2E74D

Crystal structure of the cytochrome b6f complex from m.laminosus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
total genus 30
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e74D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e74D02
2YMKA 4NBFD 4H0LC 3DQYA 3GL2A 1O7NA 2NWFA 2NVGA 2XR8A 1WQLA 1NTZE 1O7MA 1UUWA 4AIVA 4P1CH 1FQTA 4HM7A 1NTME 3AZCA 2D2CD 4OGQC 2NUMA 1SJGA 4EMJB 3H1JE 1SQVE 4NBCD 2YFLA 1O7HA 1UUVA 3VCAA 1NTKE 3GCEA 3H1IE 2HMJA 4QUPA 3D89A 4I7ZC 4U3FE 5KLIC 2YIUC 5AEUA 1SQXE 3C0DA 3GTEA 3GZXA 1BE3E 3GZYA 5BOKA 4NBHD 4H13D 2DE6D 1EZVE 4NBGD 3VMID 2FYNC 1L0NE 1L0LE 2BMRA 1BCCE 4QDCA 3TGUE 4H13C 1RIEA 3L75E 2BMQA 4HM0A 4HM5A 3EQQA 3VMHD 2QJYC 2YFJA 2DE7D 2B24A 2BCCE 3CWBE 3L70E 2XSHA 4P1BH 1ZRTE 1SQPE 4HM6A 2GBXA 1JM1A 4HKVA 1ULIA 2D2CC 1Q90C 1O7GA 4H44D 1SQQE 5KLVE 3L72E 4HM2A 5KKZC 2XSOA 1VCKA 5HL4A 1VF5D 3H1LE 4HM8A 2FYUE 1RFSA 2JZAA 4QURA 1KB9E 3CXHE 4NBDD 4HM3A 1KYOE 3FOUA 1P84E 1O7PA 4H44C 2E4QA 4PD4E 3H1KE 2HMLA 3GKEA 2ZT9D 3L73E 1VF5C 4PV1D 1NDOA 2CKFA 1PPJE 2BMOA 4AAYB 3L74E 1PP9E 3H1HE 3VMGD 2E74D 4NB8D 2DE5D 3BCCE 2NVFA 4H0LD 2ZT9C 2NVEA 3GB4A 4PV1C 1G8KB 2ZYLA 2QJPC 2IBZE 2Q3WA 4QUQA 1EG9A 4HJLA 2HMNA 4QDDA 5AEWA 4HM1A 1NU1E 3EN1A 3L71E 4OGQD 4HM4A 2QJKC 3GOBA 1O7WA 2JO6A 1ULJA 4QDFB 2E4PA 2GBWA 2E75D 2HMMA 4NBBD 2YFIA 4NBAD 1VM9A 2B1XA 2QPZA 5CXMA 2XRXA 4NBED 1G8JB 2YVJB 2HMKA 3VCPA 3CX5E 2E75C 3GTSA 2E76D 2NUKA 4NB9D 4QCKA 3GL0A 3N0QA 1NYKA 4QDFA 2E74C 2HMOA 2I7FA 2A06E 2E76C 1SQBE
chains in the Genus database with same CATH superfamily
5CCGA 4NBFD 2NWFA 2QM7A 2KNCB 2YXQB 1NAYA 1PL5A 5GTHH 4HM7A 3T97B 1LT1A 1OXZA 2Q6QA 2O01J 2HFED 1NAFA 3EFFK 2JEEA 3H1HG 1SQXE 1NO4A 4PD4H 3PH0A 3D6ZA 4Z1MH 3L74J 2QJYC 1A02F 2Q7CA 1IFIA 3L37A 2A45I 3VTPC 1KFMA 1LTIC 5KLVE 2NPSD 3FOUA 4RO0A 2P58A 3WU2E 5AW5B 1PPJE 2IFNA 1WRGA 3BATA 4TT3H 2ZFCA 5H2FE 1KV4A 1M1JC 1IFMA 1BGYD 1NU1E 3II6A 1FDMA 5KLIB 2H7HA 1SQXG 1ULJA 1ZN5A 3I5CA 3H1ID 1Q82Q 2E75C 2A45G 1LP1B 3AEGC 1JTHA 1P84D 2HPCA 1PIXA 1WQLA 4AIVA 1HGVA 1SFCD 2J59M 4EDFA 1CI6B 5CJ0A 4RKUJ 3CCUP 2KZJA 4B86A 3H6PA 1QX8A 2W90A 3VCAA 1K8AQ 4DJGA 1PPJG 3D89A 2B87A 2FXPA 4YXWH 1UIXA 1LWUC 2JWDA 3C0DA 2DE6D 3T97A 1X8YA 1NU1G 4L76A 2ZYDA 4BRYA 1LGHB 2ZYGA 4WY4D 5AW0B 2ZXEB 3M0DA 1LTGC 1N86A 4HH2A 5AVSB 2M5AB 4HM6A 3TDKA 3Q5SA 4HM2A 1KC8Q 1SQXK 1JUNA 1KILE 4GOEA 3CCMP 3O8ZA 2I1JA 2FYZA 4JQ0D 2N1TA 1N2DC 5AVUB 4AAYB 1BCCG 1URQD 2ZT9C 1HTLC 5KJ7C 2WQYC 1WMKA 2K9YA 3KXDA 4HM4A 5KLVK 3USSA 4JF7A 2GBWA 1LT9C 1VQOP 3H1KG 3G71P 3G9RA 4IL6E 2JKVA 3C9IA 1JY2P 2E43A 1BE3J 4DCKA 3CXHD 1JNMA 2V7QH 4LLHA 4KHXA 3LW5H 4D6TE 1ZV8A 1EDJA 2BEZF 3EQ2A 1FQTA 1LP1A 1JB0J 4XE5B 1AVOA 3H1IE 4GODA 1FJPA 2HMJA 1PGPA 1X0TA 3GZYA 5BOKA 3CCJP 2B9BA 1IK7A 3L36A 1T6AA 3SSUA 1CI6A 2WPRA 4AUWA 5AVXB 1K05A 2GBXA 1DD3A 1RE3A 2JP3A 2LR2A 3KYQA 1E79H 5K5GB 2AEJA 1JY3N 2KI7B 2AEMA 1HWTC 3CL3D 2IDBA 4PJ0H 1KFNA 5APTA 4H0LB 2M5AA 2CKFA 4D6TG 2N9YB 1PP9E 3M0DC 2W83C 4NB8D 1FC2C 3M06A 5CCHA 2ZYLA 1U7JA 1R5LA 1J1DB 2P2UA 2OYIB 2H89C 1S72P 3H1IG 2K9JB 4QDFB 1KILA 2KSEA 1KB9I 3CCSP 1L4AD 2WT7A 2WSSH 3AEAC 3VN0A 1YI2P 2HMOA 1GU4A 1SQBE 3CLQA 1U57A 2JR8A 1VQMP 1JM0A 1FZAA 2GA1A 2KOGA 3L70J 2NUMA 4EMJB 3W68A 3L4FA 1MZ9A 4H44B 2JDIH 3U59A 3CCEP 3OW2O 4U3FE 3RL0D 3H32B 5KLIC 1IFNA 3A0HH 1P84H 1RE4C 2LXCB 3CPWO 1KQGB 2OTJP 1HJBA 1AJYA 3H1HJ 3BCCD 5GTIE 1FOSE 3E1RA 1S4XA 3EFGA 2I1KA 3VP9A 1O7GA 3B71A 2L91A 3L72E 3RK3D 4HM8A 1NTMD 1ZP0C 2E4QA 1SQBG 2E76B 2LXBA 3KHUA 2B88A 1JMBA 3A5TA 5B5EE 1RF0A 3AEDC 1NH4A 4A7PA 4JBZA 5AEWA 3I56P 3GG2A 5C39A 3EN1A 1YQ4C 4GKGA 1JCDA 1FBMA 2WVRA 3OJAB 1VM9A 2O01N 4WB4A 1G2CA 2Z5IA 3AE8C 5CCHC 3AE5C 2OYIA 1SQXJ 4WY4A 1KYOD 3KZIE 4QDFA 3N4XA 3JCUH 1SVFA 4U7JA 1FDOA 1N7SD 2XR8A 3L72G 3VOPA 1YJWP 2KK7A 2IBZD 4WVZA 3D70A 3V4WA 2G8YA 3IF4A 3L71D 1NHLA 3CXHH 3GTEA 1H0TA 4H13D 2M3BA 3EWKA 3S4RA 1ZXGA 3CX5D 1SQBK 4QDCA 3TNUA 1Q2NA 1HUCA 1M8OB 1OWAA 2AXCA 3H32A 4P1BH 3RGUA 5GTHE 2P7JA 3F89A 1YBKA 1NU1J 3U1CA 1UIIA 3E1IA 1IFJA 1JY2O 1FS0E 1Y9BA 1OFCX 2QG4A 4PD4E 3L73E 5B5EH 2P67A 1NDOA 1NTKD 3FXEA 4PD4I 1VQLP 3G3ZA 3BCCE 1DD4A 4RJTA 3MTUE 2XDJA 4HM1A 2V7QJ 1JCCA 2BCCD 3HD7D 4NBBD 1N8RQ 2WPSA 2XRXA 1G8JB 1T3UA 3MP7B 1RF0C 2NUKA 1EZVD 1GW4A 1NYKA 4K35A 4H0LC 3B4SA 3H1KJ 3RK2B 3H25A 2WMMA 2HPCB 4P1CH 1AV1A 3AZCA 4UB6H 1GD2E 1RY3A 1K04A 3H1JE 1ZR4A 2OYIC 2ZVOB 2J5UA 3P8CD 4HKZH 1VF5B 3CCVP 1USDA 1L2PA 3H1LD 1ZR2A 3BCCG 5L8RJ 4L74A 4PV1B 2B87B 4ZKPA 4L75A 3QWOC 4ZMDA 1DX7A 3VMHD 1PV3A 3EQQA 2BEQD 1A02J 3P8MC 4NPFX 1CSBA 2PAJA 5KAFE 1LTJC 4BRYB 3Q5PA 1L4AA 3SFDC 2J58A 3GMAA 1X22A 1CW5A 5HL4A 3HE5A 5CBOA 5AVVB 2PGDA 4H44C 1NYHA 4HJGH 2DE5D 3TYYA 2N1TB 1AQTA 3H1JG 4D6TJ 3TF5A 5AW4B 1GDTA 1XTCC 1U7MA 3CCLP 3H1IJ 3TSIA 3KPEA 3S1KA 3AE3C 4NB9D 2FXMA 2QEXP 1M56D 2KYVA 2UWJE 5AVZB 2R3CA 2KP8A 2I7FA 2E76C 2IBZG 3RBZA 3CWBD 5KKZB 1LNQA 1SP4A 3WUUA 2FFDA 2K37A 2K1AA 1M57D 2QVAA 1EXJA 1FZCA 1OW6A 2WTYA 1GL2B 4WBAA 4DT0A 4QUPA 4HB1A 1KYOH 1T2KC 1EZVE 4N6JA 3MGNA 2G3AA 1L0NE 2BMRA 1BCCE 1HBWA 1PP9J 3BVHA 1K9MQ 4HM0A 5KAFH 1W5CE 3MIWA 4OVNF 2YFJA 3SWYA 1ZMEC 2RMZA 4DZOA 1JM1A 2Z4EA 3R4YA 3M9BA 1NTKG 1RF1B 1DIPA 3H1LE 5CCGC 1GZLA 4IOIH 1RQUA 3CX5H 2E74B 3H1KE 2HMLA 4EI2A 1H88A 2BMOA 1T3JA 2NVFA 4H0LD 2NVEA 3G4SP 2LKMA 3KDPB 1QL1A 2Q3WA 1SQBJ 5E79H 2WITA 3TK1A 3NTNA 5TJHA 5CBNA 2JO1A 3CD6P 2R5DA 1MUUA 1EZVG 1SQVD 4NBED 2Q5UA 2FYNB 1L0NG 2WWWA 1HF9A 1KILB 2JJLA 4U3FJ 4PJ0E 4TLFA 1K73Q 3M91A 2XNDH 3RBXA 1HJ0A 1L0LD 2W8ZA 2WT7B 2W6BA 5AVWB 1Q7YQ 3H1LG 3V5BA 2QE7H 1OVVA 3AEBC 5KTBA 1Z56A 2FKWB 3L72J 2FYUD 1AFOA 2L5GB 2WSFH 1SS1A 1BGYE 1TU3F 3G6EP 4OH8B 4XA4A 3IN6A 4GDOA 1NU1K 1RIEA 1GL2A 3CWBE 2AXTH 3PTZA 3B5NA 5AW7B 3HUSA 2YO3A 4BWNA 3RK2C 4YXDC 1S9KD 1RFSA 2I8DA 2OYOA 3A0HE 1P84E 1VF5C 1L0NK 3BRTB 1P84I 2YNYA 4JPZB 1RF1A 4PV1C 5AVTB 2SPZA 4EOTA 4W7ZA 1QEXA 2FY8A 2YIUB 3ZDMA 2YO2A 2E4PA 3IR9A 1QVFO 2E75D 2RN0A 1VPCA 1VQ9P 1BGYG 1T2KD 1KQSO 2HMKA 1LTAC 5CJ4A 1FZGA 2OTLP 3U1AA 3GTSA 1YJNP 4QCKA 3GL0A 1G2CB 3CWBG 4IFDK 5B66H 4C7NA 5TISH 1OIPA 3L75D 4WY4B 1CZQA 1JY2N 1O7MA 3GF3A 1ZRTD 3F5HA 3BRVB 2N1TC 3JSVC 5AVRB 1GMJA 4ASWA 1SQVE 5CCGD 1RH5B 3GCEA 1NGMB 4NBHD 3MUDA 1E5WA 1J2JB 2YKQA 1G1IA 1H0TB 3L73J 1L0LE 4Y28J 5APWA 3JCUE 3VYIA 3BCCJ 2NPSA 1S2EA 3TNUB 2IYPA 3V2NA 2ITAA 3FWLA 3CMAP 5KKZC 1VQPP 2FYUE 1SLQA 3CXHE 4HM3A 2KLVA 2ZT9D 2HLOA 1GL2C 3CXHI 5KJ7D 3SFEC 1EDIA 1VQNP 3V2QA 4KJMA 1NWQA 5BU5A 1SQVG 2ZVNB 1NTZD 1R8EA 1AQ5A 3P32A 2JO6A 1YQ3C 2HYNA 3L70D 3H1JJ 2OQQA 2YVJB 4I2LC 1IJDB 1L0LG 1FZFA 4R4MA 1RF1C 4CPGA 2Y0CA 1SFCA 3AECC 3I55P 1VQ5P 1RE3C 2YKPA 5APVA 4ZKUA 2E74C 4AYCA 2PRRA 1HVVA 2YMYA 3H1HD 4JYBA 4QMAA 2FYUG 1SQPD 2Y0DA 3RK2D 1SJGA 5AVYB 2KZIA 3VMYA 1KQFB 3C1LA 3V2PA 1UUVA 2KS1A 2WSCH 4NBGD 2FYNC 3B8EB 2M8RA 1KILC 3A2AA 3IAOA 3L75E 2E5YA 4WWIA 2C0XA 2DE7D 2XNXA 1ZRTE 3FXDA 5CMZA 1SQVK 1FE6A 4UB6E 3D6YA 1URQA 2RKLA 1EDLA 1L4AB 1S5LH 3E7KA 3HE5B 1OZHA 3V6IA 1L0LK 1NTKJ 1SQXD 3V4QA 4GT1A 1DH3A 4OGQB 1D7MA 4I6MC 5AW1B 2Q3EA 4QDDA 4BXLA 3AEFC 2N1TD 4I7ZB 2WZ7A 1O7WA 1QVGO 2C0WA 2DW3A 2QPZA 1Q81Q 3RL0B 1JEKA 1PGJA 2ZYAA 5KLVD 3L75G 2Y9YA 2HODA 1W2EA 2VRSA 1PFIA 2NRGA 3TGUD 1L0NJ 3GL2A 2WSFJ 1BCCJ 2D2CB 1PPJD 1NTZE 3LW5J 3M9HA 3RK3E 1NTME 3O6QA 3A0BH 1USEA 2YFLA 3RK3B 1SQQD 1BSHA 2FFDB 2M0BA 1M1JA 2YIUC 1FZCB 3GZXA 3H1LJ 1QGKB 3BASA 1FAVA 2H43A 4XFJA 1OVRA 2QJKB 5BVZA 1KD1Q 1J1DC 1SQPE 1J1EB 1X79B 1H89A 4WY4C 1JOCA 1RHZB 1KORA 2CPSA 1N73B 1KYOE 1R5SA 4GIFA 1KYOI 2E74D 1NTZG 3WUTA 1VQ6P 1NTMG 3V2RA 1N7SB 2IBZE 4HJLA 2HMNA 2R5BA 3L35A 1VDFA 3L71E 4O9BA 2IBZI 3CCRP 1IK9A 4R4LA 2GM4A 5CCHD 2H8PD 2QM8A 3HRNA 4EYYQ 3AE1C 2R44A 3Q5RA 5APXA 3VCPA 3CX5E 4H13B 5KAIH 2POHA 3N0QA 4W7YA 3CX5I 1KILD 3JC22 1SQPG 4YPCA 1BGYJ 3DQYA 3LIEA 1XTGB 5E79E 1UUWA 3CWBJ 1X9VA 1M90Q 2OTKE 5AW2B 2MJZA 5AW8B 1ZOYC 1VQKP 1NTKE 1YTZI 1QL2A 5KJ7A 4NPDA 2ZXXA 2K88A 2W27A 3VMID 1MKMA 3VP8A 3L74D 3TGUE 1VQ8P 3L71G 1G1JA 1LT9A 2IYOA 1NTZK 2BCCE 2B24A 1VL2A 1NTMK 1IZNB 3CC4P 4HKVA 4D6TD 1WT6A 4M3LA 1SQQE 3HD7B 3B5NB 3HUSB 1NJIQ 1YTZT 1FJKA 1S5LX 1EZVI 2ZAEB 4UB8E 1NKZB 2OARA 3GB4A 4QUQA 1N73A 2XKMA 2AXTE 1SQPK 3SWKA 3P8CE 4Y99B 2FXOA 5KLVG 2OYHB 2IX7C 1AA0A 2HR3A 1SQVJ 3OA7A 2P1JA 2QRXA 1N7SA 3TGUG 3MZWB 2BASA 3R2PA 2BCCG 2KNCA 1L4AC 2A45H 2O3JA 3M9QA 5CXMA 1L0LJ 2WSCJ 3HTKB 1SQQG 1PP9D 4IFMA 4C7NB 3NFQA 4OGQC 3CC2P 3C8VA 1KTMA 4I7ZC 1YHQP 3S9OA 1KB9D 1EC5A 1KZUB 2FYUJ 3Q3DA 3PP5A 1ZW0A 3WU2H 3AE7C 3RL0C 2QJPB 1OW8A 5B66E 2IZ1A 3CC7P 3VMZA 5H2FH 3AEEC 5TISE 2BMQA 1JY3P 5EFWB 1OMIA 5BU8B 1MFTA 5AW3B 4HYTB 1QLED 1SQBD 1YITP 1ULIA 2NPSB 2D2CC 1Q90C 2GUSA 4H44D 1NTKK 2XSOA 1VCKA 5CHXA 1NOHA 2KLUA 4UB8H 2W6JH 4RESB 3RK3C 5DJUB 2FFDC 2AEFA 2QIWA 3L74E 4U3FD 5AW6B 1T8ZA 1FZCC 3HD7A 3W67A 2HG5D 1RE4A 2C9LY 1DEBA 1W2BO 3VMXA 3CI9A 2W6AA 1Y8AA 2QJKC 3FWNA 1SQQK 2P10A 1FOSF 2KSJA 1J1EC 4LC1A 3L72D 4K3AA 1BE3D 1YIJP 2E76D 1GU5A 2CPBA 3M0AA 1N73C 4L73A 2Y0EA 2OYHA 2WSEH 1VQ7P 1SFCB 3AE2C 5APYA 3L75J 4EIJA 1FU1A 2PP6A 2XZRA 3NMDA 3GLMA 1N7SC 2RH0A 2Q3IA 2KUBA 2N9BA 3L74G 4IFFA 3HTKA 3HE4B 4ASVA 2YKOA 2KS1B 1FZBA 3FGAD 4H13C 1MV8A 1M7LA 2O01H 2C9NY 2R3SA 2IFMA 1DEEG 2B89A 2YXRB 3PJSK 1S3JA 3GHGB 1KB9E 4NBDD 4IL6H 1EDKA 1URQB 2ZJSE 3RL0g 1N7LA 3N7NA 4GOFA 3GW6A 3D71A 3A7OA 2WPQA 4N3YB 2A06D 2KXPB 3QH9A 2PFXA 4NPEA 5AW9B 1LTJB 4OGQD 1NKNA 1MFZA 1BDDA 1NTZJ 5APQA 4YTPC 1NTMJ 3VMAA 2HMMA 3PHLA 3Q1MA 1ZLLA 3PRJA 1S5LE 3HD7C 1YJ9P 3B5NC 2XV5A 3NXSA 3HUSC 5DJTB 1PP9G 2QJYB 4PD4D 3L73D 2YMKA 1HH0A 2HODB 1O7NA 1S1CX 2NVGA 5APUA 4C7RA 1S9KE 2D2CD 1PGQA 1Q90D 1SQPJ 4W80A 4N78D 4Y99C 1O7HA 2K3RA 3IFMA 1GW3A 1RQVA 3ABVC 3O6QB 5AEUA 1H8AA 2OYHC 1BE3E 3GF7A 1M1JB 3K5BA 4MN4C 1GTWA 1LTBC 1VQ4P 2WPVB 1IFPA 3CCQP 2O1KA 4JYCA 2XSHA 1OX3A 1NVOA 3HE4A 1KB9H 2QSIA 2H88C 3A0BE 3L71J 2E75B 1LTSC 1OW7A 5APSA 1VF5D 4U3FG 2JZAA 3MHVA 1O7PA 5M1BA 2E42A 3H1JD 4LGDE 3GKEA 2M3EA 1PGOA 4PV1D 1BDCA 3ITKA 3VMGD 1M1KQ 3CMEP 3SWFA 3GHGA 1EXIA 2K9JA 1AVYA 2QJPC 3MUDC 1KMIZ 3GOBA 1LWUB 1BE3G 1BSNA 2YFIA 4NBAD 1IO4A 2B1XA 1GK6A 4C46A 1YYCA 3Q2YA 2IPPA 1KN7A 2NPSC 1LJ2A 1OVUA 4I1LA 5KLVJ 1JY3O 2IZ0A 1LTJA 3AE6C 1EQ7A 3FX0A 2E5TA 3P7KA 2A06E 3MD0A 2QA4P 3TGUJ 3AE4C 5GTIH 2Q9IA 2BCCJ 2FYUK 3AE9C 1KQLA 4NBCD 4ZNCA 1SQQJ 2CK3H 2R32A 2ZT9B 5KAIE 2JWAA 3OAKA 2KB7P 4HM5A 4DOJA 3L70E 2OGUA 1JO5A 1LT9B 1SFCC 1NU1D 4N78E 2FBWC 1Y47A 1GL2D 2NZ2A 4QURA 2MKVA 3LIDA 3B5ND 5AVQB 2A06G 2Z5HA 4IL6X 2KIKA 3H1HE 1FZEA 3KZIH 1Q86Q 3UIAA 2V4HA 1G8KB 1IFDA 2GUVA 1EG9A 1L0ND 1BCCD 1IC2A 2WSEJ 4OWFA 2XU6A 1JTHB 2Q1KA 1LTTC 4AQRD 3A3YB 1GK4A 3PLNA 1HGZA 1PZQA 1JMMA 3WMM0 1FDIA 3L73G 4KT0J 3GHGC 2Y9ZA 3KQGA 3L70G 1LWUA 2O1JA 3H1KD 3WUVA 1URQC
chains in the Genus database with same CATH topology
4NBFD 4U7JA 2WSCJ 1FDOA 2NWFA 2XR8A 1PL5A 1O7MA 3GF3A 4HM7A 3T97B 4OGQC 1GMJA 2O01J 3D70A 1SQVE 3C8VA 2G8YA 3GCEA 1KTMA 4I7ZC 1NGMB 3S9OA 1SQXE 3GTEA 4NBHD 3Q3DA 4H13D 3D6ZA 3EWKA 4Z1MH 3AE7C 1OW8A 1L0LE 4Y28J 4QDCA 3AEEC 2BMQA 2QJYC 1OMIA 4P1BH 1ULIA 2D2CC 1Q90C 4H44D 5KLVE 5KKZC 2XSOA 1VCKA 2FYUE 3CXHE 1Y9BA 4HM3A 3FOUA 4PD4E 2ZT9D 3L73E 1NDOA 1PPJE 2QIWA 3L74E 3SFEC 4TT3H 3BCCE 1DD4A 4HM1A 1NU1E 2V7QJ 1R8EA 2QJKC 2JO6A 1ULJA 1YQ3C 2P10A 4NBBD 2XRXA 1G8JB 2OQQA 2YVJB 4R4MA 2E75C 2E76D 2NUKA 3AECC 3AEGC 1NYKA 2E74C 4H0LC 1PIXA 3AE2C 3H25A 1WQLA 4AIVA 4P1CH 3AZCA 3GLMA 4RKUJ 1SJGA 3H1JE 1K04A 1KQFB 1UUVA 2J5UA 3VCAA 1VF5B 3D89A 2FXPA 1UIXA 3C0DA 5L8RJ 2DE6D 4PV1B 4NBGD 2FYNC 3FGAD 4H13C 3IAOA 3L75E 3VMHD 1PV3A 3EQQA 2BEQD 2DE7D 1ZRTE 4HM6A 3Q5SA 3Q5PA 3SFDC 3GMAA 3D6YA 4HM2A 5HL4A 1KB9E 4NBDD 1KILE 4H44C 1NYHA 3RL0g 4AAYB 3D71A 2DE5D 2ZT9C 4OGQB 2WQYC 1WMKA 4QDDA 3AEFC 2K9YA 4OGQD 4HM4A 4I7ZB 4YTPC 1O7WA 2GBWA 2HMMA 2QPZA 3Q1MA 3G9RA 3AE3C 4NB9D 2I7FA 2E76C 2YMKA 3GL2A 1O7NA 2WSFJ 2D2CB 1S1CX 2NVGA 2BEZF 1NTZE 3LW5J 3RK3E 1FQTA 1NTME 2D2CD 1Q90D 3O6QA 1EXJA 1JB0J 2YFLA 1OW6A 1O7HA 3H1IE 2HMJA 4QUPA 1RQVA 3ABVC 2YIUC 5AEUA 3GZXA 1BE3E 3GZYA 5BOKA 3GF7A 1IK7A 1EZVE 2G3AA 1L0NE 4XFJA 2BMRA 1BCCE 2WPVB 1K05A 4HM0A 2YFJA 2XSHA 1ZMEC 1SQPE 2GBXA 1JM1A 1DD3A 2JP3A 2QSIA 2H88C 3R4YA 2E75B 1DIPA 1OW7A 1VF5D 3H1LE 2JZAA 1KORA 1RQUA 1KYOE 1O7PA 5M1BA 2E74B 3H1KE 2HMLA 3GKEA 2IDBA 4H0LB 4PV1D 2CKFA 2BMOA 1PP9E 3VMGD 2E74D 4NB8D 2NVFA 4H0LD 2NVEA 2ZYLA 1EXIA 2QJPC 2IBZE 2Q3WA 4HJLA 2HMNA 2H89C 3L71E 1KMIZ 3GOBA 2JO1A 4R4LA 4QDFB 2YFIA 4NBAD 2B1XA 3Q2YA 4NBED 3AE1C 3Q5RA 3VCPA 3CX5E 1HF9A 4H13B 3N0QA 3AE6C 3AEAC 1HJ0A 2HMOA 2A06E 1SQBE 3DQYA 1U57A 3AE4C 1UUWA 3AE9C 3AEBC 2NUMA 4EMJB 4H44B 4NBCD 1ZOYC 1NTKE 4U3FE 5KLIC 1KQGB 2ZT9B 3VMID 1AJYA 1MKMA 1TU3F 3TGUE 3IN6A 4GDOA 1RIEA 4HM5A 2B24A 2BCCE 3CWBE 1VL2A 3L70E 4HKVA 4YXDC 1O7GA 2FBWC 3B71A 1SQQE 3L72E 4HM8A 2NZ2A 1RFSA 4QURA 2MKVA 1P84E 1ZP0C 2E4QA 1S5LX 2E76B 4IL6X 1VF5C 3H1HE 3GB4A 3AEDC 4PV1C 1G8KB 4QUQA 1EG9A 5AEWA 3EN1A 2WSEJ 1YQ4C 2E4PA 2E75D 1VM9A 3AE8C 2HMKA 1FDIA 4KT0J 3AE5C 3GTSA 4QCKA 3GL0A 4QDFA 5CXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMK A;  4NBF D;  4H0L C;  3DQY A;  3GL2 A;  1O7N A;  2NWF A;  2NVG A;  2XR8 A;  1WQL A;  1NTZ E;  1O7M A;  1UUW A;  4AIV A;  4P1C H;  1FQT A;  4HM7 A;  1NTM E;  3AZC A;  2D2C D;  4OGQ C;  2NUM A;  1SJG A;  4EMJ B;  3H1J E;  1SQV E;  4NBC D;  2YFL A;  1O7H A;  1UUV A;  3VCA A;  1NTK E;  3GCE A;  3H1I E;  2HMJ A;  4QUP A;  3D89 A;  4I7Z C;  4U3F E;  5KLI C;  2YIU C;  5AEU A;  1SQX E;  3C0D A;  3GTE A;  3GZX A;  1BE3 E;  3GZY A;  5BOK A;  4NBH D;  4H13 D;  2DE6 D;  1EZV E;  4NBG D;  3VMI D;  2FYN C;  1L0N E;  1L0L E;  2BMR A;  1BCC E;  4QDC A;  3TGU E;  4H13 C;  1RIE A;  3L75 E;  2BMQ A;  4HM0 A;  4HM5 A;  3EQQ A;  3VMH D;  2QJY C;  2YFJ A;  2DE7 D;  2B24 A;  2BCC E;  3CWB E;  3L70 E;  2XSH A;  4P1B H;  1ZRT E;  1SQP E;  4HM6 A;  2GBX A;  1JM1 A;  4HKV A;  1ULI A;  2D2C C;  1Q90 C;  1O7G A;  4H44 D;  1SQQ E;  5KLV E;  3L72 E;  4HM2 A;  5KKZ C;  2XSO A;  1VCK A;  5HL4 A;  1VF5 D;  3H1L E;  4HM8 A;  2FYU E;  1RFS A;  2JZA A;  4QUR A;  1KB9 E;  3CXH E;  4NBD D;  4HM3 A;  1KYO E;  3FOU A;  1P84 E;  1O7P A;  4H44 C;  2E4Q A;  4PD4 E;  3H1K E;  2HML A;  3GKE A;  2ZT9 D;  3L73 E;  1VF5 C;  4PV1 D;  1NDO A;  2CKF A;  1PPJ E;  2BMO A;  4AAY B;  3L74 E;  1PP9 E;  3H1H E;  3VMG D;  2E74 D;  4NB8 D;  2DE5 D;  3BCC E;  2NVF A;  4H0L D;  2ZT9 C;  2NVE A;  3GB4 A;  4PV1 C;  1G8K B;  2ZYL A;  2QJP C;  2IBZ E;  2Q3W A;  4QUQ A;  1EG9 A;  4HJL A;  2HMN A;  4QDD A;  5AEW A;  4HM1 A;  1NU1 E;  3EN1 A;  3L71 E;  4OGQ D;  4HM4 A;  2QJK C;  3GOB A;  1O7W A;  2JO6 A;  1ULJ A;  4QDF B;  2E4P A;  2GBW A;  2E75 D;  2HMM A;  4NBB D;  2YFI A;  4NBA D;  1VM9 A;  2B1X A;  2QPZ A;  5CXM A;  2XRX A;  4NBE D;  1G8J B;  2YVJ B;  2HMK A;  3VCP A;  3CX5 E;  2E75 C;  3GTS A;  2E76 D;  2NUK A;  4NB9 D;  4QCK A;  3GL0 A;  3N0Q A;  1NYK A;  4QDF A;  2E74 C;  2HMO A;  2I7F A;  2A06 E;  2E76 C;  1SQB E; 
#chains in the Genus database with same CATH topology
 5CCG A;  4NBF D;  2NWF A;  2QM7 A;  2KNC B;  2YXQ B;  1NAY A;  1PL5 A;  5GTH H;  4HM7 A;  3T97 B;  1LT1 A;  1OXZ A;  2Q6Q A;  2O01 J;  2HFE D;  1NAF A;  3EFF K;  2JEE A;  3H1H G;  1SQX E;  1NO4 A;  4PD4 H;  3PH0 A;  3D6Z A;  4Z1M H;  3L74 J;  2QJY C;  1A02 F;  2Q7C A;  1IFI A;  3L37 A;  2A45 I;  3VTP C;  1KFM A;  1LTI C;  5KLV E;  2NPS D;  3FOU A;  4RO0 A;  2P58 A;  3WU2 E;  5AW5 B;  1PPJ E;  2IFN A;  1WRG A;  3BAT A;  4TT3 H;  2ZFC A;  5H2F E;  1KV4 A;  1M1J C;  1IFM A;  1BGY D;  1NU1 E;  3II6 A;  1FDM A;  5KLI B;  2H7H A;  1SQX G;  1ULJ A;  1ZN5 A;  3I5C A;  3H1I D;  1Q82 Q;  2E75 C;  2A45 G;  1LP1 B;  3AEG C;  1JTH A;  1P84 D;  2HPC A;  1PIX A;  1WQL A;  4AIV A;  1HGV A;  1SFC D;  2J59 M;  4EDF A;  1CI6 B;  5CJ0 A;  4RKU J;  3CCU P;  2KZJ A;  4B86 A;  3H6P A;  1QX8 A;  2W90 A;  3VCA A;  1K8A Q;  4DJG A;  1PPJ G;  3D89 A;  2B87 A;  2FXP A;  4YXW H;  1UIX A;  1LWU C;  2JWD A;  3C0D A;  2DE6 D;  3T97 A;  1X8Y A;  1NU1 G;  4L76 A;  2ZYD A;  4BRY A;  1LGH B;  2ZYG A;  4WY4 D;  5AW0 B;  2ZXE B;  3M0D A;  1LTG C;  1N86 A;  4HH2 A;  5AVS B;  2M5A B;  4HM6 A;  3TDK A;  3Q5S A;  4HM2 A;  1KC8 Q;  1SQX K;  1JUN A;  1KIL E;  4GOE A;  3CCM P;  3O8Z A;  2I1J A;  2FYZ A;  4JQ0 D;  2N1T A;  1N2D C;  5AVU B;  4AAY B;  1BCC G;  1URQ D;  2ZT9 C;  1HTL C;  5KJ7 C;  2WQY C;  1WMK A;  2K9Y A;  3KXD A;  4HM4 A;  5KLV K;  3USS A;  4JF7 A;  2GBW A;  1LT9 C;  1VQO P;  3H1K G;  3G71 P;  3G9R A;  4IL6 E;  2JKV A;  3C9I A;  1JY2 P;  2E43 A;  1BE3 J;  4DCK A;  3CXH D;  1JNM A;  2V7Q H;  4LLH A;  4KHX A;  3LW5 H;  4D6T E;  1ZV8 A;  1EDJ A;  2BEZ F;  3EQ2 A;  1FQT A;  1LP1 A;  1JB0 J;  4XE5 B;  1AVO A;  3H1I E;  4GOD A;  1FJP A;  2HMJ A;  1PGP A;  1X0T A;  3GZY A;  5BOK A;  3CCJ P;  2B9B A;  1IK7 A;  3L36 A;  1T6A A;  3SSU A;  1CI6 A;  2WPR A;  4AUW A;  5AVX B;  1K05 A;  2GBX A;  1DD3 A;  1RE3 A;  2JP3 A;  2LR2 A;  3KYQ A;  1E79 H;  5K5G B;  2AEJ A;  1JY3 N;  2KI7 B;  2AEM A;  1HWT C;  3CL3 D;  2IDB A;  4PJ0 H;  1KFN A;  5APT A;  4H0L B;  2M5A A;  2CKF A;  4D6T G;  2N9Y B;  1PP9 E;  3M0D C;  2W83 C;  4NB8 D;  1FC2 C;  3M06 A;  5CCH A;  2ZYL A;  1U7J A;  1R5L A;  1J1D B;  2P2U A;  2OYI B;  2H89 C;  1S72 P;  3H1I G;  2K9J B;  4QDF B;  1KIL A;  2KSE A;  1KB9 I;  3CCS P;  1L4A D;  2WT7 A;  2WSS H;  3AEA C;  3VN0 A;  1YI2 P;  2HMO A;  1GU4 A;  1SQB E;  3CLQ A;  1U57 A;  2JR8 A;  1VQM P;  1JM0 A;  1FZA A;  2GA1 A;  2KOG A;  3L70 J;  2NUM A;  4EMJ B;  3W68 A;  3L4F A;  1MZ9 A;  4H44 B;  2JDI H;  3U59 A;  3CCE P;  3OW2 O;  4U3F E;  3RL0 D;  3H32 B;  5KLI C;  1IFN A;  3A0H H;  1P84 H;  1RE4 C;  2LXC B;  3CPW O;  1KQG B;  2OTJ P;  1HJB A;  1AJY A;  3H1H J;  3BCC D;  5GTI E;  1FOS E;  3E1R A;  1S4X A;  3EFG A;  2I1K A;  3VP9 A;  1O7G A;  3B71 A;  2L91 A;  3L72 E;  3RK3 D;  4HM8 A;  1NTM D;  1ZP0 C;  2E4Q A;  1SQB G;  2E76 B;  2LXB A;  3KHU A;  2B88 A;  1JMB A;  3A5T A;  5B5E E;  1RF0 A;  3AED C;  1NH4 A;  4A7P A;  4JBZ A;  5AEW A;  3I56 P;  3GG2 A;  5C39 A;  3EN1 A;  1YQ4 C;  4GKG A;  1JCD A;  1FBM A;  2WVR A;  3OJA B;  1VM9 A;  2O01 N;  4WB4 A;  1G2C A;  2Z5I A;  3AE8 C;  5CCH C;  3AE5 C;  2OYI A;  1SQX J;  4WY4 A;  1KYO D;  3KZI E;  4QDF A;  3N4X A;  3JCU H;  1SVF A;  4U7J A;  1FDO A;  1N7S D;  2XR8 A;  3L72 G;  3VOP A;  1YJW P;  2KK7 A;  2IBZ D;  4WVZ A;  3D70 A;  3V4W A;  2G8Y A;  3IF4 A;  3L71 D;  1NHL A;  3CXH H;  3GTE A;  1H0T A;  4H13 D;  2M3B A;  3EWK A;  3S4R A;  1ZXG A;  3CX5 D;  1SQB K;  4QDC A;  3TNU A;  1Q2N A;  1HUC A;  1M8O B;  1OWA A;  2AXC A;  3H32 A;  4P1B H;  3RGU A;  5GTH E;  2P7J A;  3F89 A;  1YBK A;  1NU1 J;  3U1C A;  1UII A;  3E1I A;  1IFJ A;  1JY2 O;  1FS0 E;  1Y9B A;  1OFC X;  2QG4 A;  4PD4 E;  3L73 E;  5B5E H;  2P67 A;  1NDO A;  1NTK D;  3FXE A;  4PD4 I;  1VQL P;  3G3Z A;  3BCC E;  1DD4 A;  4RJT A;  3MTU E;  2XDJ A;  4HM1 A;  2V7Q J;  1JCC A;  2BCC D;  3HD7 D;  4NBB D;  1N8R Q;  2WPS A;  2XRX A;  1G8J B;  1T3U A;  3MP7 B;  1RF0 C;  2NUK A;  1EZV D;  1GW4 A;  1NYK A;  4K35 A;  4H0L C;  3B4S A;  3H1K J;  3RK2 B;  3H25 A;  2WMM A;  2HPC B;  4P1C H;  1AV1 A;  3AZC A;  4UB6 H;  1GD2 E;  1RY3 A;  1K04 A;  3H1J E;  1ZR4 A;  2OYI C;  2ZVO B;  2J5U A;  3P8C D;  4HKZ H;  1VF5 B;  3CCV P;  1USD A;  1L2P A;  3H1L D;  1ZR2 A;  3BCC G;  5L8R J;  4L74 A;  4PV1 B;  2B87 B;  4ZKP A;  4L75 A;  3QWO C;  4ZMD A;  1DX7 A;  3VMH D;  1PV3 A;  3EQQ A;  2BEQ D;  1A02 J;  3P8M C;  4NPF X;  1CSB A;  2PAJ A;  5KAF E;  1LTJ C;  4BRY B;  3Q5P A;  1L4A A;  3SFD C;  2J58 A;  3GMA A;  1X22 A;  1CW5 A;  5HL4 A;  3HE5 A;  5CBO A;  5AVV B;  2PGD A;  4H44 C;  1NYH A;  4HJG H;  2DE5 D;  3TYY A;  2N1T B;  1AQT A;  3H1J G;  4D6T J;  3TF5 A;  5AW4 B;  1GDT A;  1XTC C;  1U7M A;  3CCL P;  3H1I J;  3TSI A;  3KPE A;  3S1K A;  3AE3 C;  4NB9 D;  2FXM A;  2QEX P;  1M56 D;  2KYV A;  2UWJ E;  5AVZ B;  2R3C A;  2KP8 A;  2I7F A;  2E76 C;  2IBZ G;  3RBZ A;  3CWB D;  5KKZ B;  1LNQ A;  1SP4 A;  3WUU A;  2FFD A;  2K37 A;  2K1A A;  1M57 D;  2QVA A;  1EXJ A;  1FZC A;  1OW6 A;  2WTY A;  1GL2 B;  4WBA A;  4DT0 A;  4QUP A;  4HB1 A;  1KYO H;  1T2K C;  1EZV E;  4N6J A;  3MGN A;  2G3A A;  1L0N E;  2BMR A;  1BCC E;  1HBW A;  1PP9 J;  3BVH A;  1K9M Q;  4HM0 A;  5KAF H;  1W5C E;  3MIW A;  4OVN F;  2YFJ A;  3SWY A;  1ZME C;  2RMZ A;  4DZO A;  1JM1 A;  2Z4E A;  3R4Y A;  3M9B A;  1NTK G;  1RF1 B;  1DIP A;  3H1L E;  5CCG C;  1GZL A;  4IOI H;  1RQU A;  3CX5 H;  2E74 B;  3H1K E;  2HML A;  4EI2 A;  1H88 A;  2BMO A;  1T3J A;  2NVF A;  4H0L D;  2NVE A;  3G4S P;  2LKM A;  3KDP B;  1QL1 A;  2Q3W A;  1SQB J;  5E79 H;  2WIT A;  3TK1 A;  3NTN A;  5TJH A;  5CBN A;  2JO1 A;  3CD6 P;  2R5D A;  1MUU A;  1EZV G;  1SQV D;  4NBE D;  2Q5U A;  2FYN B;  1L0N G;  2WWW A;  1HF9 A;  1KIL B;  2JJL A;  4U3F J;  4PJ0 E;  4TLF A;  1K73 Q;  3M91 A;  2XND H;  3RBX A;  1HJ0 A;  1L0L D;  2W8Z A;  2WT7 B;  2W6B A;  5AVW B;  1Q7Y Q;  3H1L G;  3V5B A;  2QE7 H;  1OVV A;  3AEB C;  5KTB A;  1Z56 A;  2FKW B;  3L72 J;  2FYU D;  1AFO A;  2L5G B;  2WSF H;  1SS1 A;  1BGY E;  1TU3 F;  3G6E P;  4OH8 B;  4XA4 A;  3IN6 A;  4GDO A;  1NU1 K;  1RIE A;  1GL2 A;  3CWB E;  2AXT H;  3PTZ A;  3B5N A;  5AW7 B;  3HUS A;  2YO3 A;  4BWN A;  3RK2 C;  4YXD C;  1S9K D;  1RFS A;  2I8D A;  2OYO A;  3A0H E;  1P84 E;  1VF5 C;  1L0N K;  3BRT B;  1P84 I;  2YNY A;  4JPZ B;  1RF1 A;  4PV1 C;  5AVT B;  2SPZ A;  4EOT A;  4W7Z A;  1QEX A;  2FY8 A;  2YIU B;  3ZDM A;  2YO2 A;  2E4P A;  3IR9 A;  1QVF O;  2E75 D;  2RN0 A;  1VPC A;  1VQ9 P;  1BGY G;  1T2K D;  1KQS O;  2HMK A;  1LTA C;  5CJ4 A;  1FZG A;  2OTL P;  3U1A A;  3GTS A;  1YJN P;  4QCK A;  3GL0 A;  1G2C B;  3CWB G;  4IFD K;  5B66 H;  4C7N A;  5TIS H;  1OIP A;  3L75 D;  4WY4 B;  1CZQ A;  1JY2 N;  1O7M A;  3GF3 A;  1ZRT D;  3F5H A;  3BRV B;  2N1T C;  3JSV C;  5AVR B;  1GMJ A;  4ASW A;  1SQV E;  5CCG D;  1RH5 B;  3GCE A;  1NGM B;  4NBH D;  3MUD A;  1E5W A;  1J2J B;  2YKQ A;  1G1I A;  1H0T B;  3L73 J;  1L0L E;  4Y28 J;  5APW A;  3JCU E;  3VYI A;  3BCC J;  2NPS A;  1S2E A;  3TNU B;  2IYP A;  3V2N A;  2ITA A;  3FWL A;  3CMA P;  5KKZ C;  1VQP P;  2FYU E;  1SLQ A;  3CXH E;  4HM3 A;  2KLV A;  2ZT9 D;  2HLO A;  1GL2 C;  3CXH I;  5KJ7 D;  3SFE C;  1EDI A;  1VQN P;  3V2Q A;  4KJM A;  1NWQ A;  5BU5 A;  1SQV G;  2ZVN B;  1NTZ D;  1R8E A;  1AQ5 A;  3P32 A;  2JO6 A;  1YQ3 C;  2HYN A;  3L70 D;  3H1J J;  2OQQ A;  2YVJ B;  4I2L C;  1IJD B;  1L0L G;  1FZF A;  4R4M A;  1RF1 C;  4CPG A;  2Y0C A;  1SFC A;  3AEC C;  3I55 P;  1VQ5 P;  1RE3 C;  2YKP A;  5APV A;  4ZKU A;  2E74 C;  4AYC A;  2PRR A;  1HVV A;  2YMY A;  3H1H D;  4JYB A;  4QMA A;  2FYU G;  1SQP D;  2Y0D A;  3RK2 D;  1SJG A;  5AVY B;  2KZI A;  3VMY A;  1KQF B;  3C1L A;  3V2P A;  1UUV A;  2KS1 A;  2WSC H;  4NBG D;  2FYN C;  3B8E B;  2M8R A;  1KIL C;  3A2A A;  3IAO A;  3L75 E;  2E5Y A;  4WWI A;  2C0X A;  2DE7 D;  2XNX A;  1ZRT E;  3FXD A;  5CMZ A;  1SQV K;  1FE6 A;  4UB6 E;  3D6Y A;  1URQ A;  2RKL A;  1EDL A;  1L4A B;  1S5L H;  3E7K A;  3HE5 B;  1OZH A;  3V6I A;  1L0L K;  1NTK J;  1SQX D;  3V4Q A;  4GT1 A;  1DH3 A;  4OGQ B;  1D7M A;  4I6M C;  5AW1 B;  2Q3E A;  4QDD A;  4BXL A;  3AEF C;  2N1T D;  4I7Z B;  2WZ7 A;  1O7W A;  1QVG O;  2C0W A;  2DW3 A;  2QPZ A;  1Q81 Q;  3RL0 B;  1JEK A;  1PGJ A;  2ZYA A;  5KLV D;  3L75 G;  2Y9Y A;  2HOD A;  1W2E A;  2VRS A;  1PFI A;  2NRG A;  3TGU D;  1L0N J;  3GL2 A;  2WSF J;  1BCC J;  2D2C B;  1PPJ D;  1NTZ E;  3LW5 J;  3M9H A;  3RK3 E;  1NTM E;  3O6Q A;  3A0B H;  1USE A;  2YFL A;  3RK3 B;  1SQQ D;  1BSH A;  2FFD B;  2M0B A;  1M1J A;  2YIU C;  1FZC B;  3GZX A;  3H1L J;  1QGK B;  3BAS A;  1FAV A;  2H43 A;  4XFJ A;  1OVR A;  2QJK B;  5BVZ A;  1KD1 Q;  1J1D C;  1SQP E;  1J1E B;  1X79 B;  1H89 A;  4WY4 C;  1JOC A;  1RHZ B;  1KOR A;  2CPS A;  1N73 B;  1KYO E;  1R5S A;  4GIF A;  1KYO I;  2E74 D;  1NTZ G;  3WUT A;  1VQ6 P;  1NTM G;  3V2R A;  1N7S B;  2IBZ E;  4HJL A;  2HMN A;  2R5B A;  3L35 A;  1VDF A;  3L71 E;  4O9B A;  2IBZ I;  3CCR P;  1IK9 A;  4R4L A;  2GM4 A;  5CCH D;  2H8P D;  2QM8 A;  3HRN A;  4EYY Q;  3AE1 C;  2R44 A;  3Q5R A;  5APX A;  3VCP A;  3CX5 E;  4H13 B;  5KAI H;  2POH A;  3N0Q A;  4W7Y A;  3CX5 I;  1KIL D;  3JC2 2;  1SQP G;  4YPC A;  1BGY J;  3DQY A;  3LIE A;  1XTG B;  5E79 E;  1UUW A;  3CWB J;  1X9V A;  1M90 Q;  2OTK E;  5AW2 B;  2MJZ A;  5AW8 B;  1ZOY C;  1VQK P;  1NTK E;  1YTZ I;  1QL2 A;  5KJ7 A;  4NPD A;  2ZXX A;  2K88 A;  2W27 A;  3VMI D;  1MKM A;  3VP8 A;  3L74 D;  3TGU E;  1VQ8 P;  3L71 G;  1G1J A;  1LT9 A;  2IYO A;  1NTZ K;  2BCC E;  2B24 A;  1VL2 A;  1NTM K;  1IZN B;  3CC4 P;  4HKV A;  4D6T D;  1WT6 A;  4M3L A;  1SQQ E;  3HD7 B;  3B5N B;  3HUS B;  1NJI Q;  1YTZ T;  1FJK A;  1S5L X;  1EZV I;  2ZAE B;  4UB8 E;  1NKZ B;  2OAR A;  3GB4 A;  4QUQ A;  1N73 A;  2XKM A;  2AXT E;  1SQP K;  3SWK A;  3P8C E;  4Y99 B;  2FXO A;  5KLV G;  2OYH B;  2IX7 C;  1AA0 A;  2HR3 A;  1SQV J;  3OA7 A;  2P1J A;  2QRX A;  1N7S A;  3TGU G;  3MZW B;  2BAS A;  3R2P A;  2BCC G;  2KNC A;  1L4A C;  2A45 H;  2O3J A;  3M9Q A;  5CXM A;  1L0L J;  2WSC J;  3HTK B;  1SQQ G;  1PP9 D;  4IFM A;  4C7N B;  3NFQ A;  4OGQ C;  3CC2 P;  3C8V A;  1KTM A;  4I7Z C;  1YHQ P;  3S9O A;  1KB9 D;  1EC5 A;  1KZU B;  2FYU J;  3Q3D A;  3PP5 A;  1ZW0 A;  3WU2 H;  3AE7 C;  3RL0 C;  2QJP B;  1OW8 A;  5B66 E;  2IZ1 A;  3CC7 P;  3VMZ A;  5H2F H;  3AEE C;  5TIS E;  2BMQ A;  1JY3 P;  5EFW B;  1OMI A;  5BU8 B;  1MFT A;  5AW3 B;  4HYT B;  1QLE D;  1SQB D;  1YIT P;  1ULI A;  2NPS B;  2D2C C;  1Q90 C;  2GUS A;  4H44 D;  1NTK K;  2XSO A;  1VCK A;  5CHX A;  1NOH A;  2KLU A;  4UB8 H;  2W6J H;  4RES B;  3RK3 C;  5DJU B;  2FFD C;  2AEF A;  2QIW A;  3L74 E;  4U3F D;  5AW6 B;  1T8Z A;  1FZC C;  3HD7 A;  3W67 A;  2HG5 D;  1RE4 A;  2C9L Y;  1DEB A;  1W2B O;  3VMX A;  3CI9 A;  2W6A A;  1Y8A A;  2QJK C;  3FWN A;  1SQQ K;  2P10 A;  1FOS F;  2KSJ A;  1J1E C;  4LC1 A;  3L72 D;  4K3A A;  1BE3 D;  1YIJ P;  2E76 D;  1GU5 A;  2CPB A;  3M0A A;  1N73 C;  4L73 A;  2Y0E A;  2OYH A;  2WSE H;  1VQ7 P;  1SFC B;  3AE2 C;  5APY A;  3L75 J;  4EIJ A;  1FU1 A;  2PP6 A;  2XZR A;  3NMD A;  3GLM A;  1N7S C;  2RH0 A;  2Q3I A;  2KUB A;  2N9B A;  3L74 G;  4IFF A;  3HTK A;  3HE4 B;  4ASV A;  2YKO A;  2KS1 B;  1FZB A;  3FGA D;  4H13 C;  1MV8 A;  1M7L A;  2O01 H;  2C9N Y;  2R3S A;  2IFM A;  1DEE G;  2B89 A;  2YXR B;  3PJS K;  1S3J A;  3GHG B;  1KB9 E;  4NBD D;  4IL6 H;  1EDK A;  1URQ B;  2ZJS E;  3RL0 g;  1N7L A;  3N7N A;  4GOF A;  3GW6 A;  3D71 A;  3A7O A;  2WPQ A;  4N3Y B;  2A06 D;  2KXP B;  3QH9 A;  2PFX A;  4NPE A;  5AW9 B;  1LTJ B;  4OGQ D;  1NKN A;  1MFZ A;  1BDD A;  1NTZ J;  5APQ A;  4YTP C;  1NTM J;  3VMA A;  2HMM A;  3PHL A;  3Q1M A;  1ZLL A;  3PRJ A;  1S5L E;  3HD7 C;  1YJ9 P;  3B5N C;  2XV5 A;  3NXS A;  3HUS C;  5DJT B;  1PP9 G;  2QJY B;  4PD4 D;  3L73 D;  2YMK A;  1HH0 A;  2HOD B;  1O7N A;  1S1C X;  2NVG A;  5APU A;  4C7R A;  1S9K E;  2D2C D;  1PGQ A;  1Q90 D;  1SQP J;  4W80 A;  4N78 D;  4Y99 C;  1O7H A;  2K3R A;  3IFM A;  1GW3 A;  1RQV A;  3ABV C;  3O6Q B;  5AEU A;  1H8A A;  2OYH C;  1BE3 E;  3GF7 A;  1M1J B;  3K5B A;  4MN4 C;  1GTW A;  1LTB C;  1VQ4 P;  2WPV B;  1IFP A;  3CCQ P;  2O1K A;  4JYC A;  2XSH A;  1OX3 A;  1NVO A;  3HE4 A;  1KB9 H;  2QSI A;  2H88 C;  3A0B E;  3L71 J;  2E75 B;  1LTS C;  1OW7 A;  5APS A;  1VF5 D;  4U3F G;  2JZA A;  3MHV A;  1O7P A;  5M1B A;  2E42 A;  3H1J D;  4LGD E;  3GKE A;  2M3E A;  1PGO A;  4PV1 D;  1BDC A;  3ITK A;  3VMG D;  1M1K Q;  3CME P;  3SWF A;  3GHG A;  1EXI A;  2K9J A;  1AVY A;  2QJP C;  3MUD C;  1KMI Z;  3GOB A;  1LWU B;  1BE3 G;  1BSN A;  2YFI A;  4NBA D;  1IO4 A;  2B1X A;  1GK6 A;  4C46 A;  1YYC A;  3Q2Y A;  2IPP A;  1KN7 A;  2NPS C;  1LJ2 A;  1OVU A;  4I1L A;  5KLV J;  1JY3 O;  2IZ0 A;  1LTJ A;  3AE6 C;  1EQ7 A;  3FX0 A;  2E5T A;  3P7K A;  2A06 E;  3MD0 A;  2QA4 P;  3TGU J;  3AE4 C;  5GTI H;  2Q9I A;  2BCC J;  2FYU K;  3AE9 C;  1KQL A;  4NBC D;  4ZNC A;  1SQQ J;  2CK3 H;  2R32 A;  2ZT9 B;  5KAI E;  2JWA A;  3OAK A;  2KB7 P;  4HM5 A;  4DOJ A;  3L70 E;  2OGU A;  1JO5 A;  1LT9 B;  1SFC C;  1NU1 D;  4N78 E;  2FBW C;  1Y47 A;  1GL2 D;  2NZ2 A;  4QUR A;  2MKV A;  3LID A;  3B5N D;  5AVQ B;  2A06 G;  2Z5H A;  4IL6 X;  2KIK A;  3H1H E;  1FZE A;  3KZI H;  1Q86 Q;  3UIA A;  2V4H A;  1G8K B;  1IFD A;  2GUV A;  1EG9 A;  1L0N D;  1BCC D;  1IC2 A;  2WSE J;  4OWF A;  2XU6 A;  1JTH B;  2Q1K A;  1LTT C;  4AQR D;  3A3Y B;  1GK4 A;  3PLN A;  1HGZ A;  1PZQ A;  1JMM A;  3WMM 0;  1FDI A;  3L73 G;  4KT0 J;  3GHG C;  2Y9Z A;  3KQG A;  3L70 G;  1LWU A;  2O1J A;  3H1K D;  3WUV A;  1URQ C; 
#chains in the Genus database with same CATH homology
 4NBF D;  4U7J A;  2WSC J;  1FDO A;  2NWF A;  2XR8 A;  1PL5 A;  1O7M A;  3GF3 A;  4HM7 A;  3T97 B;  4OGQ C;  1GMJ A;  2O01 J;  3D70 A;  1SQV E;  3C8V A;  2G8Y A;  3GCE A;  1KTM A;  4I7Z C;  1NGM B;  3S9O A;  1SQX E;  3GTE A;  4NBH D;  3Q3D A;  4H13 D;  3D6Z A;  3EWK A;  4Z1M H;  3AE7 C;  1OW8 A;  1L0L E;  4Y28 J;  4QDC A;  3AEE C;  2BMQ A;  2QJY C;  1OMI A;  4P1B H;  1ULI A;  2D2C C;  1Q90 C;  4H44 D;  5KLV E;  5KKZ C;  2XSO A;  1VCK A;  2FYU E;  3CXH E;  1Y9B A;  4HM3 A;  3FOU A;  4PD4 E;  2ZT9 D;  3L73 E;  1NDO A;  1PPJ E;  2QIW A;  3L74 E;  3SFE C;  4TT3 H;  3BCC E;  1DD4 A;  4HM1 A;  1NU1 E;  2V7Q J;  1R8E A;  2QJK C;  2JO6 A;  1ULJ A;  1YQ3 C;  2P10 A;  4NBB D;  2XRX A;  1G8J B;  2OQQ A;  2YVJ B;  4R4M A;  2E75 C;  2E76 D;  2NUK A;  3AEC C;  3AEG C;  1NYK A;  2E74 C;  4H0L C;  1PIX A;  3AE2 C;  3H25 A;  1WQL A;  4AIV A;  4P1C H;  3AZC A;  3GLM A;  4RKU J;  1SJG A;  3H1J E;  1K04 A;  1KQF B;  1UUV A;  2J5U A;  3VCA A;  1VF5 B;  3D89 A;  2FXP A;  1UIX A;  3C0D A;  5L8R J;  2DE6 D;  4PV1 B;  4NBG D;  2FYN C;  3FGA D;  4H13 C;  3IAO A;  3L75 E;  3VMH D;  1PV3 A;  3EQQ A;  2BEQ D;  2DE7 D;  1ZRT E;  4HM6 A;  3Q5S A;  3Q5P A;  3SFD C;  3GMA A;  3D6Y A;  4HM2 A;  5HL4 A;  1KB9 E;  4NBD D;  1KIL E;  4H44 C;  1NYH A;  3RL0 g;  4AAY B;  3D71 A;  2DE5 D;  2ZT9 C;  4OGQ B;  2WQY C;  1WMK A;  4QDD A;  3AEF C;  2K9Y A;  4OGQ D;  4HM4 A;  4I7Z B;  4YTP C;  1O7W A;  2GBW A;  2HMM A;  2QPZ A;  3Q1M A;  3G9R A;  3AE3 C;  4NB9 D;  2I7F A;  2E76 C;  2YMK A;  3GL2 A;  1O7N A;  2WSF J;  2D2C B;  1S1C X;  2NVG A;  2BEZ F;  1NTZ E;  3LW5 J;  3RK3 E;  1FQT A;  1NTM E;  2D2C D;  1Q90 D;  3O6Q A;  1EXJ A;  1JB0 J;  2YFL A;  1OW6 A;  1O7H A;  3H1I E;  2HMJ A;  4QUP A;  1RQV A;  3ABV C;  2YIU C;  5AEU A;  3GZX A;  1BE3 E;  3GZY A;  5BOK A;  3GF7 A;  1IK7 A;  1EZV E;  2G3A A;  1L0N E;  4XFJ A;  2BMR A;  1BCC E;  2WPV B;  1K05 A;  4HM0 A;  2YFJ A;  2XSH A;  1ZME C;  1SQP E;  2GBX A;  1JM1 A;  1DD3 A;  2JP3 A;  2QSI A;  2H88 C;  3R4Y A;  2E75 B;  1DIP A;  1OW7 A;  1VF5 D;  3H1L E;  2JZA A;  1KOR A;  1RQU A;  1KYO E;  1O7P A;  5M1B A;  2E74 B;  3H1K E;  2HML A;  3GKE A;  2IDB A;  4H0L B;  4PV1 D;  2CKF A;  2BMO A;  1PP9 E;  3VMG D;  2E74 D;  4NB8 D;  2NVF A;  4H0L D;  2NVE A;  2ZYL A;  1EXI A;  2QJP C;  2IBZ E;  2Q3W A;  4HJL A;  2HMN A;  2H89 C;  3L71 E;  1KMI Z;  3GOB A;  2JO1 A;  4R4L A;  4QDF B;  2YFI A;  4NBA D;  2B1X A;  3Q2Y A;  4NBE D;  3AE1 C;  3Q5R A;  3VCP A;  3CX5 E;  1HF9 A;  4H13 B;  3N0Q A;  3AE6 C;  3AEA C;  1HJ0 A;  2HMO A;  2A06 E;  1SQB E;  3DQY A;  1U57 A;  3AE4 C;  1UUW A;  3AE9 C;  3AEB C;  2NUM A;  4EMJ B;  4H44 B;  4NBC D;  1ZOY C;  1NTK E;  4U3F E;  5KLI C;  1KQG B;  2ZT9 B;  3VMI D;  1AJY A;  1MKM A;  1TU3 F;  3TGU E;  3IN6 A;  4GDO A;  1RIE A;  4HM5 A;  2B24 A;  2BCC E;  3CWB E;  1VL2 A;  3L70 E;  4HKV A;  4YXD C;  1O7G A;  2FBW C;  3B71 A;  1SQQ E;  3L72 E;  4HM8 A;  2NZ2 A;  1RFS A;  4QUR A;  2MKV A;  1P84 E;  1ZP0 C;  2E4Q A;  1S5L X;  2E76 B;  4IL6 X;  1VF5 C;  3H1H E;  3GB4 A;  3AED C;  4PV1 C;  1G8K B;  4QUQ A;  1EG9 A;  5AEW A;  3EN1 A;  2WSE J;  1YQ4 C;  2E4P A;  2E75 D;  1VM9 A;  3AE8 C;  2HMK A;  1FDI A;  4KT0 J;  3AE5 C;  3GTS A;  4QCK A;  3GL0 A;  4QDF A;  5CXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...