2E74D

Crystal structure of the cytochrome b6f complex from m.laminosus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 30
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e74D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e74D02
1WQLA 3GL2A 4QUQA 1VF5C 3H1LE 1EG9A 1PPJE 2XR8A 2CKFA 2XSOA 2YFJA 3VMGD 3AZCA 4QDFA 4NBED 3VCAA 4NBGD 4NBHD 2E76C 1NYKA 2DE6D 2E4PA 3VMID 2NUMA 1P84E 4QURA 2HMJA 1EZVE 2HMOA 4H13D 1RFSA 1RIEA 3GZXA 2JO6A 4OGQD 1FQTA 1G8JB 3GZYA 3H1HE 1VF5D 3EN1A 3GOBA 2GBXA 4QCKA 3H1IE 3L72E 1NDOA 2E76D 4HKVA 3GCEA 2YIUC 2YVJB 5AEUA 3EQQA 3VCPA 2B1XA 4HM8A 2B24A 3L75E 4QUPA 3L74E 4U3FE 2QPZA 3GL0A 4P1CH 3GTSA 3C0DA 3GB4A 1O7NA 1G8KB 1BCCE 2NVFA 3FOUA 4HM2A 1O7MA 4HM5A 2BMQA 4PD4E 2HMMA 4HM4A 3N0QA 2QJYC 2E74C 4PV1C 2I7FA 2QJKC 4QDFB 1O7GA 2YMKA 3L70E 1UUVA 2ZT9C 2ZYLA 4NBBD 1Q90C 2FYUE 3L73E 4NB8D 5HL4A 1NTME 4AAYB 1UUWA 1VM9A 1JM1A 4HM0A 5AEWA 3H1JE 2YFLA 2HMNA 4P1BH 2E74D 3H1KE 2A06E 4AIVA 2BCCE 1L0NE 4HM6A 2HMLA 1SQQE 2NVGA 1SQXE 4NB9D 2BMRA 2ZT9D 1ULJA 4QDDA 3CX5E 2E75C 1O7PA 1ULIA 4I7ZC 1NU1E 2HMKA 1PP9E 1KYOE 2XRXA 1KB9E 2FYNC 3GTEA 2XSHA 3CWBE 4H0LC 5BOKA 3BCCE 3L71E 1NTZE 1SQVE 2DE5D 2JZAA 4HM7A 3VMHD 2QJPC 4H44C 2D2CC 1L0LE 2GBWA 2IBZE 2YFIA 4NBCD 2E75D 2NUKA 1NTKE 2BMOA 2DE7D 4HJLA 5KLVE 3CXHE 1SJGA 1O7WA 3D89A 2E4QA 4PV1D 1BE3E 4H0LD 1O7HA 2NVEA 3DQYA 3GKEA 4NBAD 5CXMA 4QDCA 2Q3WA 4HM3A 1SQPE 5KLIC 4H44D 4NBFD 2NWFA 5KKZC 2D2CD 3TGUE 4H13C 4HM1A 4OGQC 4EMJB 1ZRTE 4NBDD 1SQBE 1VCKA
chains in the Genus database with same CATH superfamily
1WQLA 3CCSP 3L70D 2WSFJ 3JSVC 1WRGA 1LP1B 3RK3E 3GZYA 2UWJE 3AEAC 4N3YB 4ZKPA 5B66E 2QSIA 1E5WA 2LKMA 3PHLA 3BASA 1L0NG 1DEBA 2KNCA 3SFDC 3CMAP 1KB9H 2N1TA 2FYUK 4HM2A 3T97A 3SWFA 4IFFA 3MHVA 3TK1A 4N78E 1U57A 1SQXK 5AVYB 2ZYLA 4NBBD 1ZR2A 1YQ4C 2BCCG 1CZQA 2YIUB 2WMMA 5AVUB 3C8VA 5AW7B 1J1DC 3E7KA 1M57D 1NWQA 2C0WA 3H32A 3Q2YA 3B5NA 3BCCE 1QVFO 1KD1Q 2JZAA 2QJYB 2OYIB 3L71J 1SQPK 2K37A 2R3CA 1L0LJ 1JO5A 3HUSC 4QDCA 2YKOA 1WMKA 1LT9C 4LLHA 1LGHB 3GF7A 1FOSF 1JY3P 1VCKA 2CPBA 1KILD 2XSOA 1LTSC 1T2KD 1LT1A 3HRNA 3BATA 1RIEA 3A0HH 1FE6A 3TNUA 3RL0B 4PJ0H 3N7NA 4NPFX 3CWBD 2I1JA 5AVTB 3CCMP 3RBZA 4GIFA 3L75J 2M5AA 1VF5B 5CCGD 3C0DA 5M1BA 1NTKD 2NVFA 4HM5A 5GTHH 1NHLA 1N7SC 2W6BA 5KJ7D 1OXZA 1T6AA 1Y47A 3H1HJ 2KYVA 5AW9B 4IFDK 4NB8D 1URQC 3H1JG 3MTUE 3C1LA 3H1KG 1DIPA 4AUWA 2HMNA 3O6QB 3CCEP 2FXMA 2RKLA 2Y0CA 1LTBC 2HYNA 4Y28J 1L4AA 2P67A 1VPCA 3GTEA 5AVVB 3L37A 3L71E 3R4YA 2E74B 3OAKA 1Q2NA 1L4AC 3L35A 1HBWA 5E79H 3H25A 1L0LE 2ZYDA 1HGVA 2BASA 3VP9A 5KLVE 3MUDA 2E4QA 2ZJSE 4PV1D 3GKEA 3M06A 1IO4A 1BCCD 1HWTC 2C0XA 3N4XA 1W2EA 1SQBJ 4KJMA 1IK9A 1IZNB 2G3AA 3D6YA 4YXWH 2WPRA 5GTIH 4IFMA 3S1KA 1OMIA 3L72G 1JNMA 2ZYAA 3CCVP 2AEFA 2WSSH 3CX5H 1AQTA 3L75E 1LTTC 3OW2O 1AJYA 1OVUA 2H43A 3A0BH 1SVFA 2KLUA 3F5HA 1PGQA 1SQVG 3L73G 2W27A 1PV3A 3GF3A 4ZKUA 3F89A 2Y0DA 2ZXEB 2BEZF 3CC2P 1ZOYC 1AQ5A 3PLNA 5KLVD 1FOSE 1ULJA 2N9YB 1L0LK 1QVGO 5KLVK 1LTJC 1P84H 1CI6B 1GU5A 4D6TG 1KILA 1Z56A 2E75D 1PGJA 2BMOA 3L74D 2AEJA 3M0DC 1G2CA 1JY2P 1KILC 1H88A 2FFDB 1KMIZ 1T2KC 2D2CD 4I1LA 2XDJA 2R5BA 2Y9ZA 1SQBE 4UB8H 2NZ2A 1FAVA 4ZMDA 3M0AA 3AECC 1WT6A 4ASWA 1FZGA 2QJPB 3KYQA 1N73A 5CCGC 1PP9D 1N73C 4HKVA 3IR9A 5KJ7C 1RF1A 2GA1A 2RN0A 2FKWB 4IL6E 1O7NA 5AW2B 1NU1G 3CXHD 1RF1C 1NYHA 1FBMA 1FZCA 2KXPB 3KZIE 4QDFB 3HE5A 1ZXGA 3L70J 2RMZA 1FZCC 4DT0A 3U59A 3AE4C 2A06E 3FWNA 1KYOI 2NVGA 2LR2A 4QDDA 1O7PA 1KYOE 3RK2B 1K05A 3WMM0 5BVZA 2Y0EA 1KORA 1SFCB 1MFZA 1X0TA 2FYNB 3QWOC 4H0LB 3IN6A 4GKGA 2DE7D 1L2PA 2N1TD 3CD6P 4Y99B 4WY4B 1SQBK 5B66H 2XV5A 2MKVA 1PZQA 2O01N 5CJ0A 4CPGA 3W67A 5KLIC 4LC1A 2O01J 3VMZA 1AV1A 4GODA 4I6MC 3L36A 1EG9A 1NKNA 2PFXA 1OVVA 2A45I 2G8YA 1NYKA 1T8ZA 3H1JD 3PP5A 2Q3EA 3P8MC 3GG2A 3H1KD 4TLFA 1YI2P 2Z5IA 3FGAD 1BDDA 3H1IJ 3BRTB 4XE5B 4JBZA 5AW1B 3B5ND 3GCEA 3AE5C 5KAIE 3EQQA 3PTZA 3A5TA 1BGYD 1FJKA 3B8EB 4OWFA 3K5BA 1LWUC 4ZNCA 2BEQD 3AE2C 1JUNA 1IC2A 1K8AQ 3TGUD 3L70E 3A7OA 2ZFCA 4EIJA 2P1JA 5AW8B 2O1KA 1K04A 1X8YA 5KAFE 1FZFA 2QM8A 4AIVA 3FXDA 3HD7B 1NJIQ 2WSFH 1M7LA 2E75C 4I7ZC 3RGUA 1J1EB 3CWBJ 2PAJA 2K88A 2VRSA 4GOEA 2W6JH 2D2CC 3CCRP 3CMEP 2ZT9B 4HJLA 1TU3F 1NTKJ 2J5UA 1HH0A 1HJBA 1R8EA 2Q3WA 2QG4A 1M1JB 1HJ0A 4H44D 4PD4D 3HUSB 4JYCA 2E42A 3M9HA 1QGKB 1LT9B 1EZVI 3L73D 1E79H 4NBED 1NVOA 1GD2E 1YJNP 2CK3H 1EZVE 2JO6A 5APTA 5EFWB 3AE8C 5H2FE 2KS1B 3H1IE 1JEKA 1KTMA 1U7MA 1S9KE 1NO4A 2R5DA 3MZWB 1SS1A 2E76D 2NPSA 4C7NB 5BU5A 4HM8A 1Q81Q 3VTPC 1FZEA 2NPSC 4D6TD 3GB4A 2OTLP 1AA0A 1DD4A 1BCCJ 1SP4A 1A02F 1S3JA 2JEEA 2L91A 3L71G 3HTKA 1NTMG 1VQ9P 2Q9IA 1OVRA 2YMKA 1N7SB 1KILE 2W83C 4K3AA 2YFLA 3NXSA 1M56D 2OQQA 2JDIH 2L5GB 1AFOA 4XA4A 4R4MA 1YTZT 2N1TC 1VQMP 2XRXA 2B87A 3CWBE 1Q82Q 1IFMA 1VQ7P 5TISE 1RE4A 5APWA 1HF9A 1PGPA 2NUKA 1NTKE 1BE3G 1RE4C 3KHUA 1GL2B 1EZVD 5CMZA 2QE7H 2NWFA 2YXRB 1SLQA 1QL2A 2IPPA 3RL0D 4HM1A 4EMJB 3H1ID 3L75G 1S9KD 2NRGA 4QUQA 1JMBA 2OYHA 2V7QJ 1LJ2A 4NBHD 1A02J 3VMID 2H88C 3B5NC 5KLVJ 3H1HG 1T3JA 1VF5D 1FS0E 3EN1A 3Q1MA 1KZUB 1VQ8P 1W5CE 1GZLA 3TSIA 1R5LA 1FZBA 1BSNA 4QUPA 3LIDA 3L74J 1EDLA 1DX7A 3MIWA 1BCCE 3VYIA 1YJ9P 2O3JA 1AVOA 1D7MA 1OX3A 3RL0g 3CC7P 5AW6B 2KS1A 2JP3A 3CL3D 2FXOA 1UUWA 4RESB 2WZ7A 3LW5J 5AVSB 5DJTB 4DCKA 3OA7A 2E74D 3D71A 4HM6A 2H8PD 2BCCJ 3JCUE 2HPCB 3RBXA 2HMKA 1NTKK 4AQRD 2WPSA 1PP9J 2O1JA 1LP1A 4WBAA 2WTYA 4LGDE 1LTJB 2IBZG 1H0TB 4H44C 2K1AA 3V5BA 2W6AA 2QJKB 3CCQP 4R4LA 3GLMA 1RH5B 4U3FD 3RK3B 4XFJA 1O7HA 4NBAD 3HE4B 2OTKE 4I2LC 4IL6H 1Y9BA 3H1LG 2R44A 1PPJG 2QM7A 2YFJA 1JCDA 3CCUP 2E76C 3KZIH 2NUMA 3GZXA 1YTZI 1SQQD 2K9JB 3GOBA 4Z1MH 3Q5RA 1GL2A 3MUDC 4NPDA 2YIUC 5AEUA 1N2DC 1MKMA 1NTZD 2WSCJ 3EFGA 2A06G 2WT7B 3V2PA 3L74E 1KYOH 2OYIA 3MD0A 1RQVA 1O7MA 3G3ZA 2HMMA 2QJYC 2KLVA 2OYIC 1MZ9A 1DD3A 3A2AA 1ZRTD 2YKQA 4HM0A 3U1AA 1VL2A 3H1JJ 2BCCE 3H1KJ 3MGNA 3V2QA 1IFIA 2IZ1A 4WVZA 1HGZA 1X22A 1PP9E 3TYYA 1GK6A 1JCCA 5BOKA 2HG5D 2JR8A 4L75A 3MP7B 3CXHI 1BGYJ 2A45H 5AW4B 2FXPA 4PV1B 4KHXA 3RL0C 3CXHE 1SJGA 1O7WA 3EFFK 5KAIH 2QRXA 2OTJP 3E1IA 1NAFA 4NPEA 1S5LX 3TGUJ 3FXEA 2N9BA 3SFEC 5TJHA 1VF5C 2K3RA 5APVA 3VP8A 3FWLA 3UIAA 3U1CA 3A3YB 1H8AA 2HMJA 3KPEA 4JPZB 2ZAEB 1L0ND 1G8JB 5AVWB 2ZXXA 3O6QA 5KAFH 2LXCB 3IFMA 1USDA 4WB4A 1KQLA 2H89C 1S5LE 3OJAB 3L72J 3TF5A 3HE4A 1IJDB 1KB9D 3VCPA 4H13B 2B24A 2XKMA 4PJ0E 2QPZA 3SWYA 3GTSA 1NGMB 3KXDA 4B86A 4IL6X 2BCCD 2E74C 5APXA 1LWUB 1KQGB 2FYUG 3AE7C 4YPCA 4ASVA 2K9JA 1ZW0A 2M0BA 1O7GA 1MUUA 2WPVB 3P32A 5AW0B 1OW7A 2O01H 3L73J 3RK2D 1VQOP 4JYBA 3H1JE 5AVQB 1SFCD 1SQXG 3VN0A 3H1KE 3R2PA 1QLED 4NB9D 1X79B 2OGUA 2AEMA 3LIEA 1J2JB 2JWAA 2E75B 2NPSD 4HM7A 1BGYE 1FZAA 5H2FH 3ITKA 1CSBA 3QH9A 1RE3A 2V4HA 3WU2E 1GTWA 4D6TJ 2Z4EA 2D2CB 1SQPG 3GHGB 1RE3C 4BRYB 2B9BA 4NBFD 2QA4P 3TGUE 1S2EA 3AEFC 1ZR4A 1Q7YQ 1W2BO 1IFNA 4RJTA 1FDIA 1HTLC 4NBGD 2XNDH 4OGQD 1PL5A 3PRJA 3L72E 2IDBA 1YQ3C 3SSUA 5C39A 2QIWA 4KT0J 5KKZB 3TDKA 2KUBA 5CHXA 4PD4I 3CX5I 4JF7A 1CI6A 2XNXA 4P1CH 2IBZD 2YO3A 4HH2A 3P8CD 4PD4E 5TISH 3CPWO 1PGOA 3HD7D 2I7FA 2FFDA 3L73E 2IYPA 4L76A 3H1LD 4P1BH 3V4QA 4EI2A 1LTGC 2SPZA 2J59M 3V4WA 2ZT9D 3AEEC 2XU6A 2IFNA 1QEXA 2HODB 1NOHA 3BCCG 3BRVB 3M9QA 2N1TB 2QJPC 1OW6A 1EQ7A 1OW8A 2GBWA 4D6TE 3CLQA 1JOCA 3D89A 4UB6E 2JWDA 1AVYA 1FU1A 3O8ZA 1JB0J 1YBKA 1J1DB 2P2UA 2Q7CA 3L72D 5AVRB 4QDFA 3V6IA 3VOPA 2ZYGA 1YJWP 2QEXP 1PIXA 1KC8Q 1RY3A 4QCKA 3CX5D 1FJPA 2QVAA 3JCUH 1SQVD 2B89A 2WSEJ 1SFCA 3GL0A 1NKZB 4U3FJ 1OZHA 1M90Q 3AE3C 1SQVK 1JY3N 3NFQA 3RK2C 2H7HA 1SFCC 3N0QA 2KK7A 2PGDA 2IFMA 4WY4A 4HYTB 4YTPC 2YXQB 1M1KQ 4A7PA 5AW3B 1UUVA 4GT1A 4Y99C 4AAYB 3VMXA 5BU8B 3TNUB 3Q5PA 5AVZB 2KB7P 1VQ6P 1FDOA 1P84D 1SQQJ 2V7QH 2JO1A 2J58A 1UIIA 1RQUA 2P10A 1GL2D 1LTAC 2M5AB 1X9VA 2DE5D 1L0LG 1VQKP 1NTZJ 5KLVG 2YFIA 4GOFA 2ZVOB 3C9IA 4H44B 1URQB 1MFTA 2POHA 5APSA 3AEDC 3S4RA 1S1CX 4OGQC 1ZP0C 3VMYA 2FBWC 3L74G 2HODA 1GDTA 3G9RA 2FYUD 5DJUB 2Y9YA 3IAOA 3Q5SA 1L4AB 3CCJP 1SQXD 2E76B 3LW5H 2XZRA 1RF0A 2DW3A 1LTIC 2IZ0A 1JM0A 5CCHD 3HD7A 3P7KA 3BVHA 1NU1D 1NH4A 2YVJB 1RF0C 2KZJA 5AVXB 1OWAA 3JC22 1G1IA 1NU1K 3AE6C 3HD7C 1JTHB 4U3FE 2OYOA 1YIJP 1PP9G 2OYHC 1J1EC 2BMQA 3AE1C 1SQPD 2HLOA 3CXHH 2ZT9C 1M1JA 3HUSA 1NTMJ 2I8DA 1EDJA 2MJZA 1LT9A 5CBNA 1M1JC 2IX7C 4N6JA 4DJGA 1SQQE 2FY8A 1L0NJ 1Q90D 3G6EP 1ULIA 3RK3D 2XSHA 2KP8A 1NTZE 2Q6QA 2WPQA 1FC2C 3VMAA 3B71A 1S5LH 4U7JA 4C7NA 1VQ5P 2WSCH 3DQYA 3I56P 3GMAA 1BE3J 5B5EE 3V2RA 1EDKA 1SQBG 1K73Q 1ZRTE 4W7YA 4NBDD 1PFIA 4C7RA 4N78D 4TT3H 3VMGD 3AZCA 1IFPA 1N7SA 2AXTE 1RFSA 1FQTA 3D70A 1URQA 2YO2A 1ZV8A 1OFCX 1KILB 3W68A 2P58A 1JY2N 3BCCD 2B1XA 1G2CB 4W7ZA 4HJGH 1RHZB 1GMJA 4BXLA 4W80A 3WU2H 2GUSA 1BGYG 2KSJA 3S9OA 1SQQK 1NTME 2Q5UA 1GU4A 1JM1A 1GL2C 1N73B 4DZOA 2KZIA 1L0NE 4EDFA 1KQSO 1KB9I 1NTZK 2BMRA 1JTHA 3TGUG 1KFNA 2Q3IA 3FX0A 1N8RQ 1KB9E 3CCLP 1RF1B 3PJSK 1N86A 1K9MQ 1QX8A 2YNYA 4RO0A 1ZMEC 1FZCB 1BE3E 2HFED 2JJLA 3HE5B 2LXBA 3M91A 3G71P 3CI9A 4HB1A 2KSEA 3H6PA 1CW5A 2W90A 5CCHA 2Z5HA 5APQA 3L4FA 2YMYA 1JY3O 1OIPA 2KIKA 4PD4H 2K9YA 3ABVC 2YKPA 3H1LJ 5CCHC 1GW4A 2E4PA 4QMAA 4QURA 4H13D 1YHQP 2A45G 1VDFA 3Q3DA 1HVVA 3H1HE 3I55P 1VQPP 2HPCA 4L74A 5KLIB 4BWNA 3L71D 1IK7A 1NTMD 3I5CA 2E43A 5CBOA 1L0LD 1H0TA 1LTJA 2ZVNB 1EXIA 2W8ZA 1NTMK 2GM4A 3L70G 2WVRA 2QJKC 1L0NK 1EC5A 1KV4A 4UB6H 4DOJA 1Q90C 3M0DA 3A0HE 2WWWA 3RK3C 1VQNP 1KQFB 1VM9A 2E5TA 4K35A 3KQGA 3WUTA 2RH0A 1BDCA 3AEBC 1BE3D 4MN4C 1GK4A 1MV8A 2IBZI 2ITAA 1N7LA 2I1KA 3WUUA 3WUVA 1Q86Q 3VMHD 3GW6A 5GTHE 1SQVJ 2P7JA 2IBZE 2PRRA 3L75D 2KI7B 5CCGA 3P8CE 2WT7A 2IYOA 4H0LD 1DH3A 1KN7A 3G4SP 5KJ7A 4WY4D 3H1HD 5K5GB 3GL2A 1YITP 3KDPB 4I7ZB 3H1LE 1PPJE 2CKFA 3AEGC 4RKUJ 1EZVG 4M3LA 1M8OB 2WQYC 3H1IG 1XTGB 2R3SA 2C9NY 5E79E 2GBXA 1R5SA 1G1JA 4GDOA 1JMMA 3PH0A 1XTCC 2HR3A 1Y8AA 3CC4P 1LNQA 1U7JA 1VQ4P 5L8RJ 1G8KB 4HM4A 2CPSA 4WWIA 5GTIE 4PV1C 3USSA 1SQBD 2FYUJ 2R32A 1KFMA 1NAYA 3EWKA 1DEEG 5AEWA 5CJ4A 2HMLA 1SQXJ 2NPSB 3CX5E 3CWBG 1NU1J 5KTBA 3A0BE 1SQVE 1IFJA 1NTKG 1FDMA 1EDIA 1PPJD 2FFDC 1USEA 1QL1A 2E5YA 2M3BA 3HTKB 1JY2O 5APYA 1IFDA 3NTNA 2WSEH 1SQPJ 2PP6A 3NMDA 3M9BA 4H13C 1P84I 2KNCB 3E1RA 3SWKA 4C46A 4U3FG 1S72P 2XR8A 1LWUA 2KOGA 4OGQB 5AW5B 3VCAA 2DE6D 1S4XA 1P84E 3T97B 3D6ZA 3II6A 2HMOA 2A06D 2B87B 2WITA 2JKVA 3B4SA 4YXDC 2B88A 4O9BA 3EQ2A 1KYOD 1NDOA 1BSHA 5APUA 1VQLP 1SQQG 1T3UA 2OARA 1BCCG 3IF4A 4OVNF 3FOUA 2C9LY 1YYCA 4UB8E 3H32B 2AXCA 3B5NB 4EOTA 1NTZG 2OYHB 3GHGA 1EXJA 4BRYA 5HL4A 2FYUE 5B5EH 4L73A 4OH8B 3ZDMA 3GHGC 1N7SD 3AE9C 1SQXE 4HKZH 2FYZA 1URQD 1NU1E 2AXTH 4IOIH 2FYNC 4H0LC 4AYCA 2M3EA 3BCCJ 4JQ0D 4WY4C 2Q1KA 4NBCD 3V2NA 1ZN5A 2NVEA 1ZLLA 5CXMA 2GUVA 4HM3A 4EYYQ 1SQPE 1UIXA 1GW3A 1L4AD 2M8RA 5KKZC 1HUCA 1H89A
chains in the Genus database with same CATH topology
1WQLA 1VF5C 4TT3H 1EG9A 3VMGD 3AZCA 2WSFJ 2G8YA 1NYKA 2HMJA 1RFSA 1FQTA 1G8JB 3RK3E 3GZYA 3D70A 3O6QA 3AEAC 3FGAD 2H89C 2QSIA 3GCEA 3AE5C 3EQQA 3VCPA 2B1XA 4H13B 2B24A 3SFDC 2QPZA 3GTSA 1NGMB 4HM2A 1GMJA 4IL6X 2BEQD 3AE2C 2E74C 3S9OA 1KQGB 3AE7C 1O7GA 1U57A 2WPVB 3L70E 2ZYLA 4NBBD 1NTME 1OW7A 1K04A 1YQ4C 1JM1A 3H1JE 3H1KE 4AIVA 1L0NE 3C8VA 4NB9D 2BMRA 2E75C 4I7ZC 1KB9E 3Q2YA 2E75B 3BCCE 4HM7A 2JZAA 2D2CC 2ZT9B 4HJLA 1TU3F 1ZMEC 2J5UA 2D2CB 1BE3E 1R8EA 4QDCA 2Q3WA 1WMKA 1HJ0A 4H44D 4NBFD 3TGUE 3AEFC 3GF7A 1VCKA 2K9YA 3ABVC 2XSOA 1FDIA 4NBED 4NBGD 2E4PA 4QURA 1EZVE 4H13D 1RIEA 2JO6A 4OGQD 3Q3DA 3AE8C 3H1HE 1PL5A 3H1IE 1KTMA 3L72E 2IDBA 1YQ3C 2E76D 2QIWA 4KT0J 4HM8A 1IK7A 4P1CH 1VF5B 3C0DA 5M1BA 1EXIA 3GB4A 2NVFA 1DD4A 4HM5A 4PD4E 2I7FA 2QJKC 2YMKA 1KILE 1Q90C 3L73E 4NB8D 1KQFB 1VM9A 1DIPA 2YFLA 2HMNA 4P1BH 2OQQA 2ZT9D 3AEEC 3AEBC 4Y28J 4R4MA 2XRXA 3GTEA 3CWBE 3L71E 3R4YA 2E74B 3VMHD 2QJPC 1OW6A 1HF9A 1ZRTE 3H25A 1OW8A 1L0LE 2GBWA 2IBZE 2NUKA 1NTKE 5KLVE 3D89A 2E4QA 4PV1D 4H0LD 3GKEA 2NWFA 1JB0J 4HM1A 4EMJB 3GL2A 4QUQA 4I7ZB 3H1LE 2G3AA 3D6YA 1PPJE 2CKFA 3AEGC 2V7QJ 4QDFA 4RKUJ 4NBHD 3VMID 2H88C 1PIXA 2WQYC 1OMIA 1VF5D 3EN1A 2GBXA 4QCKA 3Q1MA 4GDOA 3L75E 4QUPA 2WSEJ 3GL0A 3AE3C 1AJYA 5L8RJ 1G8KB 1BCCE 4HM4A 3N0QA 4YTPC 4PV1C 1UUVA 3RL0g 1PV3A 3GF3A 2JP3A 4AAYB 1UUWA 3EWKA 5AEWA 3LW5J 2BEZF 3Q5PA 2E74D 3D71A 1ZOYC 4HM6A 2HMLA 1FDOA 2JO1A 1ULJA 3CX5E 1RQUA 2P10A 2HMKA 1SQVE 2DE5D 4H44C 2YFIA 2E75D 4R4LA 2BMOA 3GLMA 4H44B 4XFJA 1O7HA 4NBAD 1KMIZ 3AEDC 1S1CX 2D2CD 4H13C 4OGQC 1Y9BA 1ZP0C 1SQBE 2FBWC 3G9RA 2XR8A 2NZ2A 2YFJA 4OGQB 3VCAA 3AECC 2E76C 2DE6D 2NUMA 1P84E 3T97B 3D6ZA 3IAOA 3Q5SA 2HMOA 3GZXA 2E76B 4YXDC 3GOBA 4Z1MH 3Q5RA 1NDOA 4HKVA 2YIUC 2YVJB 5AEUA 1MKMA 2WSCJ 3AE6C 3L74E 4U3FE 1O7NA 1RQVA 3FOUA 1O7MA 2BMQA 2HMMA 1NYHA 3AE1C 2QJYC 1DD3A 4QDFB 1EXJA 2ZT9C 5HL4A 2FYUE 4HM0A 1VL2A 3AE4C 2A06E 2BCCE 3AE9C 1SQQE 1SQXE 2NVGA 1Q90D 4QDDA 1O7PA 1ULIA 1NU1E 1PP9E 1KYOE 1K05A 2FYNC 5BOKA 2XSHA 4H0LC 1KORA 1NTZE 2FXPA 4PV1B 4H0LB 3IN6A 3B71A 4NBCD 4U7JA 2DE7D 3CXHE 1SJGA 1O7WA 2NVEA 3DQYA 5CXMA 3GMAA 2MKVA 4HM3A 1SQPE 1UIXA 5KLIC 2O01J 5KKZC 1S5LX 3SFEC 4NBDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQL A;  3GL2 A;  4QUQ A;  1VF5 C;  3H1L E;  1EG9 A;  1PPJ E;  2XR8 A;  2CKF A;  2XSO A;  2YFJ A;  3VMG D;  3AZC A;  4QDF A;  4NBE D;  3VCA A;  4NBG D;  4NBH D;  2E76 C;  1NYK A;  2DE6 D;  2E4P A;  3VMI D;  2NUM A;  1P84 E;  4QUR A;  2HMJ A;  1EZV E;  2HMO A;  4H13 D;  1RFS A;  1RIE A;  3GZX A;  2JO6 A;  4OGQ D;  1FQT A;  1G8J B;  3GZY A;  3H1H E;  1VF5 D;  3EN1 A;  3GOB A;  2GBX A;  4QCK A;  3H1I E;  3L72 E;  1NDO A;  2E76 D;  4HKV A;  3GCE A;  2YIU C;  2YVJ B;  5AEU A;  3EQQ A;  3VCP A;  2B1X A;  4HM8 A;  2B24 A;  3L75 E;  4QUP A;  3L74 E;  4U3F E;  2QPZ A;  3GL0 A;  4P1C H;  3GTS A;  3C0D A;  3GB4 A;  1O7N A;  1G8K B;  1BCC E;  2NVF A;  3FOU A;  4HM2 A;  1O7M A;  4HM5 A;  2BMQ A;  4PD4 E;  2HMM A;  4HM4 A;  3N0Q A;  2QJY C;  2E74 C;  4PV1 C;  2I7F A;  2QJK C;  4QDF B;  1O7G A;  2YMK A;  3L70 E;  1UUV A;  2ZT9 C;  2ZYL A;  4NBB D;  1Q90 C;  2FYU E;  3L73 E;  4NB8 D;  5HL4 A;  1NTM E;  4AAY B;  1UUW A;  1VM9 A;  1JM1 A;  4HM0 A;  5AEW A;  3H1J E;  2YFL A;  2HMN A;  4P1B H;  2E74 D;  3H1K E;  2A06 E;  4AIV A;  2BCC E;  1L0N E;  4HM6 A;  2HML A;  1SQQ E;  2NVG A;  1SQX E;  4NB9 D;  2BMR A;  2ZT9 D;  1ULJ A;  4QDD A;  3CX5 E;  2E75 C;  1O7P A;  1ULI A;  4I7Z C;  1NU1 E;  2HMK A;  1PP9 E;  1KYO E;  2XRX A;  1KB9 E;  2FYN C;  3GTE A;  2XSH A;  3CWB E;  4H0L C;  5BOK A;  3BCC E;  3L71 E;  1NTZ E;  1SQV E;  2DE5 D;  2JZA A;  4HM7 A;  3VMH D;  2QJP C;  4H44 C;  2D2C C;  1L0L E;  2GBW A;  2IBZ E;  2YFI A;  4NBC D;  2E75 D;  2NUK A;  1NTK E;  2BMO A;  2DE7 D;  4HJL A;  5KLV E;  3CXH E;  1SJG A;  1O7W A;  3D89 A;  2E4Q A;  4PV1 D;  1BE3 E;  4H0L D;  1O7H A;  2NVE A;  3DQY A;  3GKE A;  4NBA D;  5CXM A;  4QDC A;  2Q3W A;  4HM3 A;  1SQP E;  5KLI C;  4H44 D;  4NBF D;  2NWF A;  5KKZ C;  2D2C D;  3TGU E;  4H13 C;  4HM1 A;  4OGQ C;  4EMJ B;  1ZRT E;  4NBD D;  1SQB E;  1VCK A; 
#chains in the Genus database with same CATH topology
 1WQL A;  3CCS P;  3L70 D;  2WSF J;  3JSV C;  1WRG A;  1LP1 B;  3RK3 E;  3GZY A;  2UWJ E;  3AEA C;  4N3Y B;  4ZKP A;  5B66 E;  2QSI A;  1E5W A;  2LKM A;  3PHL A;  3BAS A;  1L0N G;  1DEB A;  2KNC A;  3SFD C;  3CMA P;  1KB9 H;  2N1T A;  2FYU K;  4HM2 A;  3T97 A;  3SWF A;  4IFF A;  3MHV A;  3TK1 A;  4N78 E;  1U57 A;  1SQX K;  5AVY B;  2ZYL A;  4NBB D;  1ZR2 A;  1YQ4 C;  2BCC G;  1CZQ A;  2YIU B;  2WMM A;  5AVU B;  3C8V A;  5AW7 B;  1J1D C;  3E7K A;  1M57 D;  1NWQ A;  2C0W A;  3H32 A;  3Q2Y A;  3B5N A;  3BCC E;  1QVF O;  1KD1 Q;  2JZA A;  2QJY B;  2OYI B;  3L71 J;  1SQP K;  2K37 A;  2R3C A;  1L0L J;  1JO5 A;  3HUS C;  4QDC A;  2YKO A;  1WMK A;  1LT9 C;  4LLH A;  1LGH B;  3GF7 A;  1FOS F;  1JY3 P;  1VCK A;  2CPB A;  1KIL D;  2XSO A;  1LTS C;  1T2K D;  1LT1 A;  3HRN A;  3BAT A;  1RIE A;  3A0H H;  1FE6 A;  3TNU A;  3RL0 B;  4PJ0 H;  3N7N A;  4NPF X;  3CWB D;  2I1J A;  5AVT B;  3CCM P;  3RBZ A;  4GIF A;  3L75 J;  2M5A A;  1VF5 B;  5CCG D;  3C0D A;  5M1B A;  1NTK D;  2NVF A;  4HM5 A;  5GTH H;  1NHL A;  1N7S C;  2W6B A;  5KJ7 D;  1OXZ A;  1T6A A;  1Y47 A;  3H1H J;  2KYV A;  5AW9 B;  4IFD K;  4NB8 D;  1URQ C;  3H1J G;  3MTU E;  3C1L A;  3H1K G;  1DIP A;  4AUW A;  2HMN A;  3O6Q B;  3CCE P;  2FXM A;  2RKL A;  2Y0C A;  1LTB C;  2HYN A;  4Y28 J;  1L4A A;  2P67 A;  1VPC A;  3GTE A;  5AVV B;  3L37 A;  3L71 E;  3R4Y A;  2E74 B;  3OAK A;  1Q2N A;  1L4A C;  3L35 A;  1HBW A;  5E79 H;  3H25 A;  1L0L E;  2ZYD A;  1HGV A;  2BAS A;  3VP9 A;  5KLV E;  3MUD A;  2E4Q A;  2ZJS E;  4PV1 D;  3GKE A;  3M06 A;  1IO4 A;  1BCC D;  1HWT C;  2C0X A;  3N4X A;  1W2E A;  1SQB J;  4KJM A;  1IK9 A;  1IZN B;  2G3A A;  3D6Y A;  4YXW H;  2WPR A;  5GTI H;  4IFM A;  3S1K A;  1OMI A;  3L72 G;  1JNM A;  2ZYA A;  3CCV P;  2AEF A;  2WSS H;  3CX5 H;  1AQT A;  3L75 E;  1LTT C;  3OW2 O;  1AJY A;  1OVU A;  2H43 A;  3A0B H;  1SVF A;  2KLU A;  3F5H A;  1PGQ A;  1SQV G;  3L73 G;  2W27 A;  1PV3 A;  3GF3 A;  4ZKU A;  3F89 A;  2Y0D A;  2ZXE B;  2BEZ F;  3CC2 P;  1ZOY C;  1AQ5 A;  3PLN A;  5KLV D;  1FOS E;  1ULJ A;  2N9Y B;  1L0L K;  1QVG O;  5KLV K;  1LTJ C;  1P84 H;  1CI6 B;  1GU5 A;  4D6T G;  1KIL A;  1Z56 A;  2E75 D;  1PGJ A;  2BMO A;  3L74 D;  2AEJ A;  3M0D C;  1G2C A;  1JY2 P;  1KIL C;  1H88 A;  2FFD B;  1KMI Z;  1T2K C;  2D2C D;  4I1L A;  2XDJ A;  2R5B A;  2Y9Z A;  1SQB E;  4UB8 H;  2NZ2 A;  1FAV A;  4ZMD A;  3M0A A;  3AEC C;  1WT6 A;  4ASW A;  1FZG A;  2QJP B;  3KYQ A;  1N73 A;  5CCG C;  1PP9 D;  1N73 C;  4HKV A;  3IR9 A;  5KJ7 C;  1RF1 A;  2GA1 A;  2RN0 A;  2FKW B;  4IL6 E;  1O7N A;  5AW2 B;  1NU1 G;  3CXH D;  1RF1 C;  1NYH A;  1FBM A;  1FZC A;  2KXP B;  3KZI E;  4QDF B;  3HE5 A;  1ZXG A;  3L70 J;  2RMZ A;  1FZC C;  4DT0 A;  3U59 A;  3AE4 C;  2A06 E;  3FWN A;  1KYO I;  2NVG A;  2LR2 A;  4QDD A;  1O7P A;  1KYO E;  3RK2 B;  1K05 A;  3WMM 0;  5BVZ A;  2Y0E A;  1KOR A;  1SFC B;  1MFZ A;  1X0T A;  2FYN B;  3QWO C;  4H0L B;  3IN6 A;  4GKG A;  2DE7 D;  1L2P A;  2N1T D;  3CD6 P;  4Y99 B;  4WY4 B;  1SQB K;  5B66 H;  2XV5 A;  2MKV A;  1PZQ A;  2O01 N;  5CJ0 A;  4CPG A;  3W67 A;  5KLI C;  4LC1 A;  2O01 J;  3VMZ A;  1AV1 A;  4GOD A;  4I6M C;  3L36 A;  1EG9 A;  1NKN A;  2PFX A;  1OVV A;  2A45 I;  2G8Y A;  1NYK A;  1T8Z A;  3H1J D;  3PP5 A;  2Q3E A;  3P8M C;  3GG2 A;  3H1K D;  4TLF A;  1YI2 P;  2Z5I A;  3FGA D;  1BDD A;  3H1I J;  3BRT B;  4XE5 B;  4JBZ A;  5AW1 B;  3B5N D;  3GCE A;  3AE5 C;  5KAI E;  3EQQ A;  3PTZ A;  3A5T A;  1BGY D;  1FJK A;  3B8E B;  4OWF A;  3K5B A;  1LWU C;  4ZNC A;  2BEQ D;  3AE2 C;  1JUN A;  1IC2 A;  1K8A Q;  3TGU D;  3L70 E;  3A7O A;  2ZFC A;  4EIJ A;  2P1J A;  5AW8 B;  2O1K A;  1K04 A;  1X8Y A;  5KAF E;  1FZF A;  2QM8 A;  4AIV A;  3FXD A;  3HD7 B;  1NJI Q;  2WSF H;  1M7L A;  2E75 C;  4I7Z C;  3RGU A;  1J1E B;  3CWB J;  2PAJ A;  2K88 A;  2VRS A;  4GOE A;  2W6J H;  2D2C C;  3CCR P;  3CME P;  2ZT9 B;  4HJL A;  1TU3 F;  1NTK J;  2J5U A;  1HH0 A;  1HJB A;  1R8E A;  2Q3W A;  2QG4 A;  1M1J B;  1HJ0 A;  4H44 D;  4PD4 D;  3HUS B;  4JYC A;  2E42 A;  3M9H A;  1QGK B;  1LT9 B;  1EZV I;  3L73 D;  1E79 H;  4NBE D;  1NVO A;  1GD2 E;  1YJN P;  2CK3 H;  1EZV E;  2JO6 A;  5APT A;  5EFW B;  3AE8 C;  5H2F E;  2KS1 B;  3H1I E;  1JEK A;  1KTM A;  1U7M A;  1S9K E;  1NO4 A;  2R5D A;  3MZW B;  1SS1 A;  2E76 D;  2NPS A;  4C7N B;  5BU5 A;  4HM8 A;  1Q81 Q;  3VTP C;  1FZE A;  2NPS C;  4D6T D;  3GB4 A;  2OTL P;  1AA0 A;  1DD4 A;  1BCC J;  1SP4 A;  1A02 F;  1S3J A;  2JEE A;  2L91 A;  3L71 G;  3HTK A;  1NTM G;  1VQ9 P;  2Q9I A;  1OVR A;  2YMK A;  1N7S B;  1KIL E;  2W83 C;  4K3A A;  2YFL A;  3NXS A;  1M56 D;  2OQQ A;  2JDI H;  2L5G B;  1AFO A;  4XA4 A;  4R4M A;  1YTZ T;  2N1T C;  1VQM P;  2XRX A;  2B87 A;  3CWB E;  1Q82 Q;  1IFM A;  1VQ7 P;  5TIS E;  1RE4 A;  5APW A;  1HF9 A;  1PGP A;  2NUK A;  1NTK E;  1BE3 G;  1RE4 C;  3KHU A;  1GL2 B;  1EZV D;  5CMZ A;  2QE7 H;  2NWF A;  2YXR B;  1SLQ A;  1QL2 A;  2IPP A;  3RL0 D;  4HM1 A;  4EMJ B;  3H1I D;  3L75 G;  1S9K D;  2NRG A;  4QUQ A;  1JMB A;  2OYH A;  2V7Q J;  1LJ2 A;  4NBH D;  1A02 J;  3VMI D;  2H88 C;  3B5N C;  5KLV J;  3H1H G;  1T3J A;  1VF5 D;  1FS0 E;  3EN1 A;  3Q1M A;  1KZU B;  1VQ8 P;  1W5C E;  1GZL A;  3TSI A;  1R5L A;  1FZB A;  1BSN A;  4QUP A;  3LID A;  3L74 J;  1EDL A;  1DX7 A;  3MIW A;  1BCC E;  3VYI A;  1YJ9 P;  2O3J A;  1AVO A;  1D7M A;  1OX3 A;  3RL0 g;  3CC7 P;  5AW6 B;  2KS1 A;  2JP3 A;  3CL3 D;  2FXO A;  1UUW A;  4RES B;  2WZ7 A;  3LW5 J;  5AVS B;  5DJT B;  4DCK A;  3OA7 A;  2E74 D;  3D71 A;  4HM6 A;  2H8P D;  2BCC J;  3JCU E;  2HPC B;  3RBX A;  2HMK A;  1NTK K;  4AQR D;  2WPS A;  1PP9 J;  2O1J A;  1LP1 A;  4WBA A;  2WTY A;  4LGD E;  1LTJ B;  2IBZ G;  1H0T B;  4H44 C;  2K1A A;  3V5B A;  2W6A A;  2QJK B;  3CCQ P;  4R4L A;  3GLM A;  1RH5 B;  4U3F D;  3RK3 B;  4XFJ A;  1O7H A;  4NBA D;  3HE4 B;  2OTK E;  4I2L C;  4IL6 H;  1Y9B A;  3H1L G;  2R44 A;  1PPJ G;  2QM7 A;  2YFJ A;  1JCD A;  3CCU P;  2E76 C;  3KZI H;  2NUM A;  3GZX A;  1YTZ I;  1SQQ D;  2K9J B;  3GOB A;  4Z1M H;  3Q5R A;  1GL2 A;  3MUD C;  4NPD A;  2YIU C;  5AEU A;  1N2D C;  1MKM A;  1NTZ D;  2WSC J;  3EFG A;  2A06 G;  2WT7 B;  3V2P A;  3L74 E;  1KYO H;  2OYI A;  3MD0 A;  1RQV A;  1O7M A;  3G3Z A;  2HMM A;  2QJY C;  2KLV A;  2OYI C;  1MZ9 A;  1DD3 A;  3A2A A;  1ZRT D;  2YKQ A;  4HM0 A;  3U1A A;  1VL2 A;  3H1J J;  2BCC E;  3H1K J;  3MGN A;  3V2Q A;  1IFI A;  2IZ1 A;  4WVZ A;  1HGZ A;  1X22 A;  1PP9 E;  3TYY A;  1GK6 A;  1JCC A;  5BOK A;  2HG5 D;  2JR8 A;  4L75 A;  3MP7 B;  3CXH I;  1BGY J;  2A45 H;  5AW4 B;  2FXP A;  4PV1 B;  4KHX A;  3RL0 C;  3CXH E;  1SJG A;  1O7W A;  3EFF K;  5KAI H;  2QRX A;  2OTJ P;  3E1I A;  1NAF A;  4NPE A;  1S5L X;  3TGU J;  3FXE A;  2N9B A;  3SFE C;  5TJH A;  1VF5 C;  2K3R A;  5APV A;  3VP8 A;  3FWL A;  3UIA A;  3U1C A;  3A3Y B;  1H8A A;  2HMJ A;  3KPE A;  4JPZ B;  2ZAE B;  1L0N D;  1G8J B;  5AVW B;  2ZXX A;  3O6Q A;  5KAF H;  2LXC B;  3IFM A;  1USD A;  4WB4 A;  1KQL A;  2H89 C;  1S5L E;  3OJA B;  3L72 J;  3TF5 A;  3HE4 A;  1IJD B;  1KB9 D;  3VCP A;  4H13 B;  2B24 A;  2XKM A;  4PJ0 E;  2QPZ A;  3SWY A;  3GTS A;  1NGM B;  3KXD A;  4B86 A;  4IL6 X;  2BCC D;  2E74 C;  5APX A;  1LWU B;  1KQG B;  2FYU G;  3AE7 C;  4YPC A;  4ASV A;  2K9J A;  1ZW0 A;  2M0B A;  1O7G A;  1MUU A;  2WPV B;  3P32 A;  5AW0 B;  1OW7 A;  2O01 H;  3L73 J;  3RK2 D;  1VQO P;  4JYB A;  3H1J E;  5AVQ B;  1SFC D;  1SQX G;  3VN0 A;  3H1K E;  3R2P A;  1QLE D;  4NB9 D;  1X79 B;  2OGU A;  2AEM A;  3LIE A;  1J2J B;  2JWA A;  2E75 B;  2NPS D;  4HM7 A;  1BGY E;  1FZA A;  5H2F H;  3ITK A;  1CSB A;  3QH9 A;  1RE3 A;  2V4H A;  3WU2 E;  1GTW A;  4D6T J;  2Z4E A;  2D2C B;  1SQP G;  3GHG B;  1RE3 C;  4BRY B;  2B9B A;  4NBF D;  2QA4 P;  3TGU E;  1S2E A;  3AEF C;  1ZR4 A;  1Q7Y Q;  1W2B O;  1IFN A;  4RJT A;  1FDI A;  1HTL C;  4NBG D;  2XND H;  4OGQ D;  1PL5 A;  3PRJ A;  3L72 E;  2IDB A;  1YQ3 C;  3SSU A;  5C39 A;  2QIW A;  4KT0 J;  5KKZ B;  3TDK A;  2KUB A;  5CHX A;  4PD4 I;  3CX5 I;  4JF7 A;  1CI6 A;  2XNX A;  4P1C H;  2IBZ D;  2YO3 A;  4HH2 A;  3P8C D;  4PD4 E;  5TIS H;  3CPW O;  1PGO A;  3HD7 D;  2I7F A;  2FFD A;  3L73 E;  2IYP A;  4L76 A;  3H1L D;  4P1B H;  3V4Q A;  4EI2 A;  1LTG C;  2SPZ A;  2J59 M;  3V4W A;  2ZT9 D;  3AEE C;  2XU6 A;  2IFN A;  1QEX A;  2HOD B;  1NOH A;  3BCC G;  3BRV B;  3M9Q A;  2N1T B;  2QJP C;  1OW6 A;  1EQ7 A;  1OW8 A;  2GBW A;  4D6T E;  3CLQ A;  1JOC A;  3D89 A;  4UB6 E;  2JWD A;  1AVY A;  1FU1 A;  3O8Z A;  1JB0 J;  1YBK A;  1J1D B;  2P2U A;  2Q7C A;  3L72 D;  5AVR B;  4QDF A;  3V6I A;  3VOP A;  2ZYG A;  1YJW P;  2QEX P;  1PIX A;  1KC8 Q;  1RY3 A;  4QCK A;  3CX5 D;  1FJP A;  2QVA A;  3JCU H;  1SQV D;  2B89 A;  2WSE J;  1SFC A;  3GL0 A;  1NKZ B;  4U3F J;  1OZH A;  1M90 Q;  3AE3 C;  1SQV K;  1JY3 N;  3NFQ A;  3RK2 C;  2H7H A;  1SFC C;  3N0Q A;  2KK7 A;  2PGD A;  2IFM A;  4WY4 A;  4HYT B;  4YTP C;  2YXQ B;  1M1K Q;  4A7P A;  5AW3 B;  1UUV A;  4GT1 A;  4Y99 C;  4AAY B;  3VMX A;  5BU8 B;  3TNU B;  3Q5P A;  5AVZ B;  2KB7 P;  1VQ6 P;  1FDO A;  1P84 D;  1SQQ J;  2V7Q H;  2JO1 A;  2J58 A;  1UII A;  1RQU A;  2P10 A;  1GL2 D;  1LTA C;  2M5A B;  1X9V A;  2DE5 D;  1L0L G;  1VQK P;  1NTZ J;  5KLV G;  2YFI A;  4GOF A;  2ZVO B;  3C9I A;  4H44 B;  1URQ B;  1MFT A;  2POH A;  5APS A;  3AED C;  3S4R A;  1S1C X;  4OGQ C;  1ZP0 C;  3VMY A;  2FBW C;  3L74 G;  2HOD A;  1GDT A;  3G9R A;  2FYU D;  5DJU B;  2Y9Y A;  3IAO A;  3Q5S A;  1L4A B;  3CCJ P;  1SQX D;  2E76 B;  3LW5 H;  2XZR A;  1RF0 A;  2DW3 A;  1LTI C;  2IZ0 A;  1JM0 A;  5CCH D;  3HD7 A;  3P7K A;  3BVH A;  1NU1 D;  1NH4 A;  2YVJ B;  1RF0 C;  2KZJ A;  5AVX B;  1OWA A;  3JC2 2;  1G1I A;  1NU1 K;  3AE6 C;  3HD7 C;  1JTH B;  4U3F E;  2OYO A;  1YIJ P;  1PP9 G;  2OYH C;  1J1E C;  2BMQ A;  3AE1 C;  1SQP D;  2HLO A;  3CXH H;  2ZT9 C;  1M1J A;  3HUS A;  1NTM J;  2I8D A;  1EDJ A;  2MJZ A;  1LT9 A;  5CBN A;  1M1J C;  2IX7 C;  4N6J A;  4DJG A;  1SQQ E;  2FY8 A;  1L0N J;  1Q90 D;  3G6E P;  1ULI A;  3RK3 D;  2XSH A;  2KP8 A;  1NTZ E;  2Q6Q A;  2WPQ A;  1FC2 C;  3VMA A;  3B71 A;  1S5L H;  4U7J A;  4C7N A;  1VQ5 P;  2WSC H;  3DQY A;  3I56 P;  3GMA A;  1BE3 J;  5B5E E;  3V2R A;  1EDK A;  1SQB G;  1K73 Q;  1ZRT E;  4W7Y A;  4NBD D;  1PFI A;  4C7R A;  4N78 D;  4TT3 H;  3VMG D;  3AZC A;  1IFP A;  1N7S A;  2AXT E;  1RFS A;  1FQT A;  3D70 A;  1URQ A;  2YO2 A;  1ZV8 A;  1OFC X;  1KIL B;  3W68 A;  2P58 A;  1JY2 N;  3BCC D;  2B1X A;  1G2C B;  4W7Z A;  4HJG H;  1RHZ B;  1GMJ A;  4BXL A;  4W80 A;  3WU2 H;  2GUS A;  1BGY G;  2KSJ A;  3S9O A;  1SQQ K;  1NTM E;  2Q5U A;  1GU4 A;  1JM1 A;  1GL2 C;  1N73 B;  4DZO A;  2KZI A;  1L0N E;  4EDF A;  1KQS O;  1KB9 I;  1NTZ K;  2BMR A;  1JTH A;  3TGU G;  1KFN A;  2Q3I A;  3FX0 A;  1N8R Q;  1KB9 E;  3CCL P;  1RF1 B;  3PJS K;  1N86 A;  1K9M Q;  1QX8 A;  2YNY A;  4RO0 A;  1ZME C;  1FZC B;  1BE3 E;  2HFE D;  2JJL A;  3HE5 B;  2LXB A;  3M91 A;  3G71 P;  3CI9 A;  4HB1 A;  2KSE A;  3H6P A;  1CW5 A;  2W90 A;  5CCH A;  2Z5H A;  5APQ A;  3L4F A;  2YMY A;  1JY3 O;  1OIP A;  2KIK A;  4PD4 H;  2K9Y A;  3ABV C;  2YKP A;  3H1L J;  5CCH C;  1GW4 A;  2E4P A;  4QMA A;  4QUR A;  4H13 D;  1YHQ P;  2A45 G;  1VDF A;  3Q3D A;  1HVV A;  3H1H E;  3I55 P;  1VQP P;  2HPC A;  4L74 A;  5KLI B;  4BWN A;  3L71 D;  1IK7 A;  1NTM D;  3I5C A;  2E43 A;  5CBO A;  1L0L D;  1H0T A;  1LTJ A;  2ZVN B;  1EXI A;  2W8Z A;  1NTM K;  2GM4 A;  3L70 G;  2WVR A;  2QJK C;  1L0N K;  1EC5 A;  1KV4 A;  4UB6 H;  4DOJ A;  1Q90 C;  3M0D A;  3A0H E;  2WWW A;  3RK3 C;  1VQN P;  1KQF B;  1VM9 A;  2E5T A;  4K35 A;  3KQG A;  3WUT A;  2RH0 A;  1BDC A;  3AEB C;  1BE3 D;  4MN4 C;  1GK4 A;  1MV8 A;  2IBZ I;  2ITA A;  1N7L A;  2I1K A;  3WUU A;  3WUV A;  1Q86 Q;  3VMH D;  3GW6 A;  5GTH E;  1SQV J;  2P7J A;  2IBZ E;  2PRR A;  3L75 D;  2KI7 B;  5CCG A;  3P8C E;  2WT7 A;  2IYO A;  4H0L D;  1DH3 A;  1KN7 A;  3G4S P;  5KJ7 A;  4WY4 D;  3H1H D;  5K5G B;  3GL2 A;  1YIT P;  3KDP B;  4I7Z B;  3H1L E;  1PPJ E;  2CKF A;  3AEG C;  4RKU J;  1EZV G;  4M3L A;  1M8O B;  2WQY C;  3H1I G;  1XTG B;  2R3S A;  2C9N Y;  5E79 E;  2GBX A;  1R5S A;  1G1J A;  4GDO A;  1JMM A;  3PH0 A;  1XTC C;  2HR3 A;  1Y8A A;  3CC4 P;  1LNQ A;  1U7J A;  1VQ4 P;  5L8R J;  1G8K B;  4HM4 A;  2CPS A;  4WWI A;  5GTI E;  4PV1 C;  3USS A;  1SQB D;  2FYU J;  2R32 A;  1KFM A;  1NAY A;  3EWK A;  1DEE G;  5AEW A;  5CJ4 A;  2HML A;  1SQX J;  2NPS B;  3CX5 E;  3CWB G;  1NU1 J;  5KTB A;  3A0B E;  1SQV E;  1IFJ A;  1NTK G;  1FDM A;  1EDI A;  1PPJ D;  2FFD C;  1USE A;  1QL1 A;  2E5Y A;  2M3B A;  3HTK B;  1JY2 O;  5APY A;  1IFD A;  3NTN A;  2WSE H;  1SQP J;  2PP6 A;  3NMD A;  3M9B A;  4H13 C;  1P84 I;  2KNC B;  3E1R A;  3SWK A;  4C46 A;  4U3F G;  1S72 P;  2XR8 A;  1LWU A;  2KOG A;  4OGQ B;  5AW5 B;  3VCA A;  2DE6 D;  1S4X A;  1P84 E;  3T97 B;  3D6Z A;  3II6 A;  2HMO A;  2A06 D;  2B87 B;  2WIT A;  2JKV A;  3B4S A;  4YXD C;  2B88 A;  4O9B A;  3EQ2 A;  1KYO D;  1NDO A;  1BSH A;  5APU A;  1VQL P;  1SQQ G;  1T3U A;  2OAR A;  1BCC G;  3IF4 A;  4OVN F;  3FOU A;  2C9L Y;  1YYC A;  4UB8 E;  3H32 B;  2AXC A;  3B5N B;  4EOT A;  1NTZ G;  2OYH B;  3GHG A;  1EXJ A;  4BRY A;  5HL4 A;  2FYU E;  5B5E H;  4L73 A;  4OH8 B;  3ZDM A;  3GHG C;  1N7S D;  3AE9 C;  1SQX E;  4HKZ H;  2FYZ A;  1URQ D;  1NU1 E;  2AXT H;  4IOI H;  2FYN C;  4H0L C;  4AYC A;  2M3E A;  3BCC J;  4JQ0 D;  4WY4 C;  2Q1K A;  4NBC D;  3V2N A;  1ZN5 A;  2NVE A;  1ZLL A;  5CXM A;  2GUV A;  4HM3 A;  4EYY Q;  1SQP E;  1UIX A;  1GW3 A;  1L4A D;  2M8R A;  5KKZ C;  1HUC A;  1H89 A; 
#chains in the Genus database with same CATH homology
 1WQL A;  1VF5 C;  4TT3 H;  1EG9 A;  3VMG D;  3AZC A;  2WSF J;  2G8Y A;  1NYK A;  2HMJ A;  1RFS A;  1FQT A;  1G8J B;  3RK3 E;  3GZY A;  3D70 A;  3O6Q A;  3AEA C;  3FGA D;  2H89 C;  2QSI A;  3GCE A;  3AE5 C;  3EQQ A;  3VCP A;  2B1X A;  4H13 B;  2B24 A;  3SFD C;  2QPZ A;  3GTS A;  1NGM B;  4HM2 A;  1GMJ A;  4IL6 X;  2BEQ D;  3AE2 C;  2E74 C;  3S9O A;  1KQG B;  3AE7 C;  1O7G A;  1U57 A;  2WPV B;  3L70 E;  2ZYL A;  4NBB D;  1NTM E;  1OW7 A;  1K04 A;  1YQ4 C;  1JM1 A;  3H1J E;  3H1K E;  4AIV A;  1L0N E;  3C8V A;  4NB9 D;  2BMR A;  2E75 C;  4I7Z C;  1KB9 E;  3Q2Y A;  2E75 B;  3BCC E;  4HM7 A;  2JZA A;  2D2C C;  2ZT9 B;  4HJL A;  1TU3 F;  1ZME C;  2J5U A;  2D2C B;  1BE3 E;  1R8E A;  4QDC A;  2Q3W A;  1WMK A;  1HJ0 A;  4H44 D;  4NBF D;  3TGU E;  3AEF C;  3GF7 A;  1VCK A;  2K9Y A;  3ABV C;  2XSO A;  1FDI A;  4NBE D;  4NBG D;  2E4P A;  4QUR A;  1EZV E;  4H13 D;  1RIE A;  2JO6 A;  4OGQ D;  3Q3D A;  3AE8 C;  3H1H E;  1PL5 A;  3H1I E;  1KTM A;  3L72 E;  2IDB A;  1YQ3 C;  2E76 D;  2QIW A;  4KT0 J;  4HM8 A;  1IK7 A;  4P1C H;  1VF5 B;  3C0D A;  5M1B A;  1EXI A;  3GB4 A;  2NVF A;  1DD4 A;  4HM5 A;  4PD4 E;  2I7F A;  2QJK C;  2YMK A;  1KIL E;  1Q90 C;  3L73 E;  4NB8 D;  1KQF B;  1VM9 A;  1DIP A;  2YFL A;  2HMN A;  4P1B H;  2OQQ A;  2ZT9 D;  3AEE C;  3AEB C;  4Y28 J;  4R4M A;  2XRX A;  3GTE A;  3CWB E;  3L71 E;  3R4Y A;  2E74 B;  3VMH D;  2QJP C;  1OW6 A;  1HF9 A;  1ZRT E;  3H25 A;  1OW8 A;  1L0L E;  2GBW A;  2IBZ E;  2NUK A;  1NTK E;  5KLV E;  3D89 A;  2E4Q A;  4PV1 D;  4H0L D;  3GKE A;  2NWF A;  1JB0 J;  4HM1 A;  4EMJ B;  3GL2 A;  4QUQ A;  4I7Z B;  3H1L E;  2G3A A;  3D6Y A;  1PPJ E;  2CKF A;  3AEG C;  2V7Q J;  4QDF A;  4RKU J;  4NBH D;  3VMI D;  2H88 C;  1PIX A;  2WQY C;  1OMI A;  1VF5 D;  3EN1 A;  2GBX A;  4QCK A;  3Q1M A;  4GDO A;  3L75 E;  4QUP A;  2WSE J;  3GL0 A;  3AE3 C;  1AJY A;  5L8R J;  1G8K B;  1BCC E;  4HM4 A;  3N0Q A;  4YTP C;  4PV1 C;  1UUV A;  3RL0 g;  1PV3 A;  3GF3 A;  2JP3 A;  4AAY B;  1UUW A;  3EWK A;  5AEW A;  3LW5 J;  2BEZ F;  3Q5P A;  2E74 D;  3D71 A;  1ZOY C;  4HM6 A;  2HML A;  1FDO A;  2JO1 A;  1ULJ A;  3CX5 E;  1RQU A;  2P10 A;  2HMK A;  1SQV E;  2DE5 D;  4H44 C;  2YFI A;  2E75 D;  4R4L A;  2BMO A;  3GLM A;  4H44 B;  4XFJ A;  1O7H A;  4NBA D;  1KMI Z;  3AED C;  1S1C X;  2D2C D;  4H13 C;  4OGQ C;  1Y9B A;  1ZP0 C;  1SQB E;  2FBW C;  3G9R A;  2XR8 A;  2NZ2 A;  2YFJ A;  4OGQ B;  3VCA A;  3AEC C;  2E76 C;  2DE6 D;  2NUM A;  1P84 E;  3T97 B;  3D6Z A;  3IAO A;  3Q5S A;  2HMO A;  3GZX A;  2E76 B;  4YXD C;  3GOB A;  4Z1M H;  3Q5R A;  1NDO A;  4HKV A;  2YIU C;  2YVJ B;  5AEU A;  1MKM A;  2WSC J;  3AE6 C;  3L74 E;  4U3F E;  1O7N A;  1RQV A;  3FOU A;  1O7M A;  2BMQ A;  2HMM A;  1NYH A;  3AE1 C;  2QJY C;  1DD3 A;  4QDF B;  1EXJ A;  2ZT9 C;  5HL4 A;  2FYU E;  4HM0 A;  1VL2 A;  3AE4 C;  2A06 E;  2BCC E;  3AE9 C;  1SQQ E;  1SQX E;  2NVG A;  1Q90 D;  4QDD A;  1O7P A;  1ULI A;  1NU1 E;  1PP9 E;  1KYO E;  1K05 A;  2FYN C;  5BOK A;  2XSH A;  4H0L C;  1KOR A;  1NTZ E;  2FXP A;  4PV1 B;  4H0L B;  3IN6 A;  3B71 A;  4NBC D;  4U7J A;  2DE7 D;  3CXH E;  1SJG A;  1O7W A;  2NVE A;  3DQY A;  5CXM A;  3GMA A;  2MKV A;  4HM3 A;  1SQP E;  1UIX A;  5KLI C;  2O01 J;  5KKZ C;  1S5L X;  3SFE C;  4NBD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...