7PA 1XTCC 4I7ZB 2WT7A 1G2CB 4Y99C 1OW8A 1S5LX 4EI2A 2Y0CA 1L0ND 3TF5A 3FXEA 1VQ5P 2O1JA 1G1JA 1PL5A 1L0LG 2WT7B 2POHA 1SQBD 2J59M 2YO2A 5AVZB 2KLVA 1Q2NA 2A06E 3Q5SA 2LKMA 3A0BE 2K1AA 1VQKP 1SFCC 2L5GB 3EFFK 2HYNA 1KILC 1K05A 3L70D 2Y9YA 1FE6A 2YMYA 3H1KJ 4OGQC 1YJ9P 1X22A 2WSCH 1BSHA 1BCCD 2YIUB 1NH4A 2WPVB 2NRGA 4PD4E 1FZGA 3L74D 3P8MC 2WSCJ 3CCMP 5EFWB 3G6EP 2QRXA 1N86A 3L71J 1EG9A 1AA0A 1LTTC 2KZJA 2Y9ZA 4H44D 4PV1D 1M56D 1URQD 1Y8AA 1PGOA 2C0XA 5KLVJ 3H1IE 1URQA 1SQVE 1CZQA 3KDPB 2Z4EA 2K37A 4H44B 1R8EA 3MTUE 1URQB 2YFIA 3CI9A 4M3LA 3VMYA 1JNMA 2DE7D 1MV8A 3C1LA 1H89A 4Y99B 1T8ZA 3CX5D 3HE5A 4BWNA 3MP7B 1IK7A 1JY3P 1SFCD 1M8OB 1AV1A 4IFMA 1SFCA 1WT6A 3JSVC 3HE5B 1KILD 5APWA 2I7FA 3AE8C 2B9BA 1SVFA 2WMMA 4OGQD 2E4PA 1KILA 4YPCA 2QJPC 3TNUA 1SFCB 2WITA 2GBXA 3A0BH 1OIPA 3G71P 2KNCA 1KILB 1T3JA 4OGQB 3TNUB 2WPQA 4JF7A 1LTJC 1NO4A 1S9KE 2KNCB 2H43A 5TISE 3M0AA 2GUVA 3K5BA 3V2PA 1KB9I 5APXA 3KHUA 1CW5A 5L8RJ 1AVYA 4ASVA 3U1CA 4NBED 1G1IA 4N78E 4QDCA 1BGYG 2E42A 1HBWA 2B89A 4PJ0H 4U3FG 2IBZE 5APTA 5B66E 1YTZI 3V2NA 3H1HG 2AEMA 1AFOA 1L0LD 1GW3A 2XDJA 2G3AA 3H1JE 1HF9A 3RBXA 2JKVA 1L0NE 2PGDA 1JM0A 1PGJA 3TK1A 3GL2A 3H1IJ 1S1CX 2P58A 1SQVJ 1KC8Q 4IFDK 5AW5B 1GZLA 1NYHA 1U7JA 3B5NC 2KYVA 1VF5C 1JY2P 4QDFA 3BRVB 1EZVD 3L70E 4ZMDA 3RGUA 5APYA 3H1KD 1NWQA 3FXDA 4QDFB 1BCCE 3JC22 2QJPB 1GMJA 1ZN5A 4HJGH 3L74E 3IAOA 1LTJA 1JMBA 1UUWA 1K04A 3L35A 3L71D 1M7LA 3ZDMA 3E1IA 1SQXG 1LTJB 1IFIA 2FYUG 2YFLA 1PP9G 3VCPA 5HL4A 3RBZA 3VN0A 1A02J 5TISH 3M9HA 3EN1A 1NU1E 3M06A 2H7HA 5AW4B 4HH2A 3GCEA 3CCVP 1QLED 1N2DC 2OYIC 4UB8E 2M3EA 3NTNA 2R5BA 3U59A 2I8DA 5B66H 2KS1A 3CX5E 1N8RQ 3B5ND 1KQFB 3CCSP
chains in the Genus database with same CATH topology
4AIVA 3CXHE 3AZCA 3L73E 1Q90C 4QUQA 2HMLA 2I7FA 2XSHA 4HM1A 2NVEA 1BE3E 1P84E 3GOBA 4QDFA 4OGQD 2E4PA 3CWBE 2FYNC 5KKZC 2QJPC 2YIUC 4HM2A 1NTKE 3L71E 2B24A 4H0LD 3L70E 4NBBD 4HM6A 4NBGD 4H13D 5AEUA 2E74D 2GBXA 2XRXA 4HM7A 3TGUE 2NVFA 4QDFB 2GBWA 2HMOA 1BCCE 2HMJA 3GKEA 3DQYA 1SJGA 4HJLA 1VF5D 1SQXE 2XSOA 5KLVE 4PD4E 3L74E 2BMQA 4HM5A 4NB8D 3VMHD 2FYUE 2D2CD 5KLIC 4AAYB 2QJKC 4P1CH 1PP9E 1UUWA 2NVGA 5BOKA 3EQQA 4NB9D 4D6TE 1JM1A 4NBHD 3VCAA 1SQPE 1O7HA 1BGYE 4P1BH 2HMNA 1O7NA 3GB4A 3BCCE 1EG9A 2YVJB 3GTSA 1KYOE 3L75E 4NBCD 1ZRTE 4NBAD 4U3FE 1VM9A 1NYKA 2YFJA 3D89A 3H1HE 4NBDD 1G8KB 2E4QA 4H44D 1NDOA 2Q3WA 2YFLA 4NBED 4PV1D 5HL4A 3VCPA 2B1XA 1O7WA 3N0QA 4QDCA 1O7GA 1ULIA 4QCKA 3H1IE 3EN1A 4HKVA 1NU1E 4HM3A 1VCKA 1SQVE 2E75D 1SQBE 1NTZE 2IBZE 3GZYA 3C0DA 1WQLA 3GTEA 3GCEA 2DE6D 2XR8A 2JZAA 4QUPA 4QDDA 2QPZA 3FOUA 1KB9E 2NWFA 1L0LE 5CXMA 4HM0A 2YFIA 3H1JE 1G8JB 3VMID 3GL0A 2NUKA 3L72E 1O7PA 2HMKA 4EMJB 4QURA 1SQQE 2JO6A 2CKFA 2BMRA 1FQTA 4NBFD 2E76D 1O7MA 1RFSA 4HM8A 2DE7D 1L0NE 2BMOA 2HMMA 3GZXA 3GL2A 1NTME 1EZVE 1ULJA 1UUVA 3VMGD 2DE5D 3CX5E 3H1KE 2QJYC 1RIEA 2BCCE 4HM4A 3H1LE 2ZYLA 2NUMA 5AEWA 2ZT9D 2A06E 1PPJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIV A;  3CXH E;  3AZC A;  3L73 E;  1Q90 C;  4QUQ A;  2HML A;  2I7F A;  2XSH A;  4HM1 A;  2NVE A;  1BE3 E;  1P84 E;  3GOB A;  4QDF A;  4OGQ D;  2E4P A;  3CWB E;  2FYN C;  5KKZ C;  2QJP C;  2YIU C;  4HM2 A;  1NTK E;  3L71 E;  2B24 A;  4H0L D;  3L70 E;  4NBB D;  4HM6 A;  4NBG D;  4H13 D;  5AEU A;  2E74 D;  2GBX A;  2XRX A;  4HM7 A;  3TGU E;  2NVF A;  4QDF B;  2GBW A;  2HMO A;  1BCC E;  2HMJ A;  3GKE A;  3DQY A;  1SJG A;  4HJL A;  1VF5 D;  1SQX E;  2XSO A;  5KLV E;  4PD4 E;  3L74 E;  2BMQ A;  4HM5 A;  4NB8 D;  3VMH D;  2FYU E;  2D2C D;  5KLI C;  4AAY B;  2QJK C;  4P1C H;  1PP9 E;  1UUW A;  2NVG A;  5BOK A;  3EQQ A;  4NB9 D;  4D6T E;  1JM1 A;  4NBH D;  3VCA A;  1SQP E;  1O7H A;  1BGY E;  4P1B H;  2HMN A;  1O7N A;  3GB4 A;  3BCC E;  1EG9 A;  2YVJ B;  3GTS A;  1KYO E;  3L75 E;  4NBC D;  1ZRT E;  4NBA D;  4U3F E;  1VM9 A;  1NYK A;  2YFJ A;  3D89 A;  3H1H E;  4NBD D;  1G8K B;  2E4Q A;  4H44 D;  1NDO A;  2Q3W A;  2YFL A;  4NBE D;  4PV1 D;  5HL4 A;  3VCP A;  2B1X A;  1O7W A;  3N0Q A;  4QDC A;  1O7G A;  1ULI A;  4QCK A;  3H1I E;  3EN1 A;  4HKV A;  1NU1 E;  4HM3 A;  1VCK A;  1SQV E;  2E75 D;  1SQB E;  1NTZ E;  2IBZ E;  3GZY A;  3C0D A;  1WQL A;  3GTE A;  3GCE A;  2DE6 D;  2XR8 A;  2JZA A;  4QUP A;  4QDD A;  2QPZ A;  3FOU A;  1KB9 E;  2NWF A;  1L0L E;  5CXM A;  4HM0 A;  2YFI A;  3H1J E;  1G8J B;  3VMI D;  3GL0 A;  2NUK A;  3L72 E;  1O7P A;  2HMK A;  4EMJ B;  4QUR A;  1SQQ E;  2JO6 A;  2CKF A;  2BMR A;  1FQT A;  4NBF D;  2E76 D;  1O7M A;  1RFS A;  4HM8 A;  2DE7 D;  1L0N E;  2BMO A;  2HMM A;  3GZX A;  3GL2 A;  1NTM E;  1EZV E;  1ULJ A;  1UUV A;  3VMG D;  2DE5 D;  3CX5 E;  3H1K E;  2QJY C;  1RIE A;  2BCC E;  4HM4 A;  3H1L E;  2ZYL A;  2NUM A;  5AEW A;  2ZT9 D;  2A06 E;  1PPJ E; 
#chains in the Genus database with same CATH topology
 3B5N A;  3H1J J;  1Q82 Q;  2KS1 B;  1NTM G;  4HKZ H;  2LXC B;  4W7Z A;  1NAF A;  3M9Q A;  1OVV A;  1L0N J;  2R44 A;  5KKZ C;  3B5N B;  3E7K A;  1X0T A;  3GHG C;  1SQB J;  1PPJ G;  1VF5 B;  4HM7 A;  2WSE H;  1HJB A;  1U7M A;  1S5L H;  2R32 A;  4WBA A;  1EXJ A;  2A06 D;  1JB0 J;  2JP3 A;  4HB1 A;  4ZNC A;  1LTI C;  3O8Z A;  1D7M A;  4GOD A;  3EQQ A;  1JM1 A;  3L70 J;  1BSN A;  5AVS B;  2RMZ A;  2YNY A;  2KIK A;  3H1H D;  1BCC J;  1N73 C;  3N0Q A;  1GD2 E;  3QWO C;  4PD4 D;  4R4L A;  4W80 A;  3L74 J;  3LID A;  1OW6 A;  1T3U A;  2QSI A;  3HUS C;  3CC7 P;  1J1E C;  3AE1 C;  2OYI A;  2JEE A;  1KB9 E;  3Q5R A;  2NWF A;  1L0L E;  2HLO A;  3A0H H;  3CME P;  1TU3 F;  4NBF D;  4RKU J;  3P32 A;  1FZE A;  4KT0 J;  3PHL A;  2OYI B;  1HUC A;  1YQ4 C;  1NU1 J;  2ITA A;  3AEA C;  5BU8 B;  1SQV D;  4TLF A;  1JO5 A;  2HOD A;  2P1J A;  4UB8 H;  1HH0 A;  3L37 A;  2NUM A;  2ZT9 D;  1KMI Z;  1KV4 A;  1KN7 A;  3CCQ P;  3CXH E;  2AEJ A;  1NTZ K;  2YXR B;  2W6A A;  3CX5 H;  4ZKU A;  3GOB A;  4C46 A;  3H1L G;  2W6B A;  2IFN A;  3MIW A;  3GHG A;  3CMA P;  4NBB D;  1VQ4 P;  3D6Z A;  2PFX A;  2NVF A;  2Q6Q A;  2W90 A;  2GBW A;  1EDI A;  5KKZ B;  1BE3 G;  2BEQ D;  3BAT A;  3GHG B;  2YKO A;  1IC2 A;  3MZW B;  3V4W A;  1DX7 A;  1EDJ A;  2HPC A;  4NB9 D;  3Q2Y A;  2D2C C;  2M8R A;  3GB4 A;  1KYO D;  1OVR A;  2KZI A;  2OGU A;  4NBA D;  1GW4 A;  3WMM 0;  3D89 A;  4NBD D;  2HPC B;  2E4Q A;  3E1R A;  1N73 A;  2Q3E A;  1QEX A;  4DCK A;  1ULI A;  5KTB A;  1M90 Q;  1VDF A;  3L75 G;  4HM3 A;  1NAY A;  2A45 H;  2Z5I A;  4ASW A;  1N73 B;  1PGQ A;  3FOU A;  2E75 C;  1RQV A;  2E43 A;  5CXM A;  2CPB A;  1VQP P;  3WU2 E;  1HTL C;  1J1E B;  3AE9 C;  3C9I A;  1NTZ G;  1YIJ P;  1O7M A;  4NPD A;  4EOT A;  1ULJ A;  4YXW H;  4MN4 C;  3FGA D;  1BDC A;  1L0L J;  1PPJ D;  3H1J D;  3WUU A;  1FJK A;  4JYC A;  1VQ6 P;  2BCC G;  5M1B A;  1LTG C;  3CL3 D;  2B24 A;  4K3A A;  2O1K A;  2FXM A;  3L73 G;  4HYT B;  5B5E E;  5AW0 B;  3D70 A;  5KAI E;  2D2C D;  1PIX A;  5KLI C;  2WVR A;  3IFM A;  2C9N Y;  1BGY E;  5CJ4 A;  1L4A C;  4U3F E;  2KP8 A;  1NYK A;  2QM7 A;  3OA7 A;  3H1H E;  2KLU A;  5GTI H;  2E5Y A;  4JYB A;  2D2C B;  1O7W A;  1VQ8 P;  1AQ5 A;  1LNQ A;  2IDB A;  3HD7 C;  2FBW C;  4QCK A;  2E75 D;  1K8A Q;  5AVT B;  1W2E A;  1Q7Y Q;  1MFZ A;  1UIX A;  4JPZ B;  1ZXG A;  3G4S P;  3B8E B;  3W67 A;  3KZI E;  1VPC A;  2Q7C A;  1M1K Q;  2E75 B;  2HMM A;  4HM8 A;  2AXC A;  4IFF A;  1NU1 D;  2MJZ A;  3VMG D;  2YMK A;  3LW5 H;  1HWT C;  3L72 G;  3H1L D;  2YKQ A;  1LTS C;  5H2F E;  3WU2 H;  3RL0 C;  2R5D A;  3LW5 J;  3D71 A;  1BE3 D;  1AQT A;  1MKM A;  3SFE C;  1LJ2 A;  2Q3I A;  1HVV A;  4H13 C;  1SQX E;  2K9Y A;  3ABV C;  3OJA B;  4BXL A;  3L36 A;  4LC1 A;  1OX3 A;  2FYU E;  2FFD C;  3I56 P;  1XTG B;  1FZA A;  4RJT A;  3NXS A;  3R2P A;  1PP9 E;  5AW9 B;  3TYY A;  1LTB C;  1L4A D;  1H8A A;  2O01 N;  1O7H A;  4TT3 H;  1VQL P;  5B5E H;  1L4A A;  1KYO E;  5AW2 B;  5KLI B;  1YJN P;  3JCU E;  2JR8 A;  1DD3 A;  5KAI H;  3HD7 D;  2KUB A;  5KJ7 C;  4OVN F;  2PAJ A;  3HD7 A;  1NTK K;  1L4A B;  1P84 I;  3BCC G;  2O01 H;  4GKG A;  3VP8 A;  5CCG C;  1NTZ D;  4WB4 A;  1BGY J;  1X9V A;  3HD7 B;  2O01 J;  1DIP A;  2A45 I;  5AVR B;  4IL6 E;  2KSJ A;  1LGH B;  4PD4 H;  2P2U A;  4XA4 A;  1FAV A;  3H1H J;  3IN6 A;  2CKF A;  1USE A;  1RH5 B;  2QEX P;  2OYO A;  1KZU B;  1KTM A;  4IOI H;  3CC2 P;  3AE5 C;  1GL2 C;  1H88 A;  2M0B A;  1NTM E;  3TSI A;  2OTL P;  1PFI A;  2E76 C;  2DE5 D;  3RL0 D;  1YHQ P;  3GW6 A;  2BCC D;  1SQQ G;  1SQX K;  2ZYL A;  1KB9 D;  3KZI H;  1FDM A;  1PPJ E;  2FYU K;  3A2A A;  1MZ9 A;  1Q90 C;  2H88 C;  4QUQ A;  2J5U A;  2C9L Y;  1VL2 A;  3RL0 B;  1S4X A;  4DT0 A;  1X8Y A;  1QVF O;  1Y9B A;  1Q86 Q;  4EIJ A;  1VQM P;  5AW1 B;  4NBG D;  4H13 D;  5AEU A;  2XRX A;  1IFD A;  2FXO A;  3A5T A;  1SJG A;  3II6 A;  3CXH D;  1LT1 A;  1USD A;  3AE4 C;  1NTK G;  2FFD A;  4AAY B;  5BOK A;  1EZV I;  4H13 B;  3TGU G;  1VQN P;  5GTH E;  1JTH A;  5KJ7 D;  2FFD B;  2QM8 A;  3FX0 A;  1VM9 A;  2L91 A;  3CCJ P;  2JWD A;  5KJ7 A;  4WWI A;  4LGD E;  1OW7 A;  5CCG D;  1SQX J;  3VTP C;  1NTM K;  1JTH B;  4D6T G;  2ZFC A;  3VMA A;  2FYU J;  3SWK A;  1MFT A;  4L76 A;  5CCG A;  1KQL A;  3GMA A;  1KYO H;  1PP9 J;  2KI7 B;  2P67 A;  3JCU H;  1JCC A;  1LWU C;  4EYY Q;  2GA1 A;  3HTK A;  5BU5 A;  4KHX A;  2JDI H;  3L72 D;  2HMK A;  1GL2 D;  3SFD C;  2Q9I A;  1LTA C;  2E76 D;  1PV3 A;  2I1J A;  1GL2 A;  1IFJ A;  2BMO A;  3HTK B;  5APQ A;  1CI6 B;  1FS0 E;  2QJY C;  2HG5 D;  3H1L E;  1Q90 D;  5AVX B;  1YIT P;  1GL2 B;  2E76 B;  3AZC A;  2QA4 P;  3CCE P;  1JEK A;  1BE3 E;  1FOS F;  2FYN C;  5DJT B;  2R3S A;  1JUN A;  1NTM J;  2RN0 A;  1BDD A;  2SPZ A;  1ZW0 A;  3Q3D A;  1VF5 D;  3FWL A;  5AW6 B;  1E79 H;  3CWB G;  4N6J A;  1VQ7 P;  2BMQ A;  1ZV8 A;  2WWW A;  3QH9 A;  1IFM A;  2V7Q J;  3SWY A;  1ZP0 C;  4P1B H;  3V4Q A;  3BCC D;  3L75 E;  4NBC D;  1ZRT D;  5TJH A;  3C8V A;  3VMX A;  5AVQ B;  1KQS O;  1AJY A;  2KOG A;  4EDF A;  4GOE A;  1NTZ E;  1LWU A;  3C0D A;  1BGY D;  1GDT A;  4C7R A;  4U3F D;  2QIW A;  4HM0 A;  3GL0 A;  2JO6 A;  1LWU B;  4NPF X;  5AVW B;  1JOC A;  4L75 A;  4PD4 I;  2FYZ A;  1SQP K;  1RFS A;  1R5S A;  1IFN A;  3VOP A;  5CHX A;  1FZC C;  1NHL A;  2BCC E;  2XND H;  3M91 A;  4AIV A;  4GIF A;  3D6Y A;  2QJY B;  2N9Y B;  3L73 E;  1ZR4 A;  3PJS K;  4H0L C;  1HGZ A;  5E79 E;  1NTK D;  3M9B A;  1K73 Q;  2LR2 A;  2AXT E;  4HM6 A;  1NGM B;  4RES B;  1NOH A;  1U57 A;  3H1L J;  3TGU D;  3HE4 A;  2XZR A;  2FYN B;  3GKE A;  4JBZ A;  1R5L A;  1OVU A;  2M3B A;  1YYC A;  1T2K C;  1BE3 J;  4P1C H;  3HE4 B;  2YKP A;  1KOR A;  4B86 A;  4D6T D;  1LT9 C;  1YI2 P;  1O7N A;  3RK2 C;  2K3R A;  1YQ3 C;  2AEF A;  2Q3W A;  3S9O A;  1SQX D;  1GK4 A;  1SQP G;  2FKW B;  2FYU D;  1O7G A;  3CCR P;  3IF4 A;  1PP9 D;  3MUD C;  1FDO A;  3GTE A;  2XR8 A;  1RF1 C;  1M57 D;  2QPZ A;  3L75 J;  4ZKP A;  3VMI D;  3L72 E;  3ITK A;  1MUU A;  2PP6 A;  1SP4 A;  3AE6 C;  1SLQ A;  1FZC A;  3A3Y B;  1N7S C;  2W6J H;  1ZLL A;  2GUS A;  3HUS A;  1RHZ B;  1IZN B;  1NTZ J;  1IO4 A;  2VRS A;  2Q5U A;  1YBK A;  1FZC B;  5APV A;  4H0L D;  3VMZ A;  1KFM A;  1IK9 A;  3V6I A;  3HUS B;  2YO3 A;  2N1T C;  4YXD C;  4YTP C;  1NTM D;  3GLM A;  1RQU A;  1WRG A;  2IBZ I;  3WUT A;  1KB9 H;  1M1J C;  2QVA A;  3A7O A;  4H0L B;  2B88 A;  2BCC J;  1DEE G;  2HMJ A;  2IYP A;  1T2K D;  2B87 A;  2XSO A;  2Z5H A;  4KJM A;  1EDK A;  2PRR A;  1WMK A;  3L73 J;  3VP9 A;  3S4R A;  2ZYA A;  2P10 A;  4PV1 C;  2QJK C;  3RK2 D;  2ZXX A;  2A45 G;  1CSB A;  5CBO A;  1LT9 A;  3AE2 C;  1N7L A;  3NMD A;  2WSF J;  2ZYG A;  2B87 B;  2HMN A;  2OQQ A;  3BCC E;  2HR3 A;  2Y0D A;  1ZRT E;  3CXH H;  5APS A;  2V4H A;  3L4F A;  1LT9 B;  1QGK B;  2JO1 A;  1NDO A;  4OH8 B;  3S1K A;  2B1X A;  5APU A;  1JY3 O;  3RK2 B;  1NJI Q;  4GOF A;  1RY3 A;  2JWA A;  3U1A A;  3F89 A;  3MUD A;  4AUW A;  1AVO A;  2IZ0 A;  1GU5 A;  3I55 P;  1RF1 A;  5KLV K;  2K9J A;  5C39 A;  3CC4 P;  5AVV B;  2C0W A;  2YXQ B;  2NUK A;  1N7S D;  1SQQ E;  1FQT A;  1RF1 B;  1J2J B;  3GZX A;  1N7S A;  1S72 P;  1S2E A;  3EWK A;  4L74 A;  2K9J B;  2Q1K A;  3RK3 C;  1RIE A;  1N7S B;  2CK3 H;  2N1T D;  3L72 J;  3O6Q A;  3EQ2 A;  1EZV G;  3BVH A;  1GK6 A;  2OTJ P;  2FY8 A;  2XSH A;  2N1T A;  2NVE A;  2KK7 A;  3H1K G;  2RH0 A;  2M5A A;  1NTK E;  1M1J A;  2HFE D;  2XKM A;  3O6Q B;  3CCL P;  4PJ0 E;  2N1T B;  1RE4 C;  2WPR A;  3TGU E;  2WPS A;  3M0D C;  3VYI A;  2FXP A;  2M5A B;  5AVU B;  1LP1 A;  1M1J B;  5CCH C;  3L71 G;  3VMH D;  1IJD B;  4AYC A;  2OAR A;  2WQY C;  3PTZ A;  4D6T E;  3VCA A;  1SQP D;  3P7K A;  3CX5 I;  1LP1 B;  3GTS A;  2YVJ B;  4RO0 A;  3AEC C;  5KLV G;  1SQQ K;  4PV1 B;  4XE5 B;  2QJK B;  1OFC X;  1G8K B;  2K88 A;  4GT1 A;  2E5T A;  4UB6 E;  2Y0E A;  1ZR2 A;  2O3J A;  1DD4 A;  4BRY A;  4Z1M H;  4QUP A;  2JJL A;  1JY2 O;  3P8C E;  3BCC J;  3L75 D;  1G8J B;  1DEB A;  1O7P A;  4QUR A;  4BRY B;  1A02 F;  4CPG A;  1YTZ T;  2ZJS E;  3RK3 D;  2BAS A;  1GU4 A;  2W8Z A;  1VQO P;  2OTK E;  1KFN A;  2KXP B;  3V2R A;  5KAF E;  2IFM A;  4U3F J;  3WUV A;  1VQ9 P;  3RK3 B;  3AEE C;  1SQV K;  1SQQ J;  3CPW O;  2IYO A;  2HML A;  4HM1 A;  1P84 D;  3CWB E;  2CPS A;  1L2P A;  1Y47 A;  2A06 G;  1RE4 A;  3M0D A;  5CCH D;  5AW8 B;  3SSU A;  4HJL A;  5CCH A;  1RE3 C;  5AVY B;  3Q1M A;  3L73 D;  3UIA A;  3AEG C;  1EXI A;  1YJW P;  3AE7 C;  2NPS C;  4NBH D;  1HGV A;  3FWN A;  1NTK J;  5H2F H;  1W2B O;  1OMI A;  1RF0 C;  3TGU J;  5K5G B;  3CXH I;  2H89 C;  3G9R A;  1W5C E;  5BVZ A;  5DJU B;  5CJ0 A;  1VCK A;  1SQB E;  4D6T J;  1EC5 A;  3PH0 A;  2P7J A;  2DE6 D;  2JZA A;  3KXD A;  3AEB C;  3N4X A;  3PLN A;  4UB6 H;  1SS1 A;  4K35 A;  4EMJ B;  3H1I G;  5AW7 B;  1PZQ A;  2ZXE B;  2ZYD A;  1S5L E;  1SQV G;  1FZB A;  1UII A;  1K9M Q;  2MKV A;  3MGN A;  3CCU P;  1IFP A;  2KSE A;  4N3Y B;  2R3C A;  3OW2 O;  1CI6 A;  1KD1 Q;  1FC2 C;  2KB7 P;  1E5W A;  1H0T A;  4WY4 C;  2WTY A;  3W68 A;  4HM2 A;  2XNX A;  1JCD A;  2IZ1 A;  2GM4 A;  4IL6 H;  4XFJ A;  5KAF H;  1FDI A;  2RKL A;  1KQG B;  1H0T B;  2HMO A;  4WVZ A;  1L0N K;  3KQG A;  1RE3 A;  1FZF A;  5KLV D;  2NPS D;  3T97 A;  3A0H E;  1SQB K;  3LIE A;  4GDO A;  1J1D C;  2NPS A;  1FJP A;  3CWB J;  1QX8 A;  1SQP E;  1RF0 A;  3T97 B;  2NPS B;  2V7Q H;  1FOS E;  2G8Y A;  2QE7 H;  2W27 A;  4I1L A;  1EDL A;  3AEF C;  3GZY A;  1WQL A;  2IPP A;  4QDD A;  3BAS A;  2W83 C;  3H32 A;  4Y28 J;  4DOJ A;  1JY3 N;  1KIL E;  1NKN A;  2ZT9 C;  3B71 A;  2IBZ G;  3N7N A;  2OYH C;  3RK3 E;  5GTH H;  3H32 B;  3EFG A;  2LXB A;  3H1J G;  3B4S A;  1Q81 Q;  3MHV A;  3GG2 A;  3MD0 A;  4WY4 D;  1L0N G;  4U7J A;  1NU1 K;  2WSE J;  1SQQ D;  3PP5 A;  4QMA A;  4WY4 A;  1SQB G;  1P84 E;  3CLQ A;  1QL2 A;  1OWA A;  3OAK A;  4O9B A;  3HRN A;  4WY4 B;  1HJ0 A;  2NZ2 A;  3DQY A;  1QL1 A;  3KPE A;  4L73 A;  2E74 C;  2BEZ F;  4NB8 D;  2WZ7 A;  1QVG O;  3L70 G;  3RL0 g;  2ZVN B;  2ZAE B;  1BCC G;  4C7N A;  2H8P D;  1X79 B;  2DW3 A;  3H6P A;  3L74 G;  1J1D B;  4DJG A;  1NKZ B;  1ZOY C;  4C7N B;  1FBM A;  3H1I D;  4I7Z C;  1EQ7 A;  1SQP J;  3AE3 C;  1PGP A;  3R4Y A;  3NFQ A;  4R4M A;  3F5H A;  1NU1 G;  2BMR A;  2HOD B;  3SWF A;  2OYH A;  1ZME C;  2QG4 A;  3IR9 A;  3PRJ A;  3CD6 P;  1EZV E;  1UUV A;  2J58 A;  5CBN A;  1JY2 N;  3H1K E;  2ZT9 B;  4HM4 A;  4I6M C;  2OYH B;  1KYO I;  3P8C D;  3TDK A;  3V2Q A;  5AEW A;  4IL6 X;  5CMZ A;  1FU1 A;  4DZO A;  4I2L C;  4W7Y A;  3Q5P A;  5GTI E;  2UWJ E;  2YIU C;  1L0L K;  3L71 E;  2ZVO B;  1OZH A;  2E74 D;  4NPE A;  1P84 H;  3I5C A;  1S3J A;  1OXZ A;  5KLV E;  2IX7 C;  3GF3 A;  4HM5 A;  2XV5 A;  3H25 A;  3AED C;  1Z56 A;  2N9B A;  1T6A A;  3GF7 A;  3USS A;  1S9K D;  2NVG A;  3CWB D;  3G3Z A;  4AQR D;  2E74 B;  2XU6 A;  1NVO A;  5AW3 B;  4LLH A;  2YFJ A;  2WSS H;  1JMM A;  4OWF A;  2I1K A;  5E79 H;  4N78 D;  2WSF H;  3V5B A;  4H44 C;  4HKV A;  1URQ C;  2AXT H;  1G2C A;  1DH3 A;  4JQ0 D;  2IBZ D;  3BRT B;  1GTW A;  3KYQ A;  4A7P A;  1XTC C;  4I7Z B;  2WT7 A;  1G2C B;  4Y99 C;  1OW8 A;  1S5L X;  4EI2 A;  2Y0C A;  1L0N D;  3TF5 A;  3FXE A;  1VQ5 P;  2O1J A;  1G1J A;  1PL5 A;  1L0L G;  2WT7 B;  2POH A;  1SQB D;  2J59 M;  2YO2 A;  5AVZ B;  2KLV A;  1Q2N A;  2A06 E;  3Q5S A;  2LKM A;  3A0B E;  2K1A A;  1VQK P;  1SFC C;  2L5G B;  3EFF K;  2HYN A;  1KIL C;  1K05 A;  3L70 D;  2Y9Y A;  1FE6 A;  2YMY A;  3H1K J;  4OGQ C;  1YJ9 P;  1X22 A;  2WSC H;  1BSH A;  1BCC D;  2YIU B;  1NH4 A;  2WPV B;  2NRG A;  4PD4 E;  1FZG A;  3L74 D;  3P8M C;  2WSC J;  3CCM P;  5EFW B;  3G6E P;  2QRX A;  1N86 A;  3L71 J;  1EG9 A;  1AA0 A;  1LTT C;  2KZJ A;  2Y9Z A;  4H44 D;  4PV1 D;  1M56 D;  1URQ D;  1Y8A A;  1PGO A;  2C0X A;  5KLV J;  3H1I E;  1URQ A;  1SQV E;  1CZQ A;  3KDP B;  2Z4E A;  2K37 A;  4H44 B;  1R8E A;  3MTU E;  1URQ B;  2YFI A;  3CI9 A;  4M3L A;  3VMY A;  1JNM A;  2DE7 D;  1MV8 A;  3C1L A;  1H89 A;  4Y99 B;  1T8Z A;  3CX5 D;  3HE5 A;  4BWN A;  3MP7 B;  1IK7 A;  1JY3 P;  1SFC D;  1M8O B;  1AV1 A;  4IFM A;  1SFC A;  1WT6 A;  3JSV C;  3HE5 B;  1KIL D;  5APW A;  2I7F A;  3AE8 C;  2B9B A;  1SVF A;  2WMM A;  4OGQ D;  2E4P A;  1KIL A;  4YPC A;  2QJP C;  3TNU A;  1SFC B;  2WIT A;  2GBX A;  3A0B H;  1OIP A;  3G71 P;  2KNC A;  1KIL B;  1T3J A;  4OGQ B;  3TNU B;  2WPQ A;  4JF7 A;  1LTJ C;  1NO4 A;  1S9K E;  2KNC B;  2H43 A;  5TIS E;  3M0A A;  2GUV A;  3K5B A;  3V2P A;  1KB9 I;  5APX A;  3KHU A;  1CW5 A;  5L8R J;  1AVY A;  4ASV A;  3U1C A;  4NBE D;  1G1I A;  4N78 E;  4QDC A;  1BGY G;  2E42 A;  1HBW A;  2B89 A;  4PJ0 H;  4U3F G;  2IBZ E;  5APT A;  5B66 E;  1YTZ I;  3V2N A;  3H1H G;  2AEM A;  1AFO A;  1L0L D;  1GW3 A;  2XDJ A;  2G3A A;  3H1J E;  1HF9 A;  3RBX A;  2JKV A;  1L0N E;  2PGD A;  1JM0 A;  1PGJ A;  3TK1 A;  3GL2 A;  3H1I J;  1S1C X;  2P58 A;  1SQV J;  1KC8 Q;  4IFD K;  5AW5 B;  1GZL A;  1NYH A;  1U7J A;  3B5N C;  2KYV A;  1VF5 C;  1JY2 P;  4QDF A;  3BRV B;  1EZV D;  3L70 E;  4ZMD A;  3RGU A;  5APY A;  3H1K D;  1NWQ A;  3FXD A;  4QDF B;  1BCC E;  3JC2 2;  2QJP B;  1GMJ A;  1ZN5 A;  4HJG H;  3L74 E;  3IAO A;  1LTJ A;  1JMB A;  1UUW A;  1K04 A;  3L35 A;  3L71 D;  1M7L A;  3ZDM A;  3E1I A;  1SQX G;  1LTJ B;  1IFI A;  2FYU G;  2YFL A;  1PP9 G;  3VCP A;  5HL4 A;  3RBZ A;  3VN0 A;  1A02 J;  5TIS H;  3M9H A;  3EN1 A;  1NU1 E;  3M06 A;  2H7H A;  5AW4 B;  4HH2 A;  3GCE A;  3CCV P;  1QLE D;  1N2D C;  2OYI C;  4UB8 E;  2M3E A;  3NTN A;  2R5B A;  3U59 A;  2I8D A;  5B66 H;  2KS1 A;  3CX5 E;  1N8R Q;  3B5N D;  1KQF B;  3CCS P; 
#chains in the Genus database with same CATH homology
 4AIV A;  3CXH E;  3AZC A;  3L73 E;  1Q90 C;  4QUQ A;  2HML A;  2I7F A;  2XSH A;  4HM1 A;  2NVE A;  1BE3 E;  1P84 E;  3GOB A;  4QDF A;  4OGQ D;  2E4P A;  3CWB E;  2FYN C;  5KKZ C;  2QJP C;  2YIU C;  4HM2 A;  1NTK E;  3L71 E;  2B24 A;  4H0L D;  3L70 E;  4NBB D;  4HM6 A;  4NBG D;  4H13 D;  5AEU A;  2E74 D;  2GBX A;  2XRX A;  4HM7 A;  3TGU E;  2NVF A;  4QDF B;  2GBW A;  2HMO A;  1BCC E;  2HMJ A;  3GKE A;  3DQY A;  1SJG A;  4HJL A;  1VF5 D;  1SQX E;  2XSO A;  5KLV E;  4PD4 E;  3L74 E;  2BMQ A;  4HM5 A;  4NB8 D;  3VMH D;  2FYU E;  2D2C D;  5KLI C;  4AAY B;  2QJK C;  4P1C H;  1PP9 E;  1UUW A;  2NVG A;  5BOK A;  3EQQ A;  4NB9 D;  4D6T E;  1JM1 A;  4NBH D;  3VCA A;  1SQP E;  1O7H A;  1BGY E;  4P1B H;  2HMN A;  1O7N A;  3GB4 A;  3BCC E;  1EG9 A;  2YVJ B;  3GTS A;  1KYO E;  3L75 E;  4NBC D;  1ZRT E;  4NBA D;  4U3F E;  1VM9 A;  1NYK A;  2YFJ A;  3D89 A;  3H1H E;  4NBD D;  1G8K B;  2E4Q A;  4H44 D;  1NDO A;  2Q3W A;  2YFL A;  4NBE D;  4PV1 D;  5HL4 A;  3VCP A;  2B1X A;  1O7W A;  3N0Q A;  4QDC A;  1O7G A;  1ULI A;  4QCK A;  3H1I E;  3EN1 A;  4HKV A;  1NU1 E;  4HM3 A;  1VCK A;  1SQV E;  2E75 D;  1SQB E;  1NTZ E;  2IBZ E;  3GZY A;  3C0D A;  1WQL A;  3GTE A;  3GCE A;  2DE6 D;  2XR8 A;  2JZA A;  4QUP A;  4QDD A;  2QPZ A;  3FOU A;  1KB9 E;  2NWF A;  1L0L E;  5CXM A;  4HM0 A;  2YFI A;  3H1J E;  1G8J B;  3VMI D;  3GL0 A;  2NUK A;  3L72 E;  1O7P A;  2HMK A;  4EMJ B;  4QUR A;  1SQQ E;  2JO6 A;  2CKF A;  2BMR A;  1FQT A;  4NBF D;  2E76 D;  1O7M A;  1RFS A;  4HM8 A;  2DE7 D;  1L0N E;  2BMO A;  2HMM A;  3GZX A;  3GL2 A;  1NTM E;  1EZV E;  1ULJ A;  1UUV A;  3VMG D;  2DE5 D;  3CX5 E;  3H1K E;  2QJY C;  1RIE A;  2BCC E;  4HM4 A;  3H1L E;  2ZYL A;  2NUM A;  5AEW A;  2ZT9 D;  2A06 E;  1PPJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...