1NTZE

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntzE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntzE02
4NB9D 3VMHD 2HMNA 1NTME 3VCPA 1PP9E 4QCKA 4HM0A 3L74E 2Q3WA 4H13D 3EQQA 4P1CH 1O7MA 1SQBE 4NBHD 4HM4A 3AZCA 4HM5A 2E4PA 1O7NA 5BOKA 2HMKA 2GBWA 1SQXE 1ULIA 1G8KB 2NWFA 2ZT9D 2XSHA 3H1KE 1PPJE 4HKVA 1NYKA 4NB8D 2HMMA 1NDOA 3GL2A 4HJLA 2DE7D 2A06E 2QPZA 1NU1E 1O7GA 2JO6A 4D6TE 2HMOA 4PD4E 3L71E 1SQQE 2YVJB 2HMJA 1NTKE 2ZYLA 2BCCE 2IBZE 5KKZC 4OGQD 2E76D 3BCCE 1BE3E 2E75D 2D2CD 5AEUA 4HM7A 4HM6A 1WQLA 3TGUE 1EZVE 1SQPE 1UUWA 1SJGA 3GZXA 4QDCA 2BMQA 1BGYE 3L70E 2NVGA 4HM2A 3L72E 3VCAA 2HMLA 3C0DA 4QUQA 3CXHE 3L73E 2YFJA 1VCKA 3GKEA 2I7FA 2QJKC 1NTZE 1O7WA 3CX5E 3GZYA 3VMGD 4HM8A 4NBDD 4QDDA 5KLIC 1VF5D 2FYUE 1ZRTE 4AAYB 1VM9A 1FQTA 4PV1D 3L75E 3VMID 1L0NE 2XR8A 1SQVE 1Q90C 1UUVA 1G8JB 4NBAD 2YFLA 3GB4A 2FYNC 2E4QA 1RFSA 2DE6D 2YIUC 4NBFD 3DQYA 4NBED 2DE5D 3H1HE 4QDFB 1KYOE 1L0LE 3CWBE 3D89A 3EN1A 5KLVE 3GOBA 2JZAA 4H0LD 3GTSA 4QUPA 2XSOA 3H1JE 4U3FE 1JM1A 1KB9E 4NBBD 1BCCE 2CKFA 2NUKA 1ULJA 3H1LE 5CXMA 1P84E 2BMOA 4H44D 2BMRA 5AEWA 4EMJB 4AIVA 4QURA 4HM3A 2NVEA 3GTEA 1O7PA 2QJYC 3FOUA 3GL0A 1EG9A 4NBGD 2NUMA 5HL4A 2YFIA 4QDFA 3GCEA 2B1XA 2NVFA 2E74D 4P1BH 3H1IE 1O7HA 1RIEA 2B24A 2QJPC 2XRXA 3N0QA 4HM1A 4NBCD 2GBXA
chains in the Genus database with same CATH superfamily
3VMHD 2JJLA 3EQ2A 1GK6A 1UIIA 4H13D 4GODA 1FZGA 1GU5A 1SQBE 2R44A 4NBHD 3ABVC 1M1JB 3Q5PA 2I8DA 3TF5A 2WSEJ 3USSA 2IPPA 5GTHE 1LTTC 4LGDE 1KB9H 2V7QH 3B5NA 4PD4H 5APSA 3KXDA 1LNQA 2B89A 3BCCE 3S9OA 2OTLP 2LR2A 1WQLA 3HRNA 1N73A 3RBXA 1PP9D 3GZXA 4C7NA 2M0BA 1BE3G 1FZCC 3L73E 2J59M 4WY4C 2HR3A 1KQLA 1GDTA 1JOCA 2K1AA 2Y0CA 1KMIZ 1N7SA 3B5NB 3MZWB 1Q82Q 1Q90C 1ZLLA 3SWKA 1P84I 2ZYGA 1JY3O 3PJSK 3B5NC 1PV3A 3GTSA 5DJUB 2I1KA 3RL0D 5EFWB 4L73A 1AVYA 5KAFH 4U3FG 3H1KG 3D6ZA 3GHGC 2ZYDA 1Y8AA 2V4HA 2Y9YA 3D6YA 1VQPP 3V2PA 1PFIA 3N0QA 3L36A 1HGVA 3AE6C 1N7SC 1N73B 1NKZB 3NMDA 1LP1B 2KXPB 3L71D 1R8EA 2MKVA 4HH2A 3AZCA 3A2AA 4H13C 5L8RJ 5AVSB 2BEQD 3Q1MA 2XSHA 1PPJE 2V7QJ 1NYKA 2WSEH 1RQUA 1EQ7A 2Y0EA 3CWBG 1S1CX 2IZ1A 1SQVJ 2XU6A 3AE4C 2JEEA 1ZN5A 3MUDC 5AEUA 1KQFB 1LWUA 2K9JB 2E75C 1EZVE 1KILB 1BCCG 2KNCB 1NOHA 3PLNA 2YFJA 2QE7H 2QJKC 1DD3A 1O7WA 4PV1C 1LT9A 1RH5B 1VF5D 2IX7C 2FFDB 1BCCD 4UB8E 3JCUE 1J2JB 1L2PA 1NO4A 2E4QA 1P84D 2PRRA 1NU1D 2O3JA 3CWBE 1NU1K 2Q7CA 5CCHD 4QUPA 1NTKG 2FYUJ 3H1LE 1CSBA 3I56P 4QURA 1PP9G 3P7KA 4IOIH 2HPCA 1VQ4P 2QJPC 3CXHI 3BCCJ 3GHGB 3V6IA 3T97B 2M3BA 1G1JA 1X8YA 2H8PD 4P1CH 2QJPB 1K8AQ 1IZNB 2P7JA 1PIXA 3GW6A 2WTYA 1JY3P 2Y9ZA 3JSVC 1JEKA 1JO5A 4HKVA 1NDOA 1FZEA 3LW5H 1L0ND 4K3AA 1SFCD 3SWYA 2HMJA 3CX5D 1NHLA 1MKMA 4ASVA 5H2FE 1M8OB 4C7RA 3H1IJ 2WPVB 1AJYA 2QEXP 1UUWA 1SJGA 3M0AA 2P10A 3BASA 4HM2A 5E79E 4QUQA 1CI6A 4I7ZC 1LJ2A 2OQQA 4H0LB 1BGYG 2JO1A 2PGDA 2YKQA 1VQLP 1ZXGA 4H0LC 2R5BA 2C9LY 3B5ND 3M9QA 1T2KD 1NTMK 2QJYC 1URQD 3V2QA 2C9NY 1A02F 1BGYD 1S4XA 5AW1B 1BE3J 2WZ7A 2OYIA 2B24A 1M90Q 2P67A 3CXHD 1NWQA 1GL2C 1H88A 2W90A 1AQ5A 2ZVOB 4ZNCA 1FC2C 4HM0A 1N7SD 1SQQJ 3C8VA 1MZ9A 1ZOYC 4HM5A 2E4PA 1LWUB 3G6EP 1L4AA 3H1JD 4GIFA 2ZT9C 2A06E 1LWUC 1OVRA 3BRTB 3CD6P 1S9KE 4RKUJ 3V2NA 4MN4C 4GT1A 4OGQC 1ZW0A 3O8ZA 4IL6H 2B88A 4D6TG 2E75D 1FBMA 2N9BA 3HD7C 2W6JH 3E7KA 2OGUA 4HJGH 3D71A 5KKZB 1SQVK 2FYUG 2J58A 1YIJP 3O6QA 5E79H 3VMGD 2Z5HA 4QDDA 2O1JA 1ZRTE 1KC8Q 3H1HG 3L75E 3VMID 2YFLA 3PTZA 3FGAD 3G71P 1VQOP 4D6TD 1ZR2A 1NJIQ 2FBWC 1EDKA 5AVRB 3C9IA 4GOEA 1HWTC 1K9MQ 5B66H 1IFMA 2KYVA 2SPZA 2BEZF 5K5GB 1NTZD 3GLMA 2NVFA 1QVGO 3H1IE 4JYBA 3CX5I 2LXCB 1FDMA 1FZAA 2NPSD 2WSFJ 2NRGA 3TNUA 3A0HH 3II6A 1RE4A 3L75D 3IR9A 2E76B 2IBZG 3P8CD 2WWWA 4WB4A 2ZYLA 1SFCC 1EXJA 2IFMA 3GHGA 1RE3C 4OGQD 4B86A 2G8YA 1J1DB 1NVOA 1SFCB 3W68A 3HD7D 1DH3A 3L72E 5AVVB 4ZMDA 2QG4A 3OW2O 3CXHE 2POHA 2YKOA 4A7PA 3L72J 1VF5C 1N8RQ 3CX5E 3L4FA 3GZYA 1BCCJ 5KLIC 5M1BA 1OW7A 4I6MC 1NTKJ 1N7LA 1RFSA 4KHXA 1H89A 4NBED 3TNUB 3A0BE 3GOBA 4H0LD 2CKFA 4BXLA 2JR8A 1QVFO 2W27A 1MFTA 1JMMA 1EZVG 1GW3A 2YO2A 5AVUB 2ZYAA 5HL4A 3TSIA 3GCEA 3EWKA 3HUSB 5AVTB 1EZVI 1OW6A 1NTMJ 1T3UA 2AEFA 2GUSA 3H25A 1DIPA 1NH4A 2W6BA 1AV1A 1Z56A 4OVNF 2E43A 2L5GB 1ZP0C 1SQXE 1ZMEC 2GUVA 1L0LG 1SQQK 1SLQA 5B5EE 2E42A 3WMM0 1LTSC 1M1JC 4UB6E 3L75G 1SQBK 1P84H 3H1HJ 1SQBD 2FY8A 4W80A 2RN0A 1DEEG 2UWJE 3Q3DA 3H32B 5AVQB 1BSNA 2XDJA 1VPCA 2CPSA 3L70D 2J5UA 3JC22 1OVUA 2VRSA 1PGOA 3C0DA 3MHVA 2KZIA 1VCKA 4IFDK 2XNDH 1N2DC 2FYNB 4NBDD 5CCGC 1YBKA 5DJTB 2GA1A 4AAYB 3GF3A 3TDKA 1FAVA 2C0XA 2H88C 1GU4A 2YIUC 2ZVNB 2KP8A 4HYTB 4H44B 3S1KA 3CWBD 1PZQA 3H1JE 3N7NA 4Y99C 4N78E 2KS1A 3L73G 2HLOA 1SQVD 1WMKA 1VQMP 1VQ9P 2OYHB 1BGYJ 2NUMA 2BASA 3L74J 2E74D 3HTKA 3M9HA 3C1LA 1IFIA 1PGJA 2NPSC 1IO4A 1X22A 3AE5C 2ZXXA 3RK2D 1LTAC 1S9KD 1FJPA 3PRJA 3FXEA 1FOSF 5B5EH 1SFCA 2YO3A 2ZT9D 1NGMB 3H1KD 2K9YA 4U3FD 4YXDC 1IFNA 4I1LA 1VQKP 3RBZA 3OJAB 3E1IA 1PL5A 1S2EA 2IBZE 1USEA 1CI6B 3AEGC 3L70G 3GG2A 1FS0E 1SQPE 1LTGC 2OTJP 3TGUD 2HMLA 2W8ZA 4TT3H 1FE6A 1HH0A 3B4SA 1QL2A 1VDFA 3H32A 2XKMA 1Q90D 1YYCA 2IZ0A 1BE3D 1MUUA 5TJHA 4NPFX 5AVXB 3CPWO 3VOPA 4N6JA 4QDFB 1J1EB 2HFED 4U3FE 1BCCE 1ULJA 4H44C 3FOUA 5B66E 1M1JA 3VMAA 1EG9A 2Q5UA 1JCDA 4HM1A 5APVA 1AQTA 1OWAA 3TK1A 2WT7B 1PP9E 4QCKA 4NPEA 1H8AA 2IYPA 2Z4EA 3EQQA 1O7MA 2N1TB 3RK2C 1CW5A 1O7NA 1Q2NA 1VQ6P 5KLVG 2O01N 1RQVA 2K3RA 1RY3A 2WITA 2QPZA 3VP8A 1L0NG 3V4QA 3L71E 2IFNA 1SQXG 2BCCE 3SWFA 2D2CD 1FZCB 2KSEA 5KTBA 2M3EA 4RJTA 5TISH 3VMXA 3MTUE 3G9RA 2IBZD 2I7FA 1YQ3C 3H1LJ 1KILE 3SFEC 2O01J 1FQTA 1KFNA 4I7ZB 1D7MA 1Y9BA 3L71J 5CCHC 3A7OA 3D89A 3EN1A 2JZAA 2A45I 2NUKA 3IFMA 1H0TA 1NU1G 3AE1C 1SQXJ 2OYHA 2WSSH 1JB0J 3GL0A 1NTMG 3RL0B 2W83C 1T2KC 4NBGD 3K5BA 1JY2O 1KTMA 1NTMD 2KSJA 3BATA 1NTME 2RMZA 2WSCJ 1SQPK 3QWOC 1MFZA 3PH0A 1KZUB 2ZAEB 1LTIC 3QH9A 1FZCA 1JM0A 1HF9A 1YJ9P 5APYA 2E5TA 2HMMA 2FXPA 2W6AA 2OTKE 1R5LA 4HB1A 5AW4B 4IL6E 1PP9J 3RL0g 2KOGA 2G3AA 1JTHB 2AEJA 1GTWA 3HE5B 1RE4C 1LT1A 2RH0A 1AFOA 3FWLA 1QLED 3Q5SA 3AEDC 5AVYB 2K88A 1L0NE 2XR8A 4UB8H 1UUVA 2O1KA 1KYOH 4IFFA 2AEMA 3DQYA 3UIAA 2WPSA 3U59A 3L75J 4PJ0E 5CMZA 2YMKA 3A5TA 2B87A 1URQC 1GMJA 1L4AB 3GTEA 1RF0A 4L75A 1HGZA 2RKLA 3H1LG 2WMMA 2M5AB 2HG5D 2R5DA 1BDCA 1LTJA 1L4AC 1JTHA 1M56D 1SQBG 2OYOA 4H13B 2QSIA 1H0TB 2HMNA 2JWDA 1LTBC 4ZKUA 3O6QB 3VCPA 1K05A 2Q3WA 1KB9D 3AE3C 1N73C 1GW4A 5AW2B 4DCKA 1DX7A 1ULIA 3D70A 1YITP 3H1KJ 3U1AA 1VQ7P 1BDDA 1W2EA 1JY2P 2JP3A 2FKWB 1QGKB 4O9BA 1N86A 1E5WA 3L74G 1FZFA 5AVZB 1QX8A 1SQQE 1S5LH 1YI2P 1KILC 1T8ZA 2I1JA 4HM6A 2D2CC 1FDOA 4XFJA 4ASWA 1A02J 1QL1A 3L73J 1EDJA 3NTNA 3CX5H 2CK3H 2D2CB 3CMAP 2YIUB 5CHXA 4N78D 3Q2YA 4BWNA 2KLVA 4BRYA 3M91A 3RGUA 4HKZH 2A06D 5KLVE 2QJYB 3F5HA 3L35A 2NZ2A 5AW6B 5BVZA 2KIKA 2KS1B 5AEWA 1S5LE 1GL2B 3L70J 2B87B 5CCHA 4DZOA 1URQB 4K35A 1IFDA 3CCUP 4RO0A 3WU2H 1XTGB 4WY4A 2ZFCA 1RF0C 3HUSC 2Q3EA 3M06A 3BRVB 1AA0A 3H1IG 1N7SB 2GBWA 1G1IA 4C7NB 5CBNA 1G8KB 1ZV8A 4WVZA 2XZRA 2Q6QA 3HE5A 1O7GA 2JO6A 3OAKA 2GM4A 1KORA 3CCQP 1KD1Q 1GK4A 3OA7A 1IK7A 3Q5RA 1FJKA 3FX0A 1L0NJ 3L37A 1KILD 2P58A 4HM7A 1OZHA 1R5SA 2ITAA 3TGUE 1YQ4C 3KYQA 1OMIA 1UIXA 3WUUA 2KNCA 1NTZE 1CZQA 3MP7B 3P8MC 2FYUE 1YTZI 1MV8A 1VL2A 3RK3D 5CCGD 1SQVE 1L0LD 3P8CE 2FYNC 3JCUH 3AE7C 1Q86Q 2DE5D 3H1HE 1M1KQ 1G2CB 1KQSO 1OW8A 1HUCA 2XSOA 1JM1A 3RK3E 3FXDA 3CCJP 3E1RA 4CPGA 1PGPA 1NKNA 2YKPA 2QRXA 3HTKB 3IF4A 3VTPC 1HBWA 3TGUJ 1EZVD 1EC5A 1LTJB 1O7HA 4XA4A 1L0NK 1U57A 3GMAA 1X9VA 3B8EB 1SS1A 1RE3A 1GD2E 3H1JG 2K37A 2M5AA 1WT6A 1NU1J 2CPBA 5AW3B 1LT9C 1OFCX 4OWFA 5BOKA 3LIEA 4WBAA 5KLVD 2Z5IA 4DJGA 2NPSB 2FYUK 4JF7A 1KYOD 1T3JA 1SQQD 4GOFA 1NTZK 5KAIH 2A45G 1RF1A 1U7MA 3KPEA 1IC2A 4PD4E 3A3YB 2R3SA 1PPJG 3AEAC 2YVJB 3R4YA 1JMBA 1NTKE 1S3JA 1EXIA 2AXCA 5KKZC 2E76D 1LP1A 2P1JA 4OGQB 2NVGA 1TU3F 4WY4D 4R4LA 4N3YB 3HD7B 2DW3A 2WPQA 5APWA 3KHUA 3AE9C 3PHLA 1IFJA 1QEXA 2H43A 3AEFC 4KT0J 1ZR4A 2Q9IA 1L0LE 3HE4A 2QM7A 3RL0C 2KK7A 2WQYC 1PPJD 2HPCB 3TYYA 4NBBD 5CXMA 1SP4A 2LXBA 2QIWA 1NTZJ 2YNYA 1DEBA 1J1EC 3HUSA 3P32A 1SQBJ 4QDFA 5GTIH 2QVAA 3CXHH 4AUWA 4NPDA 2GBXA 1DD4A 1M7LA 3HD7A 1JY2N 2BCCD 1NAYA 1GL2D 2R32A 1LGHB 3CCVP 4HM4A 1KN7A 4IFMA 3M0DA 5AW8B 4L76A 3MIWA 5KAIE 5CJ0A 4WWIA 3AEBC 3GL2A 2DE7D 2WPRA 5AW0B 4D6TE 1FDIA 1G2CA 2E75B 2Q3IA 3IAOA 1VQ8P 1BE3E 5BU8B 3L72D 2QJKB 3KZIH 4QDCA 4IL6X 5GTIE 3L73D 4AQRD 4RESB 2Q1KA 3CCLP 4EIJA 3H1JJ 1SQPG 2R3CA 1VM9A 1HJBA 3NXSA 3TGUG 1G8JB 1YJWP 2FYZA 2AXTE 4NBFD 3AEEC 3RK3B 4JPZB 2BMOA 4H44D 2IDBA 1VQ5P 3VYIA 1VQNP 2WVRA 1S5LX 2E5YA 1Q7YQ 3IN6A 4AYCA 2E74C 2N1TA 1YJNP 2YFIA 3R2PA 1SQPD 1KQGB 1JY3N 1KV4A 2XNXA 1GZLA 2XRXA 1WRGA 2FXOA 2QM8A 3WU2E 4NB9D 2E74B 1L0LK 4JQ0D 2JWAA 3L74E 3M0DC 4D6TJ 3CC7P 1JCCA 5APXA 3PP5A 2P2UA 2ZXEB 3G4SP 1FU1A 2FXMA 4KJMA 1USDA 2NWFA 3L71G 3H1KE 3LIDA 4HJLA 1KFMA 1KB9I 2M8RA 1HTLC 3WUVA 3CCEP 1X0TA 2FFDA 1NYHA 2E76C 1HJ0A 3VN0A 4EOTA 4PV1B 3SFDC 2BCCG 5KLVK 3BCCD 1PGQA 5KJ7C 3CCSP 5CBOA 1OXZA 1T6AA 4L74A 2H7HA 1RF1B 2K9JA 3T97A 3AECC 4WY4B 3CWBJ 1L0LJ 1HVVA 4PD4I 2MJZA 4Y99B 1JUNA 3CL3D 5KLIB 3HE4B 2OYIC 4UB6H 2OYHC 1KB9E 2KI7B 2A45H 3CMEP 3L74D 3CCMP 4JBZA 2NVEA 2WSCH 3V2RA 5H2FH 2OYIB 4LC1A 3KDPB 1RIEA 4BRYB 1NTKK 5APQA 1NTKD 3VMYA 1NAFA 3ZDMA 1BSHA 1X79B 3SSUA 4XE5B 4PD4D 3W67A 4EYYQ 4Y28J 2JKVA 2HMKA 2N1TD 1OIPA 3H1LD 4EI2A 4NB8D 4PJ0H 1NU1E 2B9BA 4EDFA 2Y0DA 3AE8C 1Q81Q 2YXQB 3BCCG 1EDIA 3CC2P 3EFFK 2C0WA 1NTZG 4M3LA 5KAFE 3BVHA 1SQQG 1S72P 1FZBA 2N9YB 1SQXK 2KB7P 3L70E 5BU5A 2PAJA 1AVOA 3S4RA 1K73Q 2KUBA 2HODB 2OARA 4C46A 3GB4A 3H1HD 2DE6D 1RF1C 2IBZI 2WT7A 2FFDC 5APTA 3LW5J 2HYNA 2YXRB 3B71A 1U7JA 4YTPC 4R4MA 4U7JA 2FYUD 1SVFA 5APUA 3ITKA 4LLHA 2BMRA 2ZJSE 1LTJC 4GKGA 2JDIH 1RHZB 3CCRP 4P1BH 5AW5B 1Y47A 3U1CA 1URQA 2L91A 3RK2B 2PFXA 2BCCJ 4DT0A 3WUTA 2XV5A 3VMZA 2LKMA 1KYOI 3MGNA 4YPCA 2ZT9B 3A0HE 3MD0A 5C39A 3N4XA 3I5CA 3CC4P 5KJ7A 1E79H 3I55P 1K04A 2AXTH 2N1TC 2KLUA 3AE2C 1LT9B 1YHQP 2O01H 2QA4P 3EFGA 2HMOA 3V4WA 3VP9A 4DOJA 3FWNA 1J1DC 3CI9A 3MUDA 1M57D 4GDOA 2YMYA 4ZKPA 1FOSE 1JNMA 4W7YA 3H1ID 3L72G 1VF5B 2KZJA 3GF7A 1GL2A 2BMQA 1BGYE 1W5CE 1W2BO 3VCAA 5KJ7D 3GKEA 4HM8A 2NPSA 4U3FJ 3CLQA 3V5BA 4PV1D 1OX3A 5KLVJ 3RK3C 4NBAD 5CCGA 1IJDB 1IFPA 1SQVG 3A0BH 5CJ4A 1KYOE 2HODA 1SQXD 1EDLA 1IK9A 5GTHH 3M9BA 4JYCA 2WSFH 4QMAA 1ZRTD 1OVVA 2A06G 1P84E 3NFQA 5AVWB 3H6PA 3G3ZA 4EMJB 4AIVA 4HM3A 3F89A 4TLFA 1O7PA 3KQGA 4YXWH 4W7ZA 1KILA 3KZIE 1L4AD 2PP6A 1XTCC 5AW9B 1SQPJ 1YTZT 2B1XA 5AW7B 4OH8B 5TISE 2IYOA 2H89C 4I2LC 4NBCD 4Z1MH
chains in the Genus database with same CATH topology
4NB9D 3VMHD 2HMNA 1NTME 3VCPA 1PP9E 4QCKA 4HM0A 3L74E 2Q3WA 4H13D 3EQQA 4P1CH 1O7MA 1SQBE 4NBHD 4HM4A 3AZCA 4HM5A 2E4PA 1O7NA 5BOKA 2HMKA 2GBWA 1SQXE 1ULIA 1G8KB 2NWFA 2ZT9D 2XSHA 3H1KE 1PPJE 4HKVA 1NYKA 4NB8D 2HMMA 1NDOA 3GL2A 4HJLA 2DE7D 2A06E 2QPZA 1NU1E 1O7GA 2JO6A 4D6TE 2HMOA 4PD4E 3L71E 1SQQE 2YVJB 2HMJA 1NTKE 2ZYLA 2BCCE 2IBZE 5KKZC 4OGQD 2E76D 3BCCE 1BE3E 2E75D 2D2CD 5AEUA 4HM7A 4HM6A 1WQLA 3TGUE 1EZVE 1SQPE 1UUWA 1SJGA 3GZXA 4QDCA 2BMQA 1BGYE 3L70E 2NVGA 4HM2A 3L72E 3VCAA 2HMLA 3C0DA 4QUQA 3CXHE 3L73E 2YFJA 1VCKA 3GKEA 2I7FA 2QJKC 1NTZE 1O7WA 3CX5E 3GZYA 3VMGD 4HM8A 4NBDD 4QDDA 5KLIC 1VF5D 2FYUE 1ZRTE 4AAYB 1VM9A 1FQTA 4PV1D 3L75E 3VMID 1L0NE 2XR8A 1SQVE 1Q90C 1UUVA 1G8JB 4NBAD 2YFLA 3GB4A 2FYNC 2E4QA 1RFSA 2DE6D 2YIUC 4NBFD 3DQYA 4NBED 2DE5D 3H1HE 4QDFB 1KYOE 1L0LE 3CWBE 3D89A 3EN1A 5KLVE 3GOBA 2JZAA 4H0LD 3GTSA 4QUPA 2XSOA 3H1JE 4U3FE 1JM1A 1KB9E 4NBBD 1BCCE 2CKFA 2NUKA 1ULJA 3H1LE 5CXMA 1P84E 2BMOA 4H44D 2BMRA 5AEWA 4EMJB 4AIVA 4QURA 4HM3A 2NVEA 3GTEA 1O7PA 2QJYC 3FOUA 3GL0A 1EG9A 4NBGD 2NUMA 5HL4A 2YFIA 4QDFA 3GCEA 2B1XA 2NVFA 2E74D 4P1BH 3H1IE 1O7HA 1RIEA 2B24A 2QJPC 2XRXA 3N0QA 4HM1A 4NBCD 2GBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB9 D;  3VMH D;  2HMN A;  1NTM E;  3VCP A;  1PP9 E;  4QCK A;  4HM0 A;  3L74 E;  2Q3W A;  4H13 D;  3EQQ A;  4P1C H;  1O7M A;  1SQB E;  4NBH D;  4HM4 A;  3AZC A;  4HM5 A;  2E4P A;  1O7N A;  5BOK A;  2HMK A;  2GBW A;  1SQX E;  1ULI A;  1G8K B;  2NWF A;  2ZT9 D;  2XSH A;  3H1K E;  1PPJ E;  4HKV A;  1NYK A;  4NB8 D;  2HMM A;  1NDO A;  3GL2 A;  4HJL A;  2DE7 D;  2A06 E;  2QPZ A;  1NU1 E;  1O7G A;  2JO6 A;  4D6T E;  2HMO A;  4PD4 E;  3L71 E;  1SQQ E;  2YVJ B;  2HMJ A;  1NTK E;  2ZYL A;  2BCC E;  2IBZ E;  5KKZ C;  4OGQ D;  2E76 D;  3BCC E;  1BE3 E;  2E75 D;  2D2C D;  5AEU A;  4HM7 A;  4HM6 A;  1WQL A;  3TGU E;  1EZV E;  1SQP E;  1UUW A;  1SJG A;  3GZX A;  4QDC A;  2BMQ A;  1BGY E;  3L70 E;  2NVG A;  4HM2 A;  3L72 E;  3VCA A;  2HML A;  3C0D A;  4QUQ A;  3CXH E;  3L73 E;  2YFJ A;  1VCK A;  3GKE A;  2I7F A;  2QJK C;  1NTZ E;  1O7W A;  3CX5 E;  3GZY A;  3VMG D;  4HM8 A;  4NBD D;  4QDD A;  5KLI C;  1VF5 D;  2FYU E;  1ZRT E;  4AAY B;  1VM9 A;  1FQT A;  4PV1 D;  3L75 E;  3VMI D;  1L0N E;  2XR8 A;  1SQV E;  1Q90 C;  1UUV A;  1G8J B;  4NBA D;  2YFL A;  3GB4 A;  2FYN C;  2E4Q A;  1RFS A;  2DE6 D;  2YIU C;  4NBF D;  3DQY A;  4NBE D;  2DE5 D;  3H1H E;  4QDF B;  1KYO E;  1L0L E;  3CWB E;  3D89 A;  3EN1 A;  5KLV E;  3GOB A;  2JZA A;  4H0L D;  3GTS A;  4QUP A;  2XSO A;  3H1J E;  4U3F E;  1JM1 A;  1KB9 E;  4NBB D;  1BCC E;  2CKF A;  2NUK A;  1ULJ A;  3H1L E;  5CXM A;  1P84 E;  2BMO A;  4H44 D;  2BMR A;  5AEW A;  4EMJ B;  4AIV A;  4QUR A;  4HM3 A;  2NVE A;  3GTE A;  1O7P A;  2QJY C;  3FOU A;  3GL0 A;  1EG9 A;  4NBG D;  2NUM A;  5HL4 A;  2YFI A;  4QDF A;  3GCE A;  2B1X A;  2NVF A;  2E74 D;  4P1B H;  3H1I E;  1O7H A;  1RIE A;  2B24 A;  2QJP C;  2XRX A;  3N0Q A;  4HM1 A;  4NBC D;  2GBX A; 
#chains in the Genus database with same CATH topology
 3VMH D;  2JJL A;  3EQ2 A;  1GK6 A;  1UII A;  4H13 D;  4GOD A;  1FZG A;  1GU5 A;  1SQB E;  2R44 A;  4NBH D;  3ABV C;  1M1J B;  3Q5P A;  2I8D A;  3TF5 A;  2WSE J;  3USS A;  2IPP A;  5GTH E;  1LTT C;  4LGD E;  1KB9 H;  2V7Q H;  3B5N A;  4PD4 H;  5APS A;  3KXD A;  1LNQ A;  2B89 A;  3BCC E;  3S9O A;  2OTL P;  2LR2 A;  1WQL A;  3HRN A;  1N73 A;  3RBX A;  1PP9 D;  3GZX A;  4C7N A;  2M0B A;  1BE3 G;  1FZC C;  3L73 E;  2J59 M;  4WY4 C;  2HR3 A;  1KQL A;  1GDT A;  1JOC A;  2K1A A;  2Y0C A;  1KMI Z;  1N7S A;  3B5N B;  3MZW B;  1Q82 Q;  1Q90 C;  1ZLL A;  3SWK A;  1P84 I;  2ZYG A;  1JY3 O;  3PJS K;  3B5N C;  1PV3 A;  3GTS A;  5DJU B;  2I1K A;  3RL0 D;  5EFW B;  4L73 A;  1AVY A;  5KAF H;  4U3F G;  3H1K G;  3D6Z A;  3GHG C;  2ZYD A;  1Y8A A;  2V4H A;  2Y9Y A;  3D6Y A;  1VQP P;  3V2P A;  1PFI A;  3N0Q A;  3L36 A;  1HGV A;  3AE6 C;  1N7S C;  1N73 B;  1NKZ B;  3NMD A;  1LP1 B;  2KXP B;  3L71 D;  1R8E A;  2MKV A;  4HH2 A;  3AZC A;  3A2A A;  4H13 C;  5L8R J;  5AVS B;  2BEQ D;  3Q1M A;  2XSH A;  1PPJ E;  2V7Q J;  1NYK A;  2WSE H;  1RQU A;  1EQ7 A;  2Y0E A;  3CWB G;  1S1C X;  2IZ1 A;  1SQV J;  2XU6 A;  3AE4 C;  2JEE A;  1ZN5 A;  3MUD C;  5AEU A;  1KQF B;  1LWU A;  2K9J B;  2E75 C;  1EZV E;  1KIL B;  1BCC G;  2KNC B;  1NOH A;  3PLN A;  2YFJ A;  2QE7 H;  2QJK C;  1DD3 A;  1O7W A;  4PV1 C;  1LT9 A;  1RH5 B;  1VF5 D;  2IX7 C;  2FFD B;  1BCC D;  4UB8 E;  3JCU E;  1J2J B;  1L2P A;  1NO4 A;  2E4Q A;  1P84 D;  2PRR A;  1NU1 D;  2O3J A;  3CWB E;  1NU1 K;  2Q7C A;  5CCH D;  4QUP A;  1NTK G;  2FYU J;  3H1L E;  1CSB A;  3I56 P;  4QUR A;  1PP9 G;  3P7K A;  4IOI H;  2HPC A;  1VQ4 P;  2QJP C;  3CXH I;  3BCC J;  3GHG B;  3V6I A;  3T97 B;  2M3B A;  1G1J A;  1X8Y A;  2H8P D;  4P1C H;  2QJP B;  1K8A Q;  1IZN B;  2P7J A;  1PIX A;  3GW6 A;  2WTY A;  1JY3 P;  2Y9Z A;  3JSV C;  1JEK A;  1JO5 A;  4HKV A;  1NDO A;  1FZE A;  3LW5 H;  1L0N D;  4K3A A;  1SFC D;  3SWY A;  2HMJ A;  3CX5 D;  1NHL A;  1MKM A;  4ASV A;  5H2F E;  1M8O B;  4C7R A;  3H1I J;  2WPV B;  1AJY A;  2QEX P;  1UUW A;  1SJG A;  3M0A A;  2P10 A;  3BAS A;  4HM2 A;  5E79 E;  4QUQ A;  1CI6 A;  4I7Z C;  1LJ2 A;  2OQQ A;  4H0L B;  1BGY G;  2JO1 A;  2PGD A;  2YKQ A;  1VQL P;  1ZXG A;  4H0L C;  2R5B A;  2C9L Y;  3B5N D;  3M9Q A;  1T2K D;  1NTM K;  2QJY C;  1URQ D;  3V2Q A;  2C9N Y;  1A02 F;  1BGY D;  1S4X A;  5AW1 B;  1BE3 J;  2WZ7 A;  2OYI A;  2B24 A;  1M90 Q;  2P67 A;  3CXH D;  1NWQ A;  1GL2 C;  1H88 A;  2W90 A;  1AQ5 A;  2ZVO B;  4ZNC A;  1FC2 C;  4HM0 A;  1N7S D;  1SQQ J;  3C8V A;  1MZ9 A;  1ZOY C;  4HM5 A;  2E4P A;  1LWU B;  3G6E P;  1L4A A;  3H1J D;  4GIF A;  2ZT9 C;  2A06 E;  1LWU C;  1OVR A;  3BRT B;  3CD6 P;  1S9K E;  4RKU J;  3V2N A;  4MN4 C;  4GT1 A;  4OGQ C;  1ZW0 A;  3O8Z A;  4IL6 H;  2B88 A;  4D6T G;  2E75 D;  1FBM A;  2N9B A;  3HD7 C;  2W6J H;  3E7K A;  2OGU A;  4HJG H;  3D71 A;  5KKZ B;  1SQV K;  2FYU G;  2J58 A;  1YIJ P;  3O6Q A;  5E79 H;  3VMG D;  2Z5H A;  4QDD A;  2O1J A;  1ZRT E;  1KC8 Q;  3H1H G;  3L75 E;  3VMI D;  2YFL A;  3PTZ A;  3FGA D;  3G71 P;  1VQO P;  4D6T D;  1ZR2 A;  1NJI Q;  2FBW C;  1EDK A;  5AVR B;  3C9I A;  4GOE A;  1HWT C;  1K9M Q;  5B66 H;  1IFM A;  2KYV A;  2SPZ A;  2BEZ F;  5K5G B;  1NTZ D;  3GLM A;  2NVF A;  1QVG O;  3H1I E;  4JYB A;  3CX5 I;  2LXC B;  1FDM A;  1FZA A;  2NPS D;  2WSF J;  2NRG A;  3TNU A;  3A0H H;  3II6 A;  1RE4 A;  3L75 D;  3IR9 A;  2E76 B;  2IBZ G;  3P8C D;  2WWW A;  4WB4 A;  2ZYL A;  1SFC C;  1EXJ A;  2IFM A;  3GHG A;  1RE3 C;  4OGQ D;  4B86 A;  2G8Y A;  1J1D B;  1NVO A;  1SFC B;  3W68 A;  3HD7 D;  1DH3 A;  3L72 E;  5AVV B;  4ZMD A;  2QG4 A;  3OW2 O;  3CXH E;  2POH A;  2YKO A;  4A7P A;  3L72 J;  1VF5 C;  1N8R Q;  3CX5 E;  3L4F A;  3GZY A;  1BCC J;  5KLI C;  5M1B A;  1OW7 A;  4I6M C;  1NTK J;  1N7L A;  1RFS A;  4KHX A;  1H89 A;  4NBE D;  3TNU B;  3A0B E;  3GOB A;  4H0L D;  2CKF A;  4BXL A;  2JR8 A;  1QVF O;  2W27 A;  1MFT A;  1JMM A;  1EZV G;  1GW3 A;  2YO2 A;  5AVU B;  2ZYA A;  5HL4 A;  3TSI A;  3GCE A;  3EWK A;  3HUS B;  5AVT B;  1EZV I;  1OW6 A;  1NTM J;  1T3U A;  2AEF A;  2GUS A;  3H25 A;  1DIP A;  1NH4 A;  2W6B A;  1AV1 A;  1Z56 A;  4OVN F;  2E43 A;  2L5G B;  1ZP0 C;  1SQX E;  1ZME C;  2GUV A;  1L0L G;  1SQQ K;  1SLQ A;  5B5E E;  2E42 A;  3WMM 0;  1LTS C;  1M1J C;  4UB6 E;  3L75 G;  1SQB K;  1P84 H;  3H1H J;  1SQB D;  2FY8 A;  4W80 A;  2RN0 A;  1DEE G;  2UWJ E;  3Q3D A;  3H32 B;  5AVQ B;  1BSN A;  2XDJ A;  1VPC A;  2CPS A;  3L70 D;  2J5U A;  3JC2 2;  1OVU A;  2VRS A;  1PGO A;  3C0D A;  3MHV A;  2KZI A;  1VCK A;  4IFD K;  2XND H;  1N2D C;  2FYN B;  4NBD D;  5CCG C;  1YBK A;  5DJT B;  2GA1 A;  4AAY B;  3GF3 A;  3TDK A;  1FAV A;  2C0X A;  2H88 C;  1GU4 A;  2YIU C;  2ZVN B;  2KP8 A;  4HYT B;  4H44 B;  3S1K A;  3CWB D;  1PZQ A;  3H1J E;  3N7N A;  4Y99 C;  4N78 E;  2KS1 A;  3L73 G;  2HLO A;  1SQV D;  1WMK A;  1VQM P;  1VQ9 P;  2OYH B;  1BGY J;  2NUM A;  2BAS A;  3L74 J;  2E74 D;  3HTK A;  3M9H A;  3C1L A;  1IFI A;  1PGJ A;  2NPS C;  1IO4 A;  1X22 A;  3AE5 C;  2ZXX A;  3RK2 D;  1LTA C;  1S9K D;  1FJP A;  3PRJ A;  3FXE A;  1FOS F;  5B5E H;  1SFC A;  2YO3 A;  2ZT9 D;  1NGM B;  3H1K D;  2K9Y A;  4U3F D;  4YXD C;  1IFN A;  4I1L A;  1VQK P;  3RBZ A;  3OJA B;  3E1I A;  1PL5 A;  1S2E A;  2IBZ E;  1USE A;  1CI6 B;  3AEG C;  3L70 G;  3GG2 A;  1FS0 E;  1SQP E;  1LTG C;  2OTJ P;  3TGU D;  2HML A;  2W8Z A;  4TT3 H;  1FE6 A;  1HH0 A;  3B4S A;  1QL2 A;  1VDF A;  3H32 A;  2XKM A;  1Q90 D;  1YYC A;  2IZ0 A;  1BE3 D;  1MUU A;  5TJH A;  4NPF X;  5AVX B;  3CPW O;  3VOP A;  4N6J A;  4QDF B;  1J1E B;  2HFE D;  4U3F E;  1BCC E;  1ULJ A;  4H44 C;  3FOU A;  5B66 E;  1M1J A;  3VMA A;  1EG9 A;  2Q5U A;  1JCD A;  4HM1 A;  5APV A;  1AQT A;  1OWA A;  3TK1 A;  2WT7 B;  1PP9 E;  4QCK A;  4NPE A;  1H8A A;  2IYP A;  2Z4E A;  3EQQ A;  1O7M A;  2N1T B;  3RK2 C;  1CW5 A;  1O7N A;  1Q2N A;  1VQ6 P;  5KLV G;  2O01 N;  1RQV A;  2K3R A;  1RY3 A;  2WIT A;  2QPZ A;  3VP8 A;  1L0N G;  3V4Q A;  3L71 E;  2IFN A;  1SQX G;  2BCC E;  3SWF A;  2D2C D;  1FZC B;  2KSE A;  5KTB A;  2M3E A;  4RJT A;  5TIS H;  3VMX A;  3MTU E;  3G9R A;  2IBZ D;  2I7F A;  1YQ3 C;  3H1L J;  1KIL E;  3SFE C;  2O01 J;  1FQT A;  1KFN A;  4I7Z B;  1D7M A;  1Y9B A;  3L71 J;  5CCH C;  3A7O A;  3D89 A;  3EN1 A;  2JZA A;  2A45 I;  2NUK A;  3IFM A;  1H0T A;  1NU1 G;  3AE1 C;  1SQX J;  2OYH A;  2WSS H;  1JB0 J;  3GL0 A;  1NTM G;  3RL0 B;  2W83 C;  1T2K C;  4NBG D;  3K5B A;  1JY2 O;  1KTM A;  1NTM D;  2KSJ A;  3BAT A;  1NTM E;  2RMZ A;  2WSC J;  1SQP K;  3QWO C;  1MFZ A;  3PH0 A;  1KZU B;  2ZAE B;  1LTI C;  3QH9 A;  1FZC A;  1JM0 A;  1HF9 A;  1YJ9 P;  5APY A;  2E5T A;  2HMM A;  2FXP A;  2W6A A;  2OTK E;  1R5L A;  4HB1 A;  5AW4 B;  4IL6 E;  1PP9 J;  3RL0 g;  2KOG A;  2G3A A;  1JTH B;  2AEJ A;  1GTW A;  3HE5 B;  1RE4 C;  1LT1 A;  2RH0 A;  1AFO A;  3FWL A;  1QLE D;  3Q5S A;  3AED C;  5AVY B;  2K88 A;  1L0N E;  2XR8 A;  4UB8 H;  1UUV A;  2O1K A;  1KYO H;  4IFF A;  2AEM A;  3DQY A;  3UIA A;  2WPS A;  3U59 A;  3L75 J;  4PJ0 E;  5CMZ A;  2YMK A;  3A5T A;  2B87 A;  1URQ C;  1GMJ A;  1L4A B;  3GTE A;  1RF0 A;  4L75 A;  1HGZ A;  2RKL A;  3H1L G;  2WMM A;  2M5A B;  2HG5 D;  2R5D A;  1BDC A;  1LTJ A;  1L4A C;  1JTH A;  1M56 D;  1SQB G;  2OYO A;  4H13 B;  2QSI A;  1H0T B;  2HMN A;  2JWD A;  1LTB C;  4ZKU A;  3O6Q B;  3VCP A;  1K05 A;  2Q3W A;  1KB9 D;  3AE3 C;  1N73 C;  1GW4 A;  5AW2 B;  4DCK A;  1DX7 A;  1ULI A;  3D70 A;  1YIT P;  3H1K J;  3U1A A;  1VQ7 P;  1BDD A;  1W2E A;  1JY2 P;  2JP3 A;  2FKW B;  1QGK B;  4O9B A;  1N86 A;  1E5W A;  3L74 G;  1FZF A;  5AVZ B;  1QX8 A;  1SQQ E;  1S5L H;  1YI2 P;  1KIL C;  1T8Z A;  2I1J A;  4HM6 A;  2D2C C;  1FDO A;  4XFJ A;  4ASW A;  1A02 J;  1QL1 A;  3L73 J;  1EDJ A;  3NTN A;  3CX5 H;  2CK3 H;  2D2C B;  3CMA P;  2YIU B;  5CHX A;  4N78 D;  3Q2Y A;  4BWN A;  2KLV A;  4BRY A;  3M91 A;  3RGU A;  4HKZ H;  2A06 D;  5KLV E;  2QJY B;  3F5H A;  3L35 A;  2NZ2 A;  5AW6 B;  5BVZ A;  2KIK A;  2KS1 B;  5AEW A;  1S5L E;  1GL2 B;  3L70 J;  2B87 B;  5CCH A;  4DZO A;  1URQ B;  4K35 A;  1IFD A;  3CCU P;  4RO0 A;  3WU2 H;  1XTG B;  4WY4 A;  2ZFC A;  1RF0 C;  3HUS C;  2Q3E A;  3M06 A;  3BRV B;  1AA0 A;  3H1I G;  1N7S B;  2GBW A;  1G1I A;  4C7N B;  5CBN A;  1G8K B;  1ZV8 A;  4WVZ A;  2XZR A;  2Q6Q A;  3HE5 A;  1O7G A;  2JO6 A;  3OAK A;  2GM4 A;  1KOR A;  3CCQ P;  1KD1 Q;  1GK4 A;  3OA7 A;  1IK7 A;  3Q5R A;  1FJK A;  3FX0 A;  1L0N J;  3L37 A;  1KIL D;  2P58 A;  4HM7 A;  1OZH A;  1R5S A;  2ITA A;  3TGU E;  1YQ4 C;  3KYQ A;  1OMI A;  1UIX A;  3WUU A;  2KNC A;  1NTZ E;  1CZQ A;  3MP7 B;  3P8M C;  2FYU E;  1YTZ I;  1MV8 A;  1VL2 A;  3RK3 D;  5CCG D;  1SQV E;  1L0L D;  3P8C E;  2FYN C;  3JCU H;  3AE7 C;  1Q86 Q;  2DE5 D;  3H1H E;  1M1K Q;  1G2C B;  1KQS O;  1OW8 A;  1HUC A;  2XSO A;  1JM1 A;  3RK3 E;  3FXD A;  3CCJ P;  3E1R A;  4CPG A;  1PGP A;  1NKN A;  2YKP A;  2QRX A;  3HTK B;  3IF4 A;  3VTP C;  1HBW A;  3TGU J;  1EZV D;  1EC5 A;  1LTJ B;  1O7H A;  4XA4 A;  1L0N K;  1U57 A;  3GMA A;  1X9V A;  3B8E B;  1SS1 A;  1RE3 A;  1GD2 E;  3H1J G;  2K37 A;  2M5A A;  1WT6 A;  1NU1 J;  2CPB A;  5AW3 B;  1LT9 C;  1OFC X;  4OWF A;  5BOK A;  3LIE A;  4WBA A;  5KLV D;  2Z5I A;  4DJG A;  2NPS B;  2FYU K;  4JF7 A;  1KYO D;  1T3J A;  1SQQ D;  4GOF A;  1NTZ K;  5KAI H;  2A45 G;  1RF1 A;  1U7M A;  3KPE A;  1IC2 A;  4PD4 E;  3A3Y B;  2R3S A;  1PPJ G;  3AEA C;  2YVJ B;  3R4Y A;  1JMB A;  1NTK E;  1S3J A;  1EXI A;  2AXC A;  5KKZ C;  2E76 D;  1LP1 A;  2P1J A;  4OGQ B;  2NVG A;  1TU3 F;  4WY4 D;  4R4L A;  4N3Y B;  3HD7 B;  2DW3 A;  2WPQ A;  5APW A;  3KHU A;  3AE9 C;  3PHL A;  1IFJ A;  1QEX A;  2H43 A;  3AEF C;  4KT0 J;  1ZR4 A;  2Q9I A;  1L0L E;  3HE4 A;  2QM7 A;  3RL0 C;  2KK7 A;  2WQY C;  1PPJ D;  2HPC B;  3TYY A;  4NBB D;  5CXM A;  1SP4 A;  2LXB A;  2QIW A;  1NTZ J;  2YNY A;  1DEB A;  1J1E C;  3HUS A;  3P32 A;  1SQB J;  4QDF A;  5GTI H;  2QVA A;  3CXH H;  4AUW A;  4NPD A;  2GBX A;  1DD4 A;  1M7L A;  3HD7 A;  1JY2 N;  2BCC D;  1NAY A;  1GL2 D;  2R32 A;  1LGH B;  3CCV P;  4HM4 A;  1KN7 A;  4IFM A;  3M0D A;  5AW8 B;  4L76 A;  3MIW A;  5KAI E;  5CJ0 A;  4WWI A;  3AEB C;  3GL2 A;  2DE7 D;  2WPR A;  5AW0 B;  4D6T E;  1FDI A;  1G2C A;  2E75 B;  2Q3I A;  3IAO A;  1VQ8 P;  1BE3 E;  5BU8 B;  3L72 D;  2QJK B;  3KZI H;  4QDC A;  4IL6 X;  5GTI E;  3L73 D;  4AQR D;  4RES B;  2Q1K A;  3CCL P;  4EIJ A;  3H1J J;  1SQP G;  2R3C A;  1VM9 A;  1HJB A;  3NXS A;  3TGU G;  1G8J B;  1YJW P;  2FYZ A;  2AXT E;  4NBF D;  3AEE C;  3RK3 B;  4JPZ B;  2BMO A;  4H44 D;  2IDB A;  1VQ5 P;  3VYI A;  1VQN P;  2WVR A;  1S5L X;  2E5Y A;  1Q7Y Q;  3IN6 A;  4AYC A;  2E74 C;  2N1T A;  1YJN P;  2YFI A;  3R2P A;  1SQP D;  1KQG B;  1JY3 N;  1KV4 A;  2XNX A;  1GZL A;  2XRX A;  1WRG A;  2FXO A;  2QM8 A;  3WU2 E;  4NB9 D;  2E74 B;  1L0L K;  4JQ0 D;  2JWA A;  3L74 E;  3M0D C;  4D6T J;  3CC7 P;  1JCC A;  5APX A;  3PP5 A;  2P2U A;  2ZXE B;  3G4S P;  1FU1 A;  2FXM A;  4KJM A;  1USD A;  2NWF A;  3L71 G;  3H1K E;  3LID A;  4HJL A;  1KFM A;  1KB9 I;  2M8R A;  1HTL C;  3WUV A;  3CCE P;  1X0T A;  2FFD A;  1NYH A;  2E76 C;  1HJ0 A;  3VN0 A;  4EOT A;  4PV1 B;  3SFD C;  2BCC G;  5KLV K;  3BCC D;  1PGQ A;  5KJ7 C;  3CCS P;  5CBO A;  1OXZ A;  1T6A A;  4L74 A;  2H7H A;  1RF1 B;  2K9J A;  3T97 A;  3AEC C;  4WY4 B;  3CWB J;  1L0L J;  1HVV A;  4PD4 I;  2MJZ A;  4Y99 B;  1JUN A;  3CL3 D;  5KLI B;  3HE4 B;  2OYI C;  4UB6 H;  2OYH C;  1KB9 E;  2KI7 B;  2A45 H;  3CME P;  3L74 D;  3CCM P;  4JBZ A;  2NVE A;  2WSC H;  3V2R A;  5H2F H;  2OYI B;  4LC1 A;  3KDP B;  1RIE A;  4BRY B;  1NTK K;  5APQ A;  1NTK D;  3VMY A;  1NAF A;  3ZDM A;  1BSH A;  1X79 B;  3SSU A;  4XE5 B;  4PD4 D;  3W67 A;  4EYY Q;  4Y28 J;  2JKV A;  2HMK A;  2N1T D;  1OIP A;  3H1L D;  4EI2 A;  4NB8 D;  4PJ0 H;  1NU1 E;  2B9B A;  4EDF A;  2Y0D A;  3AE8 C;  1Q81 Q;  2YXQ B;  3BCC G;  1EDI A;  3CC2 P;  3EFF K;  2C0W A;  1NTZ G;  4M3L A;  5KAF E;  3BVH A;  1SQQ G;  1S72 P;  1FZB A;  2N9Y B;  1SQX K;  2KB7 P;  3L70 E;  5BU5 A;  2PAJ A;  1AVO A;  3S4R A;  1K73 Q;  2KUB A;  2HOD B;  2OAR A;  4C46 A;  3GB4 A;  3H1H D;  2DE6 D;  1RF1 C;  2IBZ I;  2WT7 A;  2FFD C;  5APT A;  3LW5 J;  2HYN A;  2YXR B;  3B71 A;  1U7J A;  4YTP C;  4R4M A;  4U7J A;  2FYU D;  1SVF A;  5APU A;  3ITK A;  4LLH A;  2BMR A;  2ZJS E;  1LTJ C;  4GKG A;  2JDI H;  1RHZ B;  3CCR P;  4P1B H;  5AW5 B;  1Y47 A;  3U1C A;  1URQ A;  2L91 A;  3RK2 B;  2PFX A;  2BCC J;  4DT0 A;  3WUT A;  2XV5 A;  3VMZ A;  2LKM A;  1KYO I;  3MGN A;  4YPC A;  2ZT9 B;  3A0H E;  3MD0 A;  5C39 A;  3N4X A;  3I5C A;  3CC4 P;  5KJ7 A;  1E79 H;  3I55 P;  1K04 A;  2AXT H;  2N1T C;  2KLU A;  3AE2 C;  1LT9 B;  1YHQ P;  2O01 H;  2QA4 P;  3EFG A;  2HMO A;  3V4W A;  3VP9 A;  4DOJ A;  3FWN A;  1J1D C;  3CI9 A;  3MUD A;  1M57 D;  4GDO A;  2YMY A;  4ZKP A;  1FOS E;  1JNM A;  4W7Y A;  3H1I D;  3L72 G;  1VF5 B;  2KZJ A;  3GF7 A;  1GL2 A;  2BMQ A;  1BGY E;  1W5C E;  1W2B O;  3VCA A;  5KJ7 D;  3GKE A;  4HM8 A;  2NPS A;  4U3F J;  3CLQ A;  3V5B A;  4PV1 D;  1OX3 A;  5KLV J;  3RK3 C;  4NBA D;  5CCG A;  1IJD B;  1IFP A;  1SQV G;  3A0B H;  5CJ4 A;  1KYO E;  2HOD A;  1SQX D;  1EDL A;  1IK9 A;  5GTH H;  3M9B A;  4JYC A;  2WSF H;  4QMA A;  1ZRT D;  1OVV A;  2A06 G;  1P84 E;  3NFQ A;  5AVW B;  3H6P A;  3G3Z A;  4EMJ B;  4AIV A;  4HM3 A;  3F89 A;  4TLF A;  1O7P A;  3KQG A;  4YXW H;  4W7Z A;  1KIL A;  3KZI E;  1L4A D;  2PP6 A;  1XTC C;  5AW9 B;  1SQP J;  1YTZ T;  2B1X A;  5AW7 B;  4OH8 B;  5TIS E;  2IYO A;  2H89 C;  4I2L C;  4NBC D;  4Z1M H; 
#chains in the Genus database with same CATH homology
 4NB9 D;  3VMH D;  2HMN A;  1NTM E;  3VCP A;  1PP9 E;  4QCK A;  4HM0 A;  3L74 E;  2Q3W A;  4H13 D;  3EQQ A;  4P1C H;  1O7M A;  1SQB E;  4NBH D;  4HM4 A;  3AZC A;  4HM5 A;  2E4P A;  1O7N A;  5BOK A;  2HMK A;  2GBW A;  1SQX E;  1ULI A;  1G8K B;  2NWF A;  2ZT9 D;  2XSH A;  3H1K E;  1PPJ E;  4HKV A;  1NYK A;  4NB8 D;  2HMM A;  1NDO A;  3GL2 A;  4HJL A;  2DE7 D;  2A06 E;  2QPZ A;  1NU1 E;  1O7G A;  2JO6 A;  4D6T E;  2HMO A;  4PD4 E;  3L71 E;  1SQQ E;  2YVJ B;  2HMJ A;  1NTK E;  2ZYL A;  2BCC E;  2IBZ E;  5KKZ C;  4OGQ D;  2E76 D;  3BCC E;  1BE3 E;  2E75 D;  2D2C D;  5AEU A;  4HM7 A;  4HM6 A;  1WQL A;  3TGU E;  1EZV E;  1SQP E;  1UUW A;  1SJG A;  3GZX A;  4QDC A;  2BMQ A;  1BGY E;  3L70 E;  2NVG A;  4HM2 A;  3L72 E;  3VCA A;  2HML A;  3C0D A;  4QUQ A;  3CXH E;  3L73 E;  2YFJ A;  1VCK A;  3GKE A;  2I7F A;  2QJK C;  1NTZ E;  1O7W A;  3CX5 E;  3GZY A;  3VMG D;  4HM8 A;  4NBD D;  4QDD A;  5KLI C;  1VF5 D;  2FYU E;  1ZRT E;  4AAY B;  1VM9 A;  1FQT A;  4PV1 D;  3L75 E;  3VMI D;  1L0N E;  2XR8 A;  1SQV E;  1Q90 C;  1UUV A;  1G8J B;  4NBA D;  2YFL A;  3GB4 A;  2FYN C;  2E4Q A;  1RFS A;  2DE6 D;  2YIU C;  4NBF D;  3DQY A;  4NBE D;  2DE5 D;  3H1H E;  4QDF B;  1KYO E;  1L0L E;  3CWB E;  3D89 A;  3EN1 A;  5KLV E;  3GOB A;  2JZA A;  4H0L D;  3GTS A;  4QUP A;  2XSO A;  3H1J E;  4U3F E;  1JM1 A;  1KB9 E;  4NBB D;  1BCC E;  2CKF A;  2NUK A;  1ULJ A;  3H1L E;  5CXM A;  1P84 E;  2BMO A;  4H44 D;  2BMR A;  5AEW A;  4EMJ B;  4AIV A;  4QUR A;  4HM3 A;  2NVE A;  3GTE A;  1O7P A;  2QJY C;  3FOU A;  3GL0 A;  1EG9 A;  4NBG D;  2NUM A;  5HL4 A;  2YFI A;  4QDF A;  3GCE A;  2B1X A;  2NVF A;  2E74 D;  4P1B H;  3H1I E;  1O7H A;  1RIE A;  2B24 A;  2QJP C;  2XRX A;  3N0Q A;  4HM1 A;  4NBC D;  2GBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...