2E74D

Crystal structure of the cytochrome b6f complex from m.laminosus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 30
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e74D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e74D02
2BMQA 3GZYA 4QUQA 1UUVA 2NVEA 2ZT9D 4H13C 2YFLA 1NTKE 4HM7A 4HM6A 3BCCE 3VMID 4HM5A 3AZCA 4QURA 4H44D 2GBXA 1NU1E 1RFSA 4QUPA 3EN1A 3VMHD 1ULJA 4HM3A 2JZAA 1PP9E 3H1LE 4I7ZC 1NTZE 4QDFB 2E74D 4OGQC 4HM8A 1EZVE 4PD4E 1VF5D 3N0QA 3H1IE 4EMJB 4H0LD 3GZXA 2D2CC 3H1JE 3L70E 3FOUA 1VF5C 2HMJA 1UUWA 2E4QA 5KKZC 4AIVA 4PV1C 2XR8A 3GTEA 1G8KB 4QDDA 4PV1D 3L74E 4HM2A 1O7PA 1SJGA 2QJPC 1P84E 3DQYA 3GKEA 2YIUC 1SQBE 2XSOA 3C0DA 2YVJB 2QJYC 1SQPE 1NYKA 4U3FE 2E75D 1L0LE 1BCCE 3GCEA 2JO6A 1NDOA 3EQQA 4NBGD 4NB8D 1RIEA 2E75C 4NBDD 3VCPA 2ZYLA 3H1HE 2DE7D 4NBHD 2DE5D 2NWFA 1L0NE 5HL4A 3GTSA 1ZRTE 2XRXA 4H13D 1O7GA 4NBBD 2HMOA 2I7FA 5AEWA 1SQQE 4NBCD 3GB4A 2YMKA 1SQXE 3GOBA 1FQTA 4QDCA 4NB9D 2QPZA 3L73E 1JM1A 2A06E 1O7NA 2E4PA 2B1XA 3H1KE 4OGQD 2NUKA 2NVGA 2HMLA 4HM1A 5KLIC 4H0LC 4HKVA 1O7WA 2NUMA 2ZT9C 3L71E 1WQLA 4HM4A 4QDFA 1BE3E 2YFJA 3CXHE 3L72E 4H44C 4NBFD 4NBED 3D89A 4HM0A 5BOKA 3TGUE 1SQVE 2FYUE 2E74C 2E76C 2NVFA 1Q90C 5CXMA 3VMGD 3CX5E 1ULIA 2E76D 3VCAA 2D2CD 2IBZE 2BMOA 2Q3WA 2QJKC 2YFIA 2XSHA 5AEUA 1O7HA 1VCKA 2HMNA 1PPJE 2BCCE 3CWBE 3GL2A 3L75E 4P1CH 4HJLA 1EG9A 2DE6D 1NTME 4AAYB 2CKFA 1KB9E 1O7MA 2B24A 2BMRA 2FYNC 4QCKA 5KLVE 2HMMA 2GBWA 1VM9A 4NBAD 3GL0A 1G8JB 1KYOE 4P1BH 2HMKA
chains in the Genus database with same CATH superfamily
1VQ9P 4C46A 2K9JB 2W6AA 3H6PA 2FFDB 3AE4C 2WZ7A 3PP5A 4KT0J 1PP9E 2KS1B 1BDDA 3V2NA 4ZKPA 4HJGH 4WB4A 2IYPA 1PL5A 1D7MA 4HM2A 5L8RJ 4BRYA 1N86A 4WWIA 1CI6A 2C0WA 1S3JA 2M0BA 2P58A 1BCCD 3L36A 5BU5A 2AEMA 4NPFX 3IAOA 4EOTA 1PFIA 4OVNF 1Q86Q 1KILE 1MFZA 1JM1A 3ITKA 1PGQA 1NAFA 3CPWO 1HVVA 3KXDA 1SQPD 2HR3A 2BCCJ 3M9QA 1KYOH 2IFNA 1YJ9P 2ZYAA 3G9RA 1H0TA 3S4RA 1JY2P 2XSHA 4LC1A 1SQVK 3RL0C 2HG5D 2JP3A 3P7KA 3AEDC 2WTYA 2R32A 3HE5B 4DJGA 1DEBA 1PGPA 4UB8H 1VM9A 5APTA 3CXHH 3FWLA 2ZT9D 4I2LC 1LTJC 4EYYQ 4HM5A 2E76B 1NU1E 2P1JA 4HM3A 4L76A 5CBNA 5E79E 1LGHB 1X8YA 1GMJA 2W27A 2B9BA 5AW0B 3L70E 1EQ7A 1JTHA 1VF5C 2HMJA 1N7SD 2B89A 3FGAD 1IFJA 5CJ4A 3WMM0 2YVJB 3CL3D 1SQPE 1OMIA 1S72P 3H25A 3VCPA 2DE7D 4YXWH 3BASA 3KDPB 2H89C 1ZR2A 3A3YB 1O7GA 1EZVD 3PJSK 3LIDA 1ZRTD 4NB9D 3FX0A 2NUKA 2OYHC 3L71E 2WQYC 2QRXA 2WSEJ 3B8EB 1L0LD 4NBFD 1FAVA 1LJ2A 1OWAA 5CCGD 4PD4H 1OFCX 4TLFA 5AVZB 3VP9A 5CXMA 2I1KA 1NU1D 2HPCB 4I7ZB 2BCCE 1QEXA 3L75E 3Q1MA 5DJTB 2FY8A 5GTHH 1KD1Q 1NGMB 2FYNC 3AE6C 4H13B 3MTUE 1Q7YQ 4I1LA 3R4YA 5CBOA 1NTZG 5AW8B 2KNCB 1Q81Q 3II6A 1ZV8A 1VQLP 1YYCA 4GT1A 3I56P 3VMYA 4QURA 3RK3E 2GBXA 3NXSA 2JZAA 4I7ZC 3USSA 4HM8A 1N7SA 3GHGA 3V2PA 5KKZC 4UB8E 3B5NA 2POHA 2A45H 1VQOP 4OGQB 1L0NK 1NTKK 3JC22 2OYIA 1NAYA 1NU1J 1HTLC 5B66H 1T3JA 3WUVA 1KQSO 3L72G 5KJ7C 1G1JA 1L0NE 1M1JA 3H1KG 3Q5SA 1ZMEC 1SVFA 3OJAB 1SQQE 3CWBD 1LWUB 1RF1C 4XE5B 3IN6A 2QVAA 5KLIC 5BU8B 2KIKA 5AVVB 1M8OB 2KS1A 2CPBA 2O1KA 1RF0A 5KAIH 1ZW0A 1ZN5A 3CCEP 2KXPB 3CWBG 1JO5A 1R5SA 1Q90C 3HE4B 1GU4A 1OVUA 2Z5IA 1JUNA 1KB9I 1W5CE 3RL0D 1AV1A 2BCCG 2ZVOB 4BXLA 3B5ND 2HLOA 3M0DC 1JY3N 2Y0EA 3GL0A 5AVYB 4Y28J 1NH4A 3WUUA 1Q82Q 5CCHA 3BCCE 3TYYA 1H89A 4H44D 1SQQJ 1IFPA 4WY4B 3AEEC 1QLED 3C9IA 1VF5D 1JB0J 2N1TA 4WVZA 3H1JE 1EDLA 1UUWA 4PV1C 1KQGB 3PHLA 1FZBA 4WY4C 5AW6B 1VQ6P 1OX3A 3DQYA 3L70G 2XSOA 4NBGD 1LTJB 2WITA 2OYOA 1URQC 3BRVB 3BCCJ 2NWFA 1LWUC 3E1IA 5HL4A 2XRXA 1JMBA 1FDOA 1SQPG 2ZFCA 4NBBD 1T3UA 4EIJA 4NBCD 1OW7A 2ZXXA 3MGNA 1HH0A 2Q6QA 2XZRA 4PJ0E 1GZLA 3HUSA 3L74D 2YO3A 2FXOA 1JEKA 1NTKJ 1ZXGA 1BCCG 2CPSA 3CX5D 1USDA 1SQVE 2FYUE 1QL2A 3VTPC 4H44B 1MKMA 2FYUD 2ZXEB 2ZAEB 1KTMA 5M1BA 1PP9D 5APYA 3CCQP 1S9KD 1HF9A 5B5EE 2R5BA 2M3EA 2NPSB 3V4WA 1S5LX 2YMYA 2OTKE 2FYUG 3B5NB 3P32A 3Q2YA 2ZYGA 3G71P 2NVEA 4B86A 3BCCG 5TISE 2H8PD 4JF7A 4JYBA 2FYZA 1NTZE 3PRJA 1PPJG 2NZ2A 1GL2B 1VL2A 2G3AA 1T8ZA 2WSSH 2P67A 5C39A 1JCDA 3D6ZA 4JQ0D 4EI2A 1YHQP 5TJHA 2OTLP 2YKPA 1BDCA 3ZDMA 4U3FE 2YKQA 1FZAA 1K8AQ 3L35A 1FOSF 3RBXA 3HD7C 1USEA 2HYNA 1ZRTE 2BEQD 1N2DC 1OW6A 1M7LA 2KB7P 3H1ID 1KILB 3CCSP 3H1HJ 3CC4P 4QDCA 4HB1A 4WBAA 5KTBA 3RK2C 3H1KE 4OGQD 5CJ0A 2KZIA 1ZLLA 1U57A 1SQQG 3Q5PA 2ZT9C 1R5LA 2E74B 4N6JA 4RO0A 1RY3A 3MHVA 1BGYD 4DCKA 4D6TJ 1RF0C 1NO4A 2N1TD 2I8DA 1SFCD 1IFNA 1ULIA 2QJKC 2Q3WA 2YXRB 1KB9D 4AUWA 1KILD 2OTJP 2MJZA 2I1JA 5CHXA 1N73C 3CMEP 2W90A 2QEXP 3SWKA 1DD4A 2KZJA 1NU1G 1G2CB 2AEJA 1LTGC 1IFIA 3NMDA 3CCUP 3H1LG 3A0HH 1BE3J 3OW2O 2XKMA 2FXPA 1GK6A 5AVSB 3CC2P 2LKMA 1EZVE 1FZFA 3L72J 3H1IE 1MZ9A 3O6QB 2DW3A 2XR8A 2LR2A 4GIFA 1P84E 3GKEA 3H1JG 1UIXA 2E75C 2KK7A 3H1HE 5H2FE 3H1IG 3GTSA 3HD7D 1NOHA 2HMOA 3MUDA 1FQTA 1AQ5A 1G1IA 1L4AD 4AQRD 4W7YA 4XA4A 1L4AA 2IPPA 1G2CA 1LTAC 1O7WA 2NPSD 1J1DB 3L74J 4UB6E 1NWQA 3H1HG 5AVUB 2ZVNB 2YFJA 2L5GB 3M91A 1W2BO 4M3LA 2E74C 4GOEA 2Q9IA 3MIWA 1Q2NA 1KFMA 2E76D 4YXDC 1SFCC 2YFIA 2Y0CA 2IYOA 2PAJA 2P10A 3VMZA 1EXJA 1IFDA 5CCHD 4NPDA 2JJLA 5AVXB 1MFTA 3G4SP 2GBWA 3VYIA 3EFFK 4GOFA 3EFGA 1W2EA 2O1JA 2PGDA 5APWA 4O9BA 3NFQA 4OWFA 2J5UA 2NRGA 4N78E 3EN1A 2BCCD 4PV1B 3JCUE 4N78D 1YBKA 3GZXA 3HTKB 1BSNA 1CW5A 3GTEA 1G8KB 5AW7B 4QDDA 4K3AA 1Y8AA 2M5AA 2QJPC 1NTKG 5E79H 1L0NG 2N9YB 1OW8A 2W8ZA 4MN4C 5EFWB 5B5EH 1LT9C 1PV3A 2GA1A 2WWWA 4XFJA 3M9BA 1NTMG 1FZEA 2W83C 3HUSC 4PD4I 1K04A 2NPSA 2NVGA 5AW9B 4H0LC 3M9HA 3PLNA 2A06D 2NUMA 3BVHA 3AECC 1MV8A 5AVTB 2KLUA 1GL2A 3L71D 3RL0g 3RL0B 3TF5A 1JNMA 4IOIH 3CCMP 1S9KE 1GL2C 3B4SA 4GODA 4HYTB 2K88A 3EQ2A 4WY4A 2BMRA 4UB6H 3GG2A 3L71G 4P1BH 2O01H 4QUQA 1JY3P 2KOGA 1SQBK 1P84H 4LLHA 2QJKB 1SQVJ 2W6BA 1RFSA 1FZCC 3H1LE 1DX7A 2E74D 2N9BA 2P7JA 5H2FH 3D70A 1YQ4C 1ZOYC 2YNYA 4JYCA 2E4QA 4H0LB 5CCGA 1SP4A 1PZQA 1SQXK 4W7ZA 2L91A 4TT3H 3VOPA 1S1CX 3NTNA 1QVGO 2JWAA 1SQBE 2WT7A 1NYHA 1GTWA 2E75D 2WPSA 3T97A 2A45G 4RJTA 1SQBD 3BCCD 2FFDA 5DJUB 2K9JA 1KMIZ 1M1JB 2I7FA 2C0XA 3Q3DA 3CCJP 3V5BA 3AE1C 5APXA 3A0HE 2B1XA 4OH8B 4I6MC 5KLVD 1L0LJ 3V2QA 2FXMA 1Y47A 1VF5B 1RE3A 3KHUA 1YIJP 2E76C 3AE7C 2H7HA 3HD7B 1NTZD 2OGUA 1DEEG 3PH0A 2H43A 1FU1A 1WMKA 4ZMDA 2GUVA 2R5DA 3JCUH 5CMZA 1RQVA 3CXHI 2E5TA 1OIPA 2H88C 2LXBA 2K3RA 2UWJE 1RHZB 2JWDA 2KYVA 1UUVA 2ITAA 2WSFJ 2Y9ZA 1KQLA 2YFLA 4HM7A 1SQQK 2WMMA 4YTPC 1YI2P 2AXTH 1ULJA 1IO4A 4OGQC 1KV4A 4RKUJ 2N1TB 3O8ZA 4AIVA 4C7NB 3H1JD 4GKGA 1R8EA 3V6IA 4CPGA 1KZUB 4DT0A 5KKZB 1BCCE 2KP8A 4NBDD 1M1JC 1HGZA 3C8VA 2IX7C 4YPCA 2B87A 4D6TG 1SQXG 1KFNA 3RBZA 3GOBA 2XDJA 3A0BE 1A02J 3N7NA 3V4QA 3ABVC 1O7NA 3A0BH 1M1KQ 2HMLA 4HM1A 3MZWB 1RQUA 3C1LA 4HM4A 1JY3O 4BWNA 4NBED 3TGUG 1HJBA 2YKOA 1LT9A 4D6TD 2B88A 4L73A 1J2JB 2KUBA 3LW5J 3E1RA 1NTZK 2A06G 3RGUA 3M06A 4HJLA 4KHXA 1GD2E 2R3SA 1NTMK 1FBMA 2HMMA 1PGOA 4GDOA 1BGYE 1YITP 5KJ7D 3W67A 4H13C 1SQVG 1HJ0A 2Q7CA 2FKWB 3TNUB 1NTKD 1SQXJ 4ASWA 4QDFB 4PD4E 5AVQB 1FS0E 2Q1KA 3F5HA 4PV1D 1O7PA 4HKZH 3WU2E 3E7KA 1AJYA 1N8RQ 2Y9YA 1Q90D 1M90Q 4N3YB 1FOSE 3RK3C 1IK7A 4A7PA 1VDFA 5AEWA 3GLMA 2V7QH 4RESB 2WSCJ 4DOJA 1P84D 3CCRP 3BRTB 4JBZA 1WQLA 5KJ7A 3CXHE 2HPCA 5AW3B 4ZKUA 1H88A 5BOKA 1KYOI 1EC5A 2IBZG 1FE6A 3AE2C 3VCAA 1S5LH 1AVOA 5AEUA 5APVA 1X22A 1VQPP 1NKZB 3CI9A 1RH5B 1NU1K 4U3FJ 3P8MC 4WY4D 2DE6D 3B5NC 1L4AB 1HBWA 4AAYB 2CKFA 1KB9E 4KJMA 1BSHA 5AW5B 2WT7B 3K5BA 4NBAD 4IFMA 1KYOE 3LIEA 1S2EA 3GMAA 2FYNB 1QVFO 2NPSC 1FC2C 3SFEC 3GW6A 4NPEA 3H1LD 2K9YA 2C9LY 5KAIE 4DZOA 1EDIA 1VQ7P 3HE4A 1MUUA 3QWOC 2JKVA 2R3CA 3Q5RA 3TDKA 1VQNP 3L70J 3SWFA 1VQKP 3VP8A 1FZCB 3L4FA 1T2KD 3OAKA 2YXQB 1BE3G 3F89A 2QA4P 4JPZB 3EQQA 3W68A 1LWUA 1P84I 3L73G 3CCVP 3TK1A 1NVOA 1NHLA 3H1HD 1BCCJ 1JM0A 5AW2B 2WPQA 2E43A 3A5TA 2CK3H 2QPZA 3L37A 1EZVI 1SQQD 2V7QJ 3SFDC 2Q3IA 1GW4A 3FWNA 4R4MA 2AXTE 2PFXA 1DIPA 1SQPJ 5CCGC 2QE7H 3L71J 1LTTC 1N7SB 3GHGB 2IBZE 3AEAC 3RK3D 1L0NJ 2FYUK 3H32A 3TSIA 1Y9BA 2XNDH 1U7JA 1O7MA 2AXCA 2RN0A 2ZT9B 2YO2A 1UIIA 2KLVA 1AA0A 3MD0A 2HMKA 5KLVK 3P8CE 1SQVD 3B71A 3EWKA 2Q3EA 1K05A 1HUCA 3G3ZA 4IFFA 3AZCA 1FJKA 1IFMA 3RK2D 1X79B 4EMJB 1SQXD 1U7MA 1N7SC 3GHGC 2QM7A 1GL2D 4Y99C 1YJNP 3A7OA 1PP9J 1SJGA 5AVWB 1RF1A 5KAFH 2QJYC 2JO6A 2IFMA 2Y0DA 2KSEA 1LNQA 1RF1B 1QL1A 2YIUB 3MUDC 2IBZD 4L75A 4AYCA 3CCLP 2M3BA 3MP7B 1OXZA 5BVZA 1URQB 2QM8A 5KLVJ 1RE3C 3FXDA 1ZP0C 4R4LA 2ZYDA 3WUTA 3AEFC 1KB9H 3CD6P 2V4HA 3SWYA 3CX5H 4HM0A 3P8CD 2NVFA 2M8RA 1S4XA 1X0TA 3S9OA 3VMGD 2O3JA 3CX5E 2QSIA 3OA7A 2JR8A 5GTIH 2RMZA 1JTHB 3I5CA 1NTME 1PPJD 1WT6A 5KLVE 1H8AA 2WVRA 1OZHA 3AE9C 3AEGC 2WPRA 1S5LE 3V2RA 4ASVA 3GZYA 1M57D 1LTJA 1NTKE 2K37A 3VN0A 1IZNB 1EDKA 2IZ1A 4QUPA 3R2PA 4Z1MH 1LTIC 2MKVA 1JY2O 2FFDC 1EZVG 4W80A 1VQ4P 3H1JJ 3HUSB 2OYIB 3FOUA 2AEFA 1HGVA 1PGJA 3L74E 1FJPA 2OQQA 3C0DA 1A02F 1NYKA 2QIWA 3T97B 1FDIA 1JMMA 4NBHD 2Q5UA 1N7LA 5APQA 3U1AA 4IL6X 2G8YA 3L74G 3L73E 1NTMD 1DH3A 1OVVA 5APSA 1J1EC 2PP6A 3IFMA 1PIXA 2QG4A 1CI6B 3LW5H 3CXHD 3L72D 2ZJSE 2OYIC 1SQBG 3HE5A 2LXCB 3L72E 2VRSA 3H1KJ 1FZGA 4K35A 1J1DC 5KLIB 2D2CD 3FXEA 3IR9A 1TU3F 1VCKA 1X9VA 2HMNA 1URQD 5AVRB 1EG9A 1E5WA 3CX5I 3GF3A 3TNUA 1BGYG 2WSCH 3AEBC 3BATA 4L74A 3IF4A 3AE3C 2IDBA 1VQMP 2BMQA 1L0LK 2E42A 1GW3A 2KNCA 2E75B 1KILA 2O01J 4IL6H 1NTMJ 1LP1A 2OYHA 2JO1A 4H0LD 3M0AA 1YTZI 2WPVB 1SQPK 2WSEH 3H1KD 1JOCA 4BRYB 4C7NA 2J58A 3D71A 1AVYA 1AFOA 4U3FG 1SQBJ 2GM4A 1L0LE 1SS1A 2R44A 3GCEA 1L0ND 2XV5A 3KZIE 2DE5D 4H13D 4PD4D 1LTSC 4PJ0H 2KI7B 2RKLA 1JY2N 3HTKA 1ZR4A 3L75J 5AW1B 4HKVA 1N73A 4QDFA 1IC2A 1N73B 1LP1B 2OYHB 2BEZF 1L2PA 1NTZJ 2N1TC 3KYQA 2BMOA 4D6TE 1QX8A 3GL2A 4P1CH 1EDJA 2IBZI 3U1CA 5KAFE 2J59M 1KILC 1GK4A 2PRRA 2IZ0A 2B24A 1KQFB 1K9MQ 1SFCA 4QCKA 1LT1A 3L75G 1YQ3C 2XU6A 1XTCC 1NJIQ 5K5GB 2D2CB 4HM6A 1LT9B 3VMID 2WSFH 3VMHD 3H1LJ 1XTGB 3L75D 1T6AA 2FBWC 1VPCA 2QJPB 3A2AA 3GF7A 2D2CC 1YJWP 1K73Q 3L70D 3VMXA 1KYOD 1IK9A 3S1KA 2BASA 2W6JH 3G6EP 1NDOA 1L0LG 3N4XA 3AE5C 3RK2B 1KC8Q 1GU5A 1GDTA 3CWBJ 5B66E 2OARA 3GB4A 2YMKA 2RH0A 3O6QA 1CSBA 3H1IJ 3CMAP 2A06E 2E4PA 3WU2H 1IJDB 3SSUA 5GTIE 4ZNCA 2Z4EA 4H44C 1YTZT 1T2KC 1Z56A 2P2UA 1FZCA 1BGYJ 1QGKB 1FDMA 4EDFA 2KSJA 2XNXA 3M0DA 1O7HA 2GUSA 1PPJE 3CWBE 1SLQA 1CZQA 1JCCA 4IL6E 1OVRA 3L73J 1DD3A 5CCHC 1M56D 2M5AB 2O01N 4IFDK 3JSVC 1G8JB 3AE8C 2HODB 2QJYB 1H0TB 2B87B 3KPEA 1KORA 3HRNA 3I55P 1VQ5P 3KQGA 1EXIA 3TGUJ 2SPZA 4Y99B 3H32B 1VQ8P 1NKNA 5GTHE 3N0QA 3CLQA 1RE4A 3VMAA 4U3FD 2YIUC 3KZIH 2JDIH 4HH2A 4NB8D 1RIEA 2ZYLA 1LTBC 1HWTC 4U7JA 4LGDE 3QH9A 3L73D 2K1AA 1E79H 1SQXE 1L4AC 1WRGA 2E5YA 5TISH 3PTZA 2JEEA 5APUA 1BE3D 2HODA 1AQTA 2A45I 3D6YA 2HFED 1BE3E 3TGUD 1SFCB 4QMAA 3D89A 3RK3B 3TGUE 3U59A 2FYUJ 1RE4C 5AW4B 1KN7A 5KLVG 1URQA 2C9NY 3CC7P 4C7RA 1PP9G 1J1EB 2Z5HA 3HD7A 3UIAA
chains in the Genus database with same CATH topology
3GZYA 3Q2YA 1UUVA 2NVEA 2WSFJ 2YFLA 1NTKE 4HM7A 3AE4C 4YTPC 4QUPA 4KT0J 1ULJA 1PP9E 1NTZE 4Z1MH 4OGQC 2MKVA 2NZ2A 4RKUJ 1VL2A 3FOUA 2G3AA 1PL5A 4AIVA 3D6ZA 3L74E 4HM2A 5L8RJ 1R8EA 2OQQA 3C0DA 1NYKA 4U3FE 1BCCE 2QIWA 3T97B 4NBDD 1FDIA 3C8VA 4NBHD 3IAOA 1ZRTE 2BEQD 1OW6A 3GOBA 4IL6X 1KILE 2G8YA 4QDCA 3L73E 1JM1A 3ABVC 1O7NA 3H1KE 1PIXA 4OGQD 2HMLA 4HM1A 1U57A 3Q5PA 2ZT9C 2E74B 1RQUA 4HM4A 3L72E 4NBED 3G9RA 1ULIA 3LW5J 2D2CD 2QJKC 2Q3WA 2XSHA 1TU3F 1VCKA 2HMNA 4HJLA 1EG9A 3GF3A 3AEBC 2JP3A 3AEDC 3AE3C 2HMMA 1DD4A 2IDBA 1VM9A 4GDOA 2BMQA 2ZT9D 4H13C 2FXPA 2E75B 1HJ0A 4HM5A 2O01J 2E76B 1NU1E 4HM3A 2JO1A 4QDFB 1EZVE 4PD4E 1GMJA 3H1IE 4H0LD 3L70E 1VF5C 2HMJA 2WPVB 3FGAD 2XR8A 4PV1D 1O7PA 3D71A 1P84E 1AJYA 3GKEA 1Q90D 2YVJB 1SQPE 1L0LE 1UIXA 3GCEA 1OMIA 2E75C 3H25A 3VCPA 3H1HE 2DE7D 1IK7A 2DE5D 2H89C 3GTSA 4H13D 1O7GA 2HMOA 5AEWA 3GLMA 1FQTA 4NB9D 2WSCJ 2NUKA 4HKVA 1O7WA 3L71E 2WQYC 1WQLA 4QDFA 2WSEJ 2YFJA 3CXHE 4NBFD 5BOKA 2E74C 3AE2C 5CXMA 3VCAA 2BEZF 2E76D 4YXDC 2BMOA 2YFIA 5AEUA 4I7ZB 2BCCE 3GL2A 3L75E 4P1CH 2P10A 3Q1MA 2DE6D 1EXJA 4AAYB 2CKFA 1KB9E 2B24A 1NGMB 1KQFB 2FYNC 4QCKA 3AE6C 4H13B 2GBWA 1YQ3C 4NBAD 1KYOE 3R4YA 3GMAA 2D2CB 2J5UA 3SFEC 4HM6A 3VMID 2K9YA 4QURA 3RK3E 2GBXA 3EN1A 3VMHD 4PV1B 2JZAA 4I7ZC 4HM8A 2FBWC 3GF7A 3GZXA 2D2CC 3Q5RA 5KKZC 3GTEA 1G8KB 4QDDA 2QJPC 4OGQB 1OW8A 1NDOA 3EQQA 3AE5C 1PV3A 1L0NE 3Q5SA 1ZMEC 1SQQE 4XFJA 3GB4A 2YMKA 2QPZA 3O6QA 3IN6A 1K04A 2A06E 2E4PA 2V7QJ 3SFDC 2NVGA 5KLIC 4H0LC 4R4MA 2NUMA 3AECC 4H44C 1DIPA 3RL0g 1Q90C 2IBZE 3AEAC 1O7HA 1PPJE 3CWBE 1Y9BA 1O7MA 2BMRA 1DD3A 2ZT9B 3GL0A 1G8JB 4P1BH 2HMKA 3AE8C 4Y28J 4QUQA 3B71A 3EWKA 1KORA 3BCCE 1K05A 3AZCA 1EXIA 4H44D 1RFSA 3AEEC 3H1LE 2E74D 1VF5D 1JB0J 3N0QA 4EMJB 3D70A 1YQ4C 1ZOYC 3H1JE 1UUWA 2E4QA 4H0LB 4PV1C 1KQGB 4TT3H 1SJGA 1S1CX 3DQYA 2YIUC 1SQBE 2XSOA 2QJYC 1NYHA 2E75D 2JO6A 4NBGD 4NB8D 1RIEA 2ZYLA 4U7JA 2NWFA 5HL4A 2XRXA 1FDOA 1KMIZ 4NBBD 2I7FA 4NBCD 3Q3DA 1SQXE 1OW7A 3AE1C 2B1XA 1ZP0C 4R4LA 3D6YA 1VF5B 3AEFC 1BE3E 3D89A 4HM0A 3TGUE 1SQVE 2FYUE 2E76C 2NVFA 3S9OA 3VMGD 3CX5E 4H44B 2QSIA 3AE7C 1MKMA 1KTMA 5M1BA 1HF9A 1NTME 1WMKA 5KLVE 1S5LX 1RQVA 3AE9C 2H88C 3AEGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMQ A;  3GZY A;  4QUQ A;  1UUV A;  2NVE A;  2ZT9 D;  4H13 C;  2YFL A;  1NTK E;  4HM7 A;  4HM6 A;  3BCC E;  3VMI D;  4HM5 A;  3AZC A;  4QUR A;  4H44 D;  2GBX A;  1NU1 E;  1RFS A;  4QUP A;  3EN1 A;  3VMH D;  1ULJ A;  4HM3 A;  2JZA A;  1PP9 E;  3H1L E;  4I7Z C;  1NTZ E;  4QDF B;  2E74 D;  4OGQ C;  4HM8 A;  1EZV E;  4PD4 E;  1VF5 D;  3N0Q A;  3H1I E;  4EMJ B;  4H0L D;  3GZX A;  2D2C C;  3H1J E;  3L70 E;  3FOU A;  1VF5 C;  2HMJ A;  1UUW A;  2E4Q A;  5KKZ C;  4AIV A;  4PV1 C;  2XR8 A;  3GTE A;  1G8K B;  4QDD A;  4PV1 D;  3L74 E;  4HM2 A;  1O7P A;  1SJG A;  2QJP C;  1P84 E;  3DQY A;  3GKE A;  2YIU C;  1SQB E;  2XSO A;  3C0D A;  2YVJ B;  2QJY C;  1SQP E;  1NYK A;  4U3F E;  2E75 D;  1L0L E;  1BCC E;  3GCE A;  2JO6 A;  1NDO A;  3EQQ A;  4NBG D;  4NB8 D;  1RIE A;  2E75 C;  4NBD D;  3VCP A;  2ZYL A;  3H1H E;  2DE7 D;  4NBH D;  2DE5 D;  2NWF A;  1L0N E;  5HL4 A;  3GTS A;  1ZRT E;  2XRX A;  4H13 D;  1O7G A;  4NBB D;  2HMO A;  2I7F A;  5AEW A;  1SQQ E;  4NBC D;  3GB4 A;  2YMK A;  1SQX E;  3GOB A;  1FQT A;  4QDC A;  4NB9 D;  2QPZ A;  3L73 E;  1JM1 A;  2A06 E;  1O7N A;  2E4P A;  2B1X A;  3H1K E;  4OGQ D;  2NUK A;  2NVG A;  2HML A;  4HM1 A;  5KLI C;  4H0L C;  4HKV A;  1O7W A;  2NUM A;  2ZT9 C;  3L71 E;  1WQL A;  4HM4 A;  4QDF A;  1BE3 E;  2YFJ A;  3CXH E;  3L72 E;  4H44 C;  4NBF D;  4NBE D;  3D89 A;  4HM0 A;  5BOK A;  3TGU E;  1SQV E;  2FYU E;  2E74 C;  2E76 C;  2NVF A;  1Q90 C;  5CXM A;  3VMG D;  3CX5 E;  1ULI A;  2E76 D;  3VCA A;  2D2C D;  2IBZ E;  2BMO A;  2Q3W A;  2QJK C;  2YFI A;  2XSH A;  5AEU A;  1O7H A;  1VCK A;  2HMN A;  1PPJ E;  2BCC E;  3CWB E;  3GL2 A;  3L75 E;  4P1C H;  4HJL A;  1EG9 A;  2DE6 D;  1NTM E;  4AAY B;  2CKF A;  1KB9 E;  1O7M A;  2B24 A;  2BMR A;  2FYN C;  4QCK A;  5KLV E;  2HMM A;  2GBW A;  1VM9 A;  4NBA D;  3GL0 A;  1G8J B;  1KYO E;  4P1B H;  2HMK A; 
#chains in the Genus database with same CATH topology
 1VQ9 P;  4C46 A;  2K9J B;  2W6A A;  3H6P A;  2FFD B;  3AE4 C;  2WZ7 A;  3PP5 A;  4KT0 J;  1PP9 E;  2KS1 B;  1BDD A;  3V2N A;  4ZKP A;  4HJG H;  4WB4 A;  2IYP A;  1PL5 A;  1D7M A;  4HM2 A;  5L8R J;  4BRY A;  1N86 A;  4WWI A;  1CI6 A;  2C0W A;  1S3J A;  2M0B A;  2P58 A;  1BCC D;  3L36 A;  5BU5 A;  2AEM A;  4NPF X;  3IAO A;  4EOT A;  1PFI A;  4OVN F;  1Q86 Q;  1KIL E;  1MFZ A;  1JM1 A;  3ITK A;  1PGQ A;  1NAF A;  3CPW O;  1HVV A;  3KXD A;  1SQP D;  2HR3 A;  2BCC J;  3M9Q A;  1KYO H;  2IFN A;  1YJ9 P;  2ZYA A;  3G9R A;  1H0T A;  3S4R A;  1JY2 P;  2XSH A;  4LC1 A;  1SQV K;  3RL0 C;  2HG5 D;  2JP3 A;  3P7K A;  3AED C;  2WTY A;  2R32 A;  3HE5 B;  4DJG A;  1DEB A;  1PGP A;  4UB8 H;  1VM9 A;  5APT A;  3CXH H;  3FWL A;  2ZT9 D;  4I2L C;  1LTJ C;  4EYY Q;  4HM5 A;  2E76 B;  1NU1 E;  2P1J A;  4HM3 A;  4L76 A;  5CBN A;  5E79 E;  1LGH B;  1X8Y A;  1GMJ A;  2W27 A;  2B9B A;  5AW0 B;  3L70 E;  1EQ7 A;  1JTH A;  1VF5 C;  2HMJ A;  1N7S D;  2B89 A;  3FGA D;  1IFJ A;  5CJ4 A;  3WMM 0;  2YVJ B;  3CL3 D;  1SQP E;  1OMI A;  1S72 P;  3H25 A;  3VCP A;  2DE7 D;  4YXW H;  3BAS A;  3KDP B;  2H89 C;  1ZR2 A;  3A3Y B;  1O7G A;  1EZV D;  3PJS K;  3LID A;  1ZRT D;  4NB9 D;  3FX0 A;  2NUK A;  2OYH C;  3L71 E;  2WQY C;  2QRX A;  2WSE J;  3B8E B;  1L0L D;  4NBF D;  1FAV A;  1LJ2 A;  1OWA A;  5CCG D;  4PD4 H;  1OFC X;  4TLF A;  5AVZ B;  3VP9 A;  5CXM A;  2I1K A;  1NU1 D;  2HPC B;  4I7Z B;  2BCC E;  1QEX A;  3L75 E;  3Q1M A;  5DJT B;  2FY8 A;  5GTH H;  1KD1 Q;  1NGM B;  2FYN C;  3AE6 C;  4H13 B;  3MTU E;  1Q7Y Q;  4I1L A;  3R4Y A;  5CBO A;  1NTZ G;  5AW8 B;  2KNC B;  1Q81 Q;  3II6 A;  1ZV8 A;  1VQL P;  1YYC A;  4GT1 A;  3I56 P;  3VMY A;  4QUR A;  3RK3 E;  2GBX A;  3NXS A;  2JZA A;  4I7Z C;  3USS A;  4HM8 A;  1N7S A;  3GHG A;  3V2P A;  5KKZ C;  4UB8 E;  3B5N A;  2POH A;  2A45 H;  1VQO P;  4OGQ B;  1L0N K;  1NTK K;  3JC2 2;  2OYI A;  1NAY A;  1NU1 J;  1HTL C;  5B66 H;  1T3J A;  3WUV A;  1KQS O;  3L72 G;  5KJ7 C;  1G1J A;  1L0N E;  1M1J A;  3H1K G;  3Q5S A;  1ZME C;  1SVF A;  3OJA B;  1SQQ E;  3CWB D;  1LWU B;  1RF1 C;  4XE5 B;  3IN6 A;  2QVA A;  5KLI C;  5BU8 B;  2KIK A;  5AVV B;  1M8O B;  2KS1 A;  2CPB A;  2O1K A;  1RF0 A;  5KAI H;  1ZW0 A;  1ZN5 A;  3CCE P;  2KXP B;  3CWB G;  1JO5 A;  1R5S A;  1Q90 C;  3HE4 B;  1GU4 A;  1OVU A;  2Z5I A;  1JUN A;  1KB9 I;  1W5C E;  3RL0 D;  1AV1 A;  2BCC G;  2ZVO B;  4BXL A;  3B5N D;  2HLO A;  3M0D C;  1JY3 N;  2Y0E A;  3GL0 A;  5AVY B;  4Y28 J;  1NH4 A;  3WUU A;  1Q82 Q;  5CCH A;  3BCC E;  3TYY A;  1H89 A;  4H44 D;  1SQQ J;  1IFP A;  4WY4 B;  3AEE C;  1QLE D;  3C9I A;  1VF5 D;  1JB0 J;  2N1T A;  4WVZ A;  3H1J E;  1EDL A;  1UUW A;  4PV1 C;  1KQG B;  3PHL A;  1FZB A;  4WY4 C;  5AW6 B;  1VQ6 P;  1OX3 A;  3DQY A;  3L70 G;  2XSO A;  4NBG D;  1LTJ B;  2WIT A;  2OYO A;  1URQ C;  3BRV B;  3BCC J;  2NWF A;  1LWU C;  3E1I A;  5HL4 A;  2XRX A;  1JMB A;  1FDO A;  1SQP G;  2ZFC A;  4NBB D;  1T3U A;  4EIJ A;  4NBC D;  1OW7 A;  2ZXX A;  3MGN A;  1HH0 A;  2Q6Q A;  2XZR A;  4PJ0 E;  1GZL A;  3HUS A;  3L74 D;  2YO3 A;  2FXO A;  1JEK A;  1NTK J;  1ZXG A;  1BCC G;  2CPS A;  3CX5 D;  1USD A;  1SQV E;  2FYU E;  1QL2 A;  3VTP C;  4H44 B;  1MKM A;  2FYU D;  2ZXE B;  2ZAE B;  1KTM A;  5M1B A;  1PP9 D;  5APY A;  3CCQ P;  1S9K D;  1HF9 A;  5B5E E;  2R5B A;  2M3E A;  2NPS B;  3V4W A;  1S5L X;  2YMY A;  2OTK E;  2FYU G;  3B5N B;  3P32 A;  3Q2Y A;  2ZYG A;  3G71 P;  2NVE A;  4B86 A;  3BCC G;  5TIS E;  2H8P D;  4JF7 A;  4JYB A;  2FYZ A;  1NTZ E;  3PRJ A;  1PPJ G;  2NZ2 A;  1GL2 B;  1VL2 A;  2G3A A;  1T8Z A;  2WSS H;  2P67 A;  5C39 A;  1JCD A;  3D6Z A;  4JQ0 D;  4EI2 A;  1YHQ P;  5TJH A;  2OTL P;  2YKP A;  1BDC A;  3ZDM A;  4U3F E;  2YKQ A;  1FZA A;  1K8A Q;  3L35 A;  1FOS F;  3RBX A;  3HD7 C;  1USE A;  2HYN A;  1ZRT E;  2BEQ D;  1N2D C;  1OW6 A;  1M7L A;  2KB7 P;  3H1I D;  1KIL B;  3CCS P;  3H1H J;  3CC4 P;  4QDC A;  4HB1 A;  4WBA A;  5KTB A;  3RK2 C;  3H1K E;  4OGQ D;  5CJ0 A;  2KZI A;  1ZLL A;  1U57 A;  1SQQ G;  3Q5P A;  2ZT9 C;  1R5L A;  2E74 B;  4N6J A;  4RO0 A;  1RY3 A;  3MHV A;  1BGY D;  4DCK A;  4D6T J;  1RF0 C;  1NO4 A;  2N1T D;  2I8D A;  1SFC D;  1IFN A;  1ULI A;  2QJK C;  2Q3W A;  2YXR B;  1KB9 D;  4AUW A;  1KIL D;  2OTJ P;  2MJZ A;  2I1J A;  5CHX A;  1N73 C;  3CME P;  2W90 A;  2QEX P;  3SWK A;  1DD4 A;  2KZJ A;  1NU1 G;  1G2C B;  2AEJ A;  1LTG C;  1IFI A;  3NMD A;  3CCU P;  3H1L G;  3A0H H;  1BE3 J;  3OW2 O;  2XKM A;  2FXP A;  1GK6 A;  5AVS B;  3CC2 P;  2LKM A;  1EZV E;  1FZF A;  3L72 J;  3H1I E;  1MZ9 A;  3O6Q B;  2DW3 A;  2XR8 A;  2LR2 A;  4GIF A;  1P84 E;  3GKE A;  3H1J G;  1UIX A;  2E75 C;  2KK7 A;  3H1H E;  5H2F E;  3H1I G;  3GTS A;  3HD7 D;  1NOH A;  2HMO A;  3MUD A;  1FQT A;  1AQ5 A;  1G1I A;  1L4A D;  4AQR D;  4W7Y A;  4XA4 A;  1L4A A;  2IPP A;  1G2C A;  1LTA C;  1O7W A;  2NPS D;  1J1D B;  3L74 J;  4UB6 E;  1NWQ A;  3H1H G;  5AVU B;  2ZVN B;  2YFJ A;  2L5G B;  3M91 A;  1W2B O;  4M3L A;  2E74 C;  4GOE A;  2Q9I A;  3MIW A;  1Q2N A;  1KFM A;  2E76 D;  4YXD C;  1SFC C;  2YFI A;  2Y0C A;  2IYO A;  2PAJ A;  2P10 A;  3VMZ A;  1EXJ A;  1IFD A;  5CCH D;  4NPD A;  2JJL A;  5AVX B;  1MFT A;  3G4S P;  2GBW A;  3VYI A;  3EFF K;  4GOF A;  3EFG A;  1W2E A;  2O1J A;  2PGD A;  5APW A;  4O9B A;  3NFQ A;  4OWF A;  2J5U A;  2NRG A;  4N78 E;  3EN1 A;  2BCC D;  4PV1 B;  3JCU E;  4N78 D;  1YBK A;  3GZX A;  3HTK B;  1BSN A;  1CW5 A;  3GTE A;  1G8K B;  5AW7 B;  4QDD A;  4K3A A;  1Y8A A;  2M5A A;  2QJP C;  1NTK G;  5E79 H;  1L0N G;  2N9Y B;  1OW8 A;  2W8Z A;  4MN4 C;  5EFW B;  5B5E H;  1LT9 C;  1PV3 A;  2GA1 A;  2WWW A;  4XFJ A;  3M9B A;  1NTM G;  1FZE A;  2W83 C;  3HUS C;  4PD4 I;  1K04 A;  2NPS A;  2NVG A;  5AW9 B;  4H0L C;  3M9H A;  3PLN A;  2A06 D;  2NUM A;  3BVH A;  3AEC C;  1MV8 A;  5AVT B;  2KLU A;  1GL2 A;  3L71 D;  3RL0 g;  3RL0 B;  3TF5 A;  1JNM A;  4IOI H;  3CCM P;  1S9K E;  1GL2 C;  3B4S A;  4GOD A;  4HYT B;  2K88 A;  3EQ2 A;  4WY4 A;  2BMR A;  4UB6 H;  3GG2 A;  3L71 G;  4P1B H;  2O01 H;  4QUQ A;  1JY3 P;  2KOG A;  1SQB K;  1P84 H;  4LLH A;  2QJK B;  1SQV J;  2W6B A;  1RFS A;  1FZC C;  3H1L E;  1DX7 A;  2E74 D;  2N9B A;  2P7J A;  5H2F H;  3D70 A;  1YQ4 C;  1ZOY C;  2YNY A;  4JYC A;  2E4Q A;  4H0L B;  5CCG A;  1SP4 A;  1PZQ A;  1SQX K;  4W7Z A;  2L91 A;  4TT3 H;  3VOP A;  1S1C X;  3NTN A;  1QVG O;  2JWA A;  1SQB E;  2WT7 A;  1NYH A;  1GTW A;  2E75 D;  2WPS A;  3T97 A;  2A45 G;  4RJT A;  1SQB D;  3BCC D;  2FFD A;  5DJU B;  2K9J A;  1KMI Z;  1M1J B;  2I7F A;  2C0X A;  3Q3D A;  3CCJ P;  3V5B A;  3AE1 C;  5APX A;  3A0H E;  2B1X A;  4OH8 B;  4I6M C;  5KLV D;  1L0L J;  3V2Q A;  2FXM A;  1Y47 A;  1VF5 B;  1RE3 A;  3KHU A;  1YIJ P;  2E76 C;  3AE7 C;  2H7H A;  3HD7 B;  1NTZ D;  2OGU A;  1DEE G;  3PH0 A;  2H43 A;  1FU1 A;  1WMK A;  4ZMD A;  2GUV A;  2R5D A;  3JCU H;  5CMZ A;  1RQV A;  3CXH I;  2E5T A;  1OIP A;  2H88 C;  2LXB A;  2K3R A;  2UWJ E;  1RHZ B;  2JWD A;  2KYV A;  1UUV A;  2ITA A;  2WSF J;  2Y9Z A;  1KQL A;  2YFL A;  4HM7 A;  1SQQ K;  2WMM A;  4YTP C;  1YI2 P;  2AXT H;  1ULJ A;  1IO4 A;  4OGQ C;  1KV4 A;  4RKU J;  2N1T B;  3O8Z A;  4AIV A;  4C7N B;  3H1J D;  4GKG A;  1R8E A;  3V6I A;  4CPG A;  1KZU B;  4DT0 A;  5KKZ B;  1BCC E;  2KP8 A;  4NBD D;  1M1J C;  1HGZ A;  3C8V A;  2IX7 C;  4YPC A;  2B87 A;  4D6T G;  1SQX G;  1KFN A;  3RBZ A;  3GOB A;  2XDJ A;  3A0B E;  1A02 J;  3N7N A;  3V4Q A;  3ABV C;  1O7N A;  3A0B H;  1M1K Q;  2HML A;  4HM1 A;  3MZW B;  1RQU A;  3C1L A;  4HM4 A;  1JY3 O;  4BWN A;  4NBE D;  3TGU G;  1HJB A;  2YKO A;  1LT9 A;  4D6T D;  2B88 A;  4L73 A;  1J2J B;  2KUB A;  3LW5 J;  3E1R A;  1NTZ K;  2A06 G;  3RGU A;  3M06 A;  4HJL A;  4KHX A;  1GD2 E;  2R3S A;  1NTM K;  1FBM A;  2HMM A;  1PGO A;  4GDO A;  1BGY E;  1YIT P;  5KJ7 D;  3W67 A;  4H13 C;  1SQV G;  1HJ0 A;  2Q7C A;  2FKW B;  3TNU B;  1NTK D;  1SQX J;  4ASW A;  4QDF B;  4PD4 E;  5AVQ B;  1FS0 E;  2Q1K A;  3F5H A;  4PV1 D;  1O7P A;  4HKZ H;  3WU2 E;  3E7K A;  1AJY A;  1N8R Q;  2Y9Y A;  1Q90 D;  1M90 Q;  4N3Y B;  1FOS E;  3RK3 C;  1IK7 A;  4A7P A;  1VDF A;  5AEW A;  3GLM A;  2V7Q H;  4RES B;  2WSC J;  4DOJ A;  1P84 D;  3CCR P;  3BRT B;  4JBZ A;  1WQL A;  5KJ7 A;  3CXH E;  2HPC A;  5AW3 B;  4ZKU A;  1H88 A;  5BOK A;  1KYO I;  1EC5 A;  2IBZ G;  1FE6 A;  3AE2 C;  3VCA A;  1S5L H;  1AVO A;  5AEU A;  5APV A;  1X22 A;  1VQP P;  1NKZ B;  3CI9 A;  1RH5 B;  1NU1 K;  4U3F J;  3P8M C;  4WY4 D;  2DE6 D;  3B5N C;  1L4A B;  1HBW A;  4AAY B;  2CKF A;  1KB9 E;  4KJM A;  1BSH A;  5AW5 B;  2WT7 B;  3K5B A;  4NBA D;  4IFM A;  1KYO E;  3LIE A;  1S2E A;  3GMA A;  2FYN B;  1QVF O;  2NPS C;  1FC2 C;  3SFE C;  3GW6 A;  4NPE A;  3H1L D;  2K9Y A;  2C9L Y;  5KAI E;  4DZO A;  1EDI A;  1VQ7 P;  3HE4 A;  1MUU A;  3QWO C;  2JKV A;  2R3C A;  3Q5R A;  3TDK A;  1VQN P;  3L70 J;  3SWF A;  1VQK P;  3VP8 A;  1FZC B;  3L4F A;  1T2K D;  3OAK A;  2YXQ B;  1BE3 G;  3F89 A;  2QA4 P;  4JPZ B;  3EQQ A;  3W68 A;  1LWU A;  1P84 I;  3L73 G;  3CCV P;  3TK1 A;  1NVO A;  1NHL A;  3H1H D;  1BCC J;  1JM0 A;  5AW2 B;  2WPQ A;  2E43 A;  3A5T A;  2CK3 H;  2QPZ A;  3L37 A;  1EZV I;  1SQQ D;  2V7Q J;  3SFD C;  2Q3I A;  1GW4 A;  3FWN A;  4R4M A;  2AXT E;  2PFX A;  1DIP A;  1SQP J;  5CCG C;  2QE7 H;  3L71 J;  1LTT C;  1N7S B;  3GHG B;  2IBZ E;  3AEA C;  3RK3 D;  1L0N J;  2FYU K;  3H32 A;  3TSI A;  1Y9B A;  2XND H;  1U7J A;  1O7M A;  2AXC A;  2RN0 A;  2ZT9 B;  2YO2 A;  1UII A;  2KLV A;  1AA0 A;  3MD0 A;  2HMK A;  5KLV K;  3P8C E;  1SQV D;  3B71 A;  3EWK A;  2Q3E A;  1K05 A;  1HUC A;  3G3Z A;  4IFF A;  3AZC A;  1FJK A;  1IFM A;  3RK2 D;  1X79 B;  4EMJ B;  1SQX D;  1U7M A;  1N7S C;  3GHG C;  2QM7 A;  1GL2 D;  4Y99 C;  1YJN P;  3A7O A;  1PP9 J;  1SJG A;  5AVW B;  1RF1 A;  5KAF H;  2QJY C;  2JO6 A;  2IFM A;  2Y0D A;  2KSE A;  1LNQ A;  1RF1 B;  1QL1 A;  2YIU B;  3MUD C;  2IBZ D;  4L75 A;  4AYC A;  3CCL P;  2M3B A;  3MP7 B;  1OXZ A;  5BVZ A;  1URQ B;  2QM8 A;  5KLV J;  1RE3 C;  3FXD A;  1ZP0 C;  4R4L A;  2ZYD A;  3WUT A;  3AEF C;  1KB9 H;  3CD6 P;  2V4H A;  3SWY A;  3CX5 H;  4HM0 A;  3P8C D;  2NVF A;  2M8R A;  1S4X A;  1X0T A;  3S9O A;  3VMG D;  2O3J A;  3CX5 E;  2QSI A;  3OA7 A;  2JR8 A;  5GTI H;  2RMZ A;  1JTH B;  3I5C A;  1NTM E;  1PPJ D;  1WT6 A;  5KLV E;  1H8A A;  2WVR A;  1OZH A;  3AE9 C;  3AEG C;  2WPR A;  1S5L E;  3V2R A;  4ASV A;  3GZY A;  1M57 D;  1LTJ A;  1NTK E;  2K37 A;  3VN0 A;  1IZN B;  1EDK A;  2IZ1 A;  4QUP A;  3R2P A;  4Z1M H;  1LTI C;  2MKV A;  1JY2 O;  2FFD C;  1EZV G;  4W80 A;  1VQ4 P;  3H1J J;  3HUS B;  2OYI B;  3FOU A;  2AEF A;  1HGV A;  1PGJ A;  3L74 E;  1FJP A;  2OQQ A;  3C0D A;  1A02 F;  1NYK A;  2QIW A;  3T97 B;  1FDI A;  1JMM A;  4NBH D;  2Q5U A;  1N7L A;  5APQ A;  3U1A A;  4IL6 X;  2G8Y A;  3L74 G;  3L73 E;  1NTM D;  1DH3 A;  1OVV A;  5APS A;  1J1E C;  2PP6 A;  3IFM A;  1PIX A;  2QG4 A;  1CI6 B;  3LW5 H;  3CXH D;  3L72 D;  2ZJS E;  2OYI C;  1SQB G;  3HE5 A;  2LXC B;  3L72 E;  2VRS A;  3H1K J;  1FZG A;  4K35 A;  1J1D C;  5KLI B;  2D2C D;  3FXE A;  3IR9 A;  1TU3 F;  1VCK A;  1X9V A;  2HMN A;  1URQ D;  5AVR B;  1EG9 A;  1E5W A;  3CX5 I;  3GF3 A;  3TNU A;  1BGY G;  2WSC H;  3AEB C;  3BAT A;  4L74 A;  3IF4 A;  3AE3 C;  2IDB A;  1VQM P;  2BMQ A;  1L0L K;  2E42 A;  1GW3 A;  2KNC A;  2E75 B;  1KIL A;  2O01 J;  4IL6 H;  1NTM J;  1LP1 A;  2OYH A;  2JO1 A;  4H0L D;  3M0A A;  1YTZ I;  2WPV B;  1SQP K;  2WSE H;  3H1K D;  1JOC A;  4BRY B;  4C7N A;  2J58 A;  3D71 A;  1AVY A;  1AFO A;  4U3F G;  1SQB J;  2GM4 A;  1L0L E;  1SS1 A;  2R44 A;  3GCE A;  1L0N D;  2XV5 A;  3KZI E;  2DE5 D;  4H13 D;  4PD4 D;  1LTS C;  4PJ0 H;  2KI7 B;  2RKL A;  1JY2 N;  3HTK A;  1ZR4 A;  3L75 J;  5AW1 B;  4HKV A;  1N73 A;  4QDF A;  1IC2 A;  1N73 B;  1LP1 B;  2OYH B;  2BEZ F;  1L2P A;  1NTZ J;  2N1T C;  3KYQ A;  2BMO A;  4D6T E;  1QX8 A;  3GL2 A;  4P1C H;  1EDJ A;  2IBZ I;  3U1C A;  5KAF E;  2J59 M;  1KIL C;  1GK4 A;  2PRR A;  2IZ0 A;  2B24 A;  1KQF B;  1K9M Q;  1SFC A;  4QCK A;  1LT1 A;  3L75 G;  1YQ3 C;  2XU6 A;  1XTC C;  1NJI Q;  5K5G B;  2D2C B;  4HM6 A;  1LT9 B;  3VMI D;  2WSF H;  3VMH D;  3H1L J;  1XTG B;  3L75 D;  1T6A A;  2FBW C;  1VPC A;  2QJP B;  3A2A A;  3GF7 A;  2D2C C;  1YJW P;  1K73 Q;  3L70 D;  3VMX A;  1KYO D;  1IK9 A;  3S1K A;  2BAS A;  2W6J H;  3G6E P;  1NDO A;  1L0L G;  3N4X A;  3AE5 C;  3RK2 B;  1KC8 Q;  1GU5 A;  1GDT A;  3CWB J;  5B66 E;  2OAR A;  3GB4 A;  2YMK A;  2RH0 A;  3O6Q A;  1CSB A;  3H1I J;  3CMA P;  2A06 E;  2E4P A;  3WU2 H;  1IJD B;  3SSU A;  5GTI E;  4ZNC A;  2Z4E A;  4H44 C;  1YTZ T;  1T2K C;  1Z56 A;  2P2U A;  1FZC A;  1BGY J;  1QGK B;  1FDM A;  4EDF A;  2KSJ A;  2XNX A;  3M0D A;  1O7H A;  2GUS A;  1PPJ E;  3CWB E;  1SLQ A;  1CZQ A;  1JCC A;  4IL6 E;  1OVR A;  3L73 J;  1DD3 A;  5CCH C;  1M56 D;  2M5A B;  2O01 N;  4IFD K;  3JSV C;  1G8J B;  3AE8 C;  2HOD B;  2QJY B;  1H0T B;  2B87 B;  3KPE A;  1KOR A;  3HRN A;  3I55 P;  1VQ5 P;  3KQG A;  1EXI A;  3TGU J;  2SPZ A;  4Y99 B;  3H32 B;  1VQ8 P;  1NKN A;  5GTH E;  3N0Q A;  3CLQ A;  1RE4 A;  3VMA A;  4U3F D;  2YIU C;  3KZI H;  2JDI H;  4HH2 A;  4NB8 D;  1RIE A;  2ZYL A;  1LTB C;  1HWT C;  4U7J A;  4LGD E;  3QH9 A;  3L73 D;  2K1A A;  1E79 H;  1SQX E;  1L4A C;  1WRG A;  2E5Y A;  5TIS H;  3PTZ A;  2JEE A;  5APU A;  1BE3 D;  2HOD A;  1AQT A;  2A45 I;  3D6Y A;  2HFE D;  1BE3 E;  3TGU D;  1SFC B;  4QMA A;  3D89 A;  3RK3 B;  3TGU E;  3U59 A;  2FYU J;  1RE4 C;  5AW4 B;  1KN7 A;  5KLV G;  1URQ A;  2C9N Y;  3CC7 P;  4C7R A;  1PP9 G;  1J1E B;  2Z5H A;  3HD7 A;  3UIA A; 
#chains in the Genus database with same CATH homology
 3GZY A;  3Q2Y A;  1UUV A;  2NVE A;  2WSF J;  2YFL A;  1NTK E;  4HM7 A;  3AE4 C;  4YTP C;  4QUP A;  4KT0 J;  1ULJ A;  1PP9 E;  1NTZ E;  4Z1M H;  4OGQ C;  2MKV A;  2NZ2 A;  4RKU J;  1VL2 A;  3FOU A;  2G3A A;  1PL5 A;  4AIV A;  3D6Z A;  3L74 E;  4HM2 A;  5L8R J;  1R8E A;  2OQQ A;  3C0D A;  1NYK A;  4U3F E;  1BCC E;  2QIW A;  3T97 B;  4NBD D;  1FDI A;  3C8V A;  4NBH D;  3IAO A;  1ZRT E;  2BEQ D;  1OW6 A;  3GOB A;  4IL6 X;  1KIL E;  2G8Y A;  4QDC A;  3L73 E;  1JM1 A;  3ABV C;  1O7N A;  3H1K E;  1PIX A;  4OGQ D;  2HML A;  4HM1 A;  1U57 A;  3Q5P A;  2ZT9 C;  2E74 B;  1RQU A;  4HM4 A;  3L72 E;  4NBE D;  3G9R A;  1ULI A;  3LW5 J;  2D2C D;  2QJK C;  2Q3W A;  2XSH A;  1TU3 F;  1VCK A;  2HMN A;  4HJL A;  1EG9 A;  3GF3 A;  3AEB C;  2JP3 A;  3AED C;  3AE3 C;  2HMM A;  1DD4 A;  2IDB A;  1VM9 A;  4GDO A;  2BMQ A;  2ZT9 D;  4H13 C;  2FXP A;  2E75 B;  1HJ0 A;  4HM5 A;  2O01 J;  2E76 B;  1NU1 E;  4HM3 A;  2JO1 A;  4QDF B;  1EZV E;  4PD4 E;  1GMJ A;  3H1I E;  4H0L D;  3L70 E;  1VF5 C;  2HMJ A;  2WPV B;  3FGA D;  2XR8 A;  4PV1 D;  1O7P A;  3D71 A;  1P84 E;  1AJY A;  3GKE A;  1Q90 D;  2YVJ B;  1SQP E;  1L0L E;  1UIX A;  3GCE A;  1OMI A;  2E75 C;  3H25 A;  3VCP A;  3H1H E;  2DE7 D;  1IK7 A;  2DE5 D;  2H89 C;  3GTS A;  4H13 D;  1O7G A;  2HMO A;  5AEW A;  3GLM A;  1FQT A;  4NB9 D;  2WSC J;  2NUK A;  4HKV A;  1O7W A;  3L71 E;  2WQY C;  1WQL A;  4QDF A;  2WSE J;  2YFJ A;  3CXH E;  4NBF D;  5BOK A;  2E74 C;  3AE2 C;  5CXM A;  3VCA A;  2BEZ F;  2E76 D;  4YXD C;  2BMO A;  2YFI A;  5AEU A;  4I7Z B;  2BCC E;  3GL2 A;  3L75 E;  4P1C H;  2P10 A;  3Q1M A;  2DE6 D;  1EXJ A;  4AAY B;  2CKF A;  1KB9 E;  2B24 A;  1NGM B;  1KQF B;  2FYN C;  4QCK A;  3AE6 C;  4H13 B;  2GBW A;  1YQ3 C;  4NBA D;  1KYO E;  3R4Y A;  3GMA A;  2D2C B;  2J5U A;  3SFE C;  4HM6 A;  3VMI D;  2K9Y A;  4QUR A;  3RK3 E;  2GBX A;  3EN1 A;  3VMH D;  4PV1 B;  2JZA A;  4I7Z C;  4HM8 A;  2FBW C;  3GF7 A;  3GZX A;  2D2C C;  3Q5R A;  5KKZ C;  3GTE A;  1G8K B;  4QDD A;  2QJP C;  4OGQ B;  1OW8 A;  1NDO A;  3EQQ A;  3AE5 C;  1PV3 A;  1L0N E;  3Q5S A;  1ZME C;  1SQQ E;  4XFJ A;  3GB4 A;  2YMK A;  2QPZ A;  3O6Q A;  3IN6 A;  1K04 A;  2A06 E;  2E4P A;  2V7Q J;  3SFD C;  2NVG A;  5KLI C;  4H0L C;  4R4M A;  2NUM A;  3AEC C;  4H44 C;  1DIP A;  3RL0 g;  1Q90 C;  2IBZ E;  3AEA C;  1O7H A;  1PPJ E;  3CWB E;  1Y9B A;  1O7M A;  2BMR A;  1DD3 A;  2ZT9 B;  3GL0 A;  1G8J B;  4P1B H;  2HMK A;  3AE8 C;  4Y28 J;  4QUQ A;  3B71 A;  3EWK A;  1KOR A;  3BCC E;  1K05 A;  3AZC A;  1EXI A;  4H44 D;  1RFS A;  3AEE C;  3H1L E;  2E74 D;  1VF5 D;  1JB0 J;  3N0Q A;  4EMJ B;  3D70 A;  1YQ4 C;  1ZOY C;  3H1J E;  1UUW A;  2E4Q A;  4H0L B;  4PV1 C;  1KQG B;  4TT3 H;  1SJG A;  1S1C X;  3DQY A;  2YIU C;  1SQB E;  2XSO A;  2QJY C;  1NYH A;  2E75 D;  2JO6 A;  4NBG D;  4NB8 D;  1RIE A;  2ZYL A;  4U7J A;  2NWF A;  5HL4 A;  2XRX A;  1FDO A;  1KMI Z;  4NBB D;  2I7F A;  4NBC D;  3Q3D A;  1SQX E;  1OW7 A;  3AE1 C;  2B1X A;  1ZP0 C;  4R4L A;  3D6Y A;  1VF5 B;  3AEF C;  1BE3 E;  3D89 A;  4HM0 A;  3TGU E;  1SQV E;  2FYU E;  2E76 C;  2NVF A;  3S9O A;  3VMG D;  3CX5 E;  4H44 B;  2QSI A;  3AE7 C;  1MKM A;  1KTM A;  5M1B A;  1HF9 A;  1NTM E;  1WMK A;  5KLV E;  1S5L X;  1RQV A;  3AE9 C;  2H88 C;  3AEG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...