2E74D

Crystal structure of the cytochrome b6f complex from m.laminosus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
166
Chain Sequence
b'DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 30
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e74D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e74D02
4QURA 2IBZE 1RIEA 4I7ZC 3GZYA 1SQBE 3L71E 5AEWA 4AAYB 4HM8A 2DE7D 2YIUC 3D89A 2E75D 3C0DA 5AEUA 2NUKA 5KKZC 4NBFD 1O7MA 4HM5A 1SJGA 1ULIA 3EQQA 1NU1E 4QCKA 2CKFA 1SQVE 2BMOA 2B1XA 1ULJA 3CX5E 4HKVA 4NB9D 1PPJE 1EZVE 1O7HA 4QDFB 2D2CD 1NDOA 2E74C 4HJLA 2NWFA 1G8JB 4AIVA 1L0NE 1VF5D 2XRXA 4H0LD 2E4PA 2QJKC 4OGQC 2YFIA 3L75E 1ZRTE 2E76D 3GOBA 2FYNC 2JZAA 3GL0A 1NTKE 3H1KE 2BMQA 4NBDD 1L0LE 4PV1D 2DE5D 1WQLA 2ZYLA 4NBAD 3L70E 2JO6A 3H1JE 4NBBD 4PD4E 1SQXE 1BE3E 3L74E 1JM1A 2GBXA 1BCCE 2XR8A 3GB4A 1O7GA 2ZT9C 2YMKA 2YFLA 2B24A 4HM3A 3H1IE 3VCAA 1PP9E 4H44C 1O7WA 4QDCA 4H13D 4OGQD 2FYUE 1FQTA 1VCKA 3GKEA 2HMJA 3GCEA 3BCCE 1NTME 2E4QA 1KYOE 4NB8D 4P1CH 2XSOA 1EG9A 2YVJB 3H1LE 1O7PA 1UUWA 2Q3WA 3L72E 2YFJA 5CXMA 2E75C 3CWBE 2QPZA 4NBED 4NBCD 4QUQA 4QUPA 4HM2A 3GTSA 3VCPA 2QJPC 3H1HE 3GL2A 2NUMA 1UUVA 2E74D 4U3FE 2NVEA 3CXHE 4EMJB 4QDFA 2D2CC 4P1BH 2BMRA 3VMGD 3L73E 3VMHD 5KLIC 1VM9A 2NVGA 3EN1A 1VF5C 4HM4A 4H0LC 1KB9E 2BCCE 1NTZE 1RFSA 4NBHD 2E76C 2QJYC 4HM7A 4HM1A 2A06E 4HM0A 2HMKA 3GTEA 1SQQE 4PV1C 3VMID 3AZCA 2NVFA 2XSHA 3N0QA 4QDDA 2HMNA 2HMMA 3FOUA 5HL4A 3DQYA 2DE6D 2ZT9D 1Q90C 5BOKA 3GZXA 2GBWA 4H44D 4NBGD 3TGUE 1O7NA 1SQPE 1G8KB 5KLVE 1P84E 2I7FA 1NYKA 2HMLA 2HMOA 4HM6A 4H13C
chains in the Genus database with same CATH superfamily
3GG2A 2J5UA 2UWJE 1X79B 1BE3D 3RK3E 1SQBK 1BE3J 2IFNA 4GKGA 4MN4C 2QA4P 3AE4C 2M8RA 1L2PA 1EZVE 4RJTA 4EYYQ 3RBXA 2E4PA 2YFIA 1M57D 3KDPB 1URQB 2WT7A 4K35A 1VQOP 3TGUG 3CXHD 4NBBD 1A02F 1VQ5P 2GBXA 5APWA 2OYHA 2BCCD 2YFLA 2BCCJ 1KB9H 3TNUA 1BE3G 2WPQA 1YTZT 3A5TA 2POHA 3PRJA 3ZDMA 1ZV8A 2KI7B 2M5AB 4QUQA 4O9BA 4OGQB 1L4AD 1H0TB 2C9NY 4RKUJ 2Y9YA 2NUMA 2WSFJ 3M91A 2YIUB 3RK3D 1AVYA 3B4SA 5AW7B 3V2RA 1H89A 1KB9E 2V4HA 4OH8B 2YKPA 1KC8Q 1QLED 3B5ND 1EZVD 3L37A 3FWNA 2R5DA 2A45I 2BCCG 4GT1A 5CCGA 3JC22 4I1LA 1HJBA 1O7NA 1ZXGA 2HMLA 2CPSA 2KK7A 1N73A 2ZT9B 1UIXA 1O7MA 1YQ4C 3RL0C 1Y8AA 1EXIA 1IJDB 3IAOA 1RF1B 3QH9A 3EQQA 5M1BA 1AJYA 1URQD 4L75A 4JYCA 2FFDA 1G8JB 2WSSH 2R5BA 1VPCA 2HODB 1EZVG 1JM0A 4HYTB 2W27A 4I7ZB 2IX7C 3V4WA 4UB8H 2IBZG 3S1KA 1JM1A 1QL1A 1Y47A 1RQUA 3HUSB 1A02J 1KB9D 1O7GA 2QJYB 1FZBA 3NXSA 4OGQD 3H1LD 1S1CX 1FJPA 3H1LJ 3KPEA 4IFFA 3KQGA 1YHQP 1ZLLA 4NBED 3GHGA 1FZCA 2FXMA 3GL2A 1LTTC 1EDLA 2Q7CA 5B66H 3S9OA 2W8ZA 1U7MA 3WUTA 2KS1B 2C0XA 3H1IG 1S4XA 1VQNP 2QSIA 2R44A 3GW6A 1RQVA 2KNCA 3LIEA 1OVVA 2W90A 2ZT9D 3M0DC 1JTHA 2OYIB 1BSNA 3L71D 3H1LG 3WUUA 1FZEA 3MHVA 3L71J 1P84E 1KFNA 1NKNA 1SQBE 4TT3H 3PP5A 3LW5J 4BXLA 2DE7D 1BGYE 3CCUP 1NTZK 4HM5A 3VP8A 2IZ0A 5EFWB 1ULIA 3AEAC 2P2UA 1JY3P 1O7HA 1DH3A 4RO0A 3SFEC 3F5HA 3L75E 3RK2C 2WQYC 1Q82Q 2JZAA 1J1EB 2BMQA 3TK1A 4BRYA 4C46A 5CCHD 2JO6A 2N1TA 3H1JE 5AW6B 1N2DC 1M7LA 3L71G 3D6YA 1FC2C 3TF5A 1PP9E 2E5YA 1KILC 1W2BO 1S5LE 3O6QB 2KXPB 2YKQA 1G2CA 3MGNA 1NTME 3VMYA 3CC7P 1IFIA 4GOEA 2QPZA 4NBCD 2Q9IA 5KAFH 3GTSA 1P84D 2P58A 3C1LA 5AVXB 1SQBD 1SQBJ 2M0BA 5GTIH 3F89A 3L73E 5AVVB 2NVGA 1VF5C 4BWNA 4AYCA 1UIIA 4WB4A 1IC2A 1LTJB 2XSHA 3JCUE 5KAFE 2K9JA 3L75D 3W68A 2FKWB 3L75J 1SQPE 3TNUB 1GW3A 4HM6A 3BASA 2O01H 1LT1A 2KUBA 2NUKA 2O1JA 2KOGA 2CK3H 1PP9D 1SQBG 1PP9J 2E76B 1JCCA 3W67A 1NTMD 1LT9C 3HE5A 1T8ZA 1NTMJ 1VQ9P 5APVA 2XRXA 2I8DA 1L0LE 2PGDA 2QRXA 5AVWB 2Z5IA 3A0HH 2IPPA 3AEGC 2YO3A 3L73D 3L73J 2O1KA 4L74A 1N73B 2QG4A 4NB8D 2AXTH 4LGDE 1VL2A 3CWBE 1SQPD 3VCPA 3Q2YA 3A0HE 2K1AA 1UUVA 2ZVNB 1NOHA 4P1BH 1Y9BA 3T97B 1VQKP 2FYZA 4DJGA 2IFMA 1EXJA 3M0DA 4HM1A 1OVUA 3M9BA 1E5WA 3L73G 2AXTE 3CC2P 5BOKA 2GBWA 3HD7C 5APUA 1L0LD 4WBAA 4QURA 1L0LJ 3CC4P 3CCLP 3FX0A 3E7KA 1GU4A 3C0DA 3AEBC 3AE7C 3SWFA 1U57A 1JCDA 1FZCB 3OA7A 3BVHA 1H8AA 1K05A 2W6BA 3SFDC 2QE7H 5CCGD 4AIVA 3CWBD 2HPCB 3CWBJ 2FYNC 4EI2A 5BU8B 2WSCJ 2MKVA 3L74J 1NKZB 1OW8A 2AEFA 1KILA 2XNDH 5APYA 2FXOA 4H0LB 2O3JA 1N7SC 1FZFA 1O7WA 1CI6A 3R4YA 5DJUB 4ZKPA 3D6ZA 3MD0A 2XKMA 2XV5A 1EDKA 1NO4A 1OVRA 3H1HE 4DZOA 3AE8C 3CWBG 4PJ0H 1LP1B 2LKMA 3L74G 2J58A 1OIPA 1RFSA 5AVZB 1G1IA 4HM7A 1M1JC 2N1TB 4AQRD 5AVYB 4EDFA 4DCKA 1IO4A 2YNYA 1EZVI 3MIWA 4UB6E 1NYKA 1CZQA 1G2CB 5AEWA 2IBZI 1LTBC 1LT9A 4RESB 4ZNCA 2CKFA 1JNMA 1NTZG 2B1XA 1IFMA 4NB9D 3CX5E 1EDIA 2NWFA 3H6PA 4H0LD 1KQLA 1OW6A 2HR3A 3H1HD 3B71A 4NBDD 3H1HJ 2Q6QA 1WQLA 3P8CE 1LTIC 4R4LA 2BEQD 3A0BE 3GMAA 4PD4I 4IL6H 2H43A 3TYYA 3RL0B 5KJ7C 1WMKA 2RN0A 3IF4A 2YXRB 2HFED 4DOJA 1HGZA 2YFJA 1N86A 3RBZA 4U3FD 1QVFO 2PP6A 4U3FJ 4H13B 4U7JA 4Y99B 4IOIH 3M9HA 1GL2C 2N1TD 2H7HA 4JYBA 3HE4B 5KLIC 3H1HG 2PFXA 3AE9C 4OWFA 1YYCA 5AVQB 4PD4H 3HD7A 3HTKA 3TSIA 2IYPA 3CX5D 1NTMK 2E74B 1T3UA 3GLMA 2ZYAA 1PV3A 2WMMA 3HRNA 4NPDA 2KZJA 2ITAA 3CL3D 5DJTB 2OTJP 3P8CD 4ASVA 2JR8A 1USDA 4U3FG 2AEMA 2J59M 2WVRA 3CCVP 1NU1E 1SQVE 1L4AC 3SWYA 2NPSB 3O8ZA 3VOPA 2GM4A 4HKVA 2M3BA 2E75B 2K9YA 1FE6A 1GMJA 1SQPK 3U59A 2OYOA 5AW4B 3G6EP 1N7SA 2FBWC 1IFNA 2ZYLA 1IZNB 1EC5A 3L35A 5H2FH 2K37A 1BDDA 4HM3A 5E79H 1JB0J 1RE4C 4H13D 1MV8A 3USSA 5L8RJ 3AEFC 3GKEA 3GCEA 3OW2O 2A45H 2XSOA 1EG9A 2PAJA 5CXMA 2KP8A 1L0LK 1DEBA 3RK2B 1LWUB 3CCJP 2E74D 1URQC 4R4MA 1GD2E 1M1JA 1J1DB 1JY3N 1P84I 2AXCA 1GW4A 1SLQA 4ASWA 1NU1D 1SQVD 1NU1J 1SQVJ 2A06E 2JEEA 4HM0A 1KILB 2P10A 3I5CA 1WRGA 1Q81Q 3DQYA 2XNXA 4UB8E 1ZR4A 4A7PA 3U1CA 4IL6X 3MP7B 4HKZH 3GZYA 1PGJA 2NPSD 5KLVK 1KILE 2WPSA 2PRRA 1JEKA 2YIUC 3AE1C 3BATA 2NRGA 2E75D 1T2KD 4NBFD 2Q5UA 3CLQA 4QCKA 3RGUA 4XA4A 3N7NA 1M8OB 2BEZF 1NU1G 1SQVG 5B66E 1OXZA 3A7OA 2O01N 2W6AA 5TISH 5AW8B 4C7NA 3CMAP 1DD3A 5KJ7A 1HJ0A 4N78E 2JJLA 3GB4A 2ZT9C 3BRVB 2WPVB 3JSVC 3QWOC 2A06D 1RF1C 3RK2D 1OX3A 1O7PA 1NWQA 1GL2A 1KYOI 2WWWA 1GZLA 4GODA 2B87B 3AEDC 4L76A 3IFMA 2Q1KA 4WY4B 1R5SA 2KLUA 3SSUA 3FWLA 4CPGA 2NVEA 4EMJB 1KILD 1K04A 2RMZA 4DT0A 4NPEA 4W7YA 1AFOA 3WU2H 1PFIA 4LLHA 1CSBA 2QJYC 2XZRA 1SVFA 3B8EB 1ZP0C 1SQQE 5CCHC 4Y28J 3FOUA 2HYNA 3CCEP 1NH4A 1Q86Q 3V4QA 1G8KB 1BGYD 1KYOH 1U7JA 1BGYJ 3CMEP 1RF0C 3G9RA 1L4AA 2WT7B 2HLOA 4N78D 4H44B 1HWTC 2OYHB 1ULJA 1K9MQ 4HJLA 3I55P 2KSJA 3I56P 1L0NE 5GTIE 1IFJA 3H1JD 2WSEH 2OYIC 3H1JJ 3HTKB 2D2CB 1RE4A 5AW3B 2YMYA 1SQXE 3P32A 1BCCE 1S9KE 2XR8A 1BGYG 1JUNA 2YXQB 2FYUE 1RHZB 1KV4A 1FQTA 1SQQD 4WY4D 1SQQJ 3V6IA 1NJIQ 2E4QA 2JDIH 5AW1B 1UUWA 1DD4A 3PHLA 1GDTA 1URQA 1ZW0A 3L72E 3C8VA 1OMIA 1N7LA 3V2NA 2JWAA 3V2PA 2R32A 2WZ7A 3L75G 1J1EC 3AE6C 1KMIZ 5KKZB 3H1JG 3VMHD 3EN1A 3LIDA 4HM4A 3GF7A 5APSA 3D70A 3VP9A 2M5AA 5AW0B 1N7SB 1VDFA 1PP9G 2NVFA 3CCMP 2Z4EA 5HL4A 1L0ND 2LXBA 4K3AA 3Q3DA 2R3CA 1NTMG 1L0NJ 1SQPJ 4HJGH 1LTAC 4H44D 2FFDB 5KLVE 2I7FA 1D7MA 1YIJP 1JOCA 1SQXD 1SQXJ 1SFCC 1XTGB 1BCCD 1S9KD 2Q3IA 1FDIA 1BCCJ 2FYUD 1KN7A 3EWKA 2D2CD 1LTJC 1S5LX 3II6A 3L72D 2O01J 3L72J 2QJPB 3GOBA 2E76D 1NTKE 3H1KE 2WTYA 1YBKA 3BRTB 2IDBA 4N6JA 5APXA 2BASA 1L0NG 1RH5B 1SQPG 3GHGB 3SWKA 1RF1A 1JMMA 3PH0A 1Q90D 2YKOA 4D6TE 1NU1K 1SQVK 2MJZA 2B9BA 4PV1B 1SQXG 1KQGB 1BCCG 3CCSP 4P1CH 1QX8A 2HODA 3V2QA 1J2JB 2KB7P 3PJSK 2GA1A 5AW5B 2KNCB 1S2EA 5KLVD 1QEXA 5KLVJ 1KQSO 1N7SD 1W2EA 1Z56A 1JTHB 3L72G 2KLVA 1L0LG 2KYVA 3VMGD 3CXHI 5CCHA 4YXDC 5AW9B 1YJ9P 2HMKA 4YTPC 1VQMP 1PGPA 3G4SP 1YI2P 1X8YA 1VQLP 1OW7A 3OJAB 3N4XA 1RF0A 3GZXA 1YJNP 1NTKD 1IFPA 3H1KD 3TGUE 1KZUB 1NTKJ 2LR2A 3H1KJ 3NMDA 5KTBA 3EFGA 4BRYB 1GL2B 1X0TA 4D6TD 2N9YB 4D6TJ 1AVOA 5KLVG 1SJGA 2FXPA 3KZIH 3CXHH 2ZYDA 2HG5D 4C7RA 3MZWB 1JY2O 1PL5A 3KXDA 2OYIA 2G3AA 4JPZB 3MUDC 4W7ZA 4PJ0E 1FZAA 3UIAA 4PV1D 5B5EH 2KZIA 1FS0E 3FXDA 1FBMA 1NTKG 2K88A 3H1KG 2WSFH 1PIXA 2RKLA 2K3RA 5C39A 4QDCA 5APTA 1AQ5A 1RY3A 4D6TG 1L4AB 3EQ2A 5GTHH 1DEEG 1MKMA 5TJHA 2LXCB 1T3JA 1ZMEC 3TGUD 1AQTA 4HM2A 4KT0J 3TGUJ 1KD1Q 2K9JB 1IK9A 2AEJA 2QM8A 2GUVA 3Q5RA 3O6QA 4H0LC 1VQ4P 2CPBA 4KJMA 4NBHD 2P67A 1KB9I 3L4FA 5GTHE 3VMID 1FZGA 2HMNA 1KFMA 4QMAA 1GL2D 3HE5B 1SFCA 2ZXXA 4N3YB 4IL6E 2IBZE 5CJ4A 1QVGO 4LC1A 1GK4A 4HM8A 4AAYB 1GK6A 1ZR2A 1LTJA 3ITKA 3FGAD 1SQQK 2KSEA 3H32A 1NDOA 3FXEA 2N1TC 1H88A 3KYQA 4GIFA 5APQA 2JKVA 2QJKC 2Z5HA 3E1RA 3VMXA 1YJWP 1VQ6P 1NGMB 1G1JA 4PD4E 1USEA 4I2LC 3VCAA 5AW2B 3H1IE 3Q1MA 1W5CE 4JF7A 3RK3C 2GUSA 2OARA 4ZKUA 2Y9ZA 1T6AA 5CHXA 1L0NK 1Q2NA 4WWIA 3H1LE 1DIPA 3RL0D 1M1KQ 3B5NC 1NVOA 2I1JA 2IBZD 1SQXK 4QDFA 2ZYGA 3U1AA 1VM9A 3G71P 1PGOA 1WT6A 3VYIA 2FYUK 3IR9A 3LW5H 3L36A 3P8MC 4B86A 1JMBA 1HBWA 2P7JA 5H2FE 2ZFCA 3T97A 2HMOA 3Q5PA 4H13C 5E79E 4Y99C 3L71E 5BVZA 2E42A 4PD4D 2C9LY 1EQ7A 1SS1A 3H1ID 3MUDA 3H1IJ 5CBNA 1PPJE 1YITP 2E74C 1CI6B 4OGQC 2Q3EA 3NTNA 1HTLC 2DE5D 3L70E 2N9BA 1VF5B 3V5BA 1P84H 3MTUE 2H88C 2QEXP 4M3LA 2ZJSE 1JY3O 1RE3C 2HMJA 2HPCA 2NPSC 2Y0DA 2KIKA 2Q3WA 1OZHA 2OGUA 1T2KC 2E75C 1NTKK 2NZ2A 1AA0A 1NAFA 1QL2A 1BDCA 2BMRA 2L5GB 2Y0CA 1R8EA 2QVAA 3M06A 1LT9B 1IK7A 1PPJD 3GTEA 3AZCA 1FDOA 5TISE 3RL0g 3OAKA 3C9IA 1Q7YQ 2OQQA 1OFCX 1NAYA 1S5LH 3CD6P 3ABVC 1LP1A 4I7ZC 3L70D 4OVNF 2XU6A 1LWUC 2SPZA 3L70J 4IFDK 2XDJA 3HUSC 3D89A 1J1DC 5AEUA 3CI9A 5AVRB 3AE3C 2H8PD 1NYHA 3VMZA 3WUVA 1HF9A 1E79H 5AVUB 3WMM0 2A06G 3CCRP 2A45G 1VF5D 3AE2C 3WU2E 1PPJG 1JO5A 2W83C 1ZN5A 2M3EA 2RH0A 4NBAD 3JCUH 3M9QA 3PLNA 1YQ3C 1K73Q 2FY8A 1SFCB 4JQ0D 1VQ7P 3L70G 3EFFK 1OWAA 1VCKA 3B5NA 3AE5C 2R3SA 1KYOE 1NHLA 3HD7B 2E5TA 2ZAEB 2L91A 4W80A 5CJ0A 4EOTA 3H32B 1FAVA 2G8YA 1MFZA 2I1KA 4GOFA 3S4RA 4L73A 1X22A 3N0QA 1HVVA 1LNQA 2HMMA 2ZVOB 1GTWA 5BU5A 3D71A 2FYNB 5AVSB 4WVZA 1VQPP 2VRSA 3HE4A 1S72P 4WY4C 1MZ9A 1LTSC 2WPRA 2WSCH 2YO2A 3Q5SA 1LTGC 2DW3A 3IN6A 5AVTB 2BMOA 1MUUA 4XE5B 1H0TA 4Z1MH 4QDFB 1SP4A 1KYOD 1SQQG 2IZ1A 1VQ8P 4IFMA 2P1JA 3A2AA 1ZRTE 1SFCD 1FJKA 3M0AA 3A3YB 1HUCA 1RE3A 3L74E 1FOSF 4TLFA 1LGHB 3HD7D 2NPSA 2FYUJ 4HH2A 2YMKA 1CW5A 1M1JB 3K5BA 4H44C 5CMZA 1HH0A 3BCCE 2E43A 5K5GB 2WSEJ 2OYHC 1QGKB 1S3JA 1FDMA 4QUPA 4XFJA 2IYOA 2OTLP 2V7QH 2D2CC 4JBZA 1KQFB 1PGQA 1TU3F 1FOSE 1BSHA 1NTZE 1MFTA 3E1IA 2E76C 4NPFX 2WITA 2FYUG 4I6MC 4QDDA 3TDKA 1M90Q 2DE6D 1LWUA 1Q90C 2JWDA 4HB1A 1ZRTD 3HUSA 4ZMDA 1YTZI 5CCGC 1RIEA 1IFDA 3AECC 4KHXA 3L74D 3G3ZA 1AV1A 4C7NB 5KKZC 1KORA 1N73C 1R5LA 5KAIH 2QM7A 1N8RQ 3BCCD 1JY2N 3BCCJ 3CX5I 1FU1A 2B89A 1GU5A 1KTMA 3GL0A 1HGVA 2FFDC 2KS1A 3H25A 3R2PA 4YXWH 3P7KA 5KLIB 1BE3E 2C0WA 2ZXEB 1M56D 3VMAA 4UB6H 4EIJA 1NTZD 2B24A 5KAIE 1NTZJ 2H89C 1PZQA 2YVJB 1EDJA 3CCQP 2OTKE 3CX5H 2QJKB 1ZOYC 3NFQA 1XTCC 3BCCG 2QJPC 1DX7A 2B88A 2V7QJ 4U3FE 3KZIE 2QIWA 2JO1A 3CXHE 3KHUA 3GHGC 1FZCC 1LJ2A 3PTZA 2BCCE 4YPCA 2W6JH 3A0BH 4GDOA 2Y0EA 4PV1C 3RK3B 5CBOA 2B87A 1JY2P 5B5EE 4WY4A 3AEEC 3VN0A 1X9VA 3VTPC 3GF3A 4NBGD 5KJ7D 3CPWO 4AUWA 2JP3A 1K8AQ 3B5NB
chains in the Genus database with same CATH topology
4QURA 3L71E 2J5UA 3G9RA 3RK3E 3C0DA 3AEBC 4H44B 3AE7C 1U57A 3AE4C 1ULJA 1K05A 1PPJE 1EZVE 3SFDC 4HJLA 2E74C 4AIVA 1L0NE 2E4PA 4OGQC 2YFIA 2FYNC 2WSCJ 2MKVA 2DE5D 2D2CB 1OW8A 3L70E 4NBBD 1SQXE 1VF5B 4H0LB 2GBXA 1BCCE 2XR8A 2H88C 2YFLA 1O7WA 2FYUE 1FQTA 2HMJA 3R4YA 2E4QA 3D6ZA 2Q3WA 1UUWA 1DD4A 3L72E 3C8VA 2E75C 1OMIA 2NZ2A 4QUQA 4OGQB 3H1HE 4RKUJ 2NUMA 2WSFJ 3AE6C 3AE8C 1KMIZ 2BMRA 3VMHD 3EN1A 1R8EA 4HM4A 3GF7A 1KB9E 1RFSA 3D70A 4HM7A 1IK7A 3GTEA 3AZCA 2NVFA 1FDOA 3RL0g 5HL4A 2OQQA 3Q3DA 4H44D 1O7NA 3ABVC 5KLVE 2I7FA 1NYKA 2HMLA 4I7ZC 5AEWA 3D89A 2ZT9B 5AEUA 1UIXA 1FDIA 1O7MA 1YQ4C 1EXIA 3IAOA 3EQQA 3AE3C 5M1BA 2CKFA 1AJYA 1NYHA 2B1XA 1HF9A 3EWKA 3CX5E 4NB9D 2D2CD 2NWFA 1G8JB 1S5LX 1VF5D 4H0LD 2O01J 3GOBA 2E76D 1OW6A 3AE2C 1NTKE 3H1KE 3B71A 4NBDD 2IDBA 1WQLA 4NBAD 4R4LA 2BEQD 4I7ZB 1YQ3C 3GMAA 1JM1A 1Q90D 1RQUA 1O7GA 4OGQD 4PV1B 1WMKA 1S1CX 1VCKA 3AE5C 1KQGB 1KYOE 4P1CH 2YFJA 4NBED 4H13B 4U7JA 3GL2A 3S9OA 3VMGD 5KLIC 2G8YA 3AE9C 4YXDC 2E74B 2HMKA 4YTPC 2QSIA 3GLMA 3N0QA 4H13C 1RQVA 2HMMA 1OW7A 1PV3A 3D71A 2ZT9D 3GZXA 3TGUE 1P84E 1SQBE 4TT3H 3LW5J 2DE7D 3Q5SA 3IN6A 4HM5A 1SJGA 1ULIA 2FXPA 1NU1E 1SQVE 2BMOA 3AEAC 4Z1MH 1PL5A 4HKVA 1O7HA 4QDFB 2G3AA 3SFEC 2E75B 2K9YA 1GMJA 3L75E 1ZRTE 2JZAA 2WQYC 2BMQA 4PV1D 2FBWC 2ZYLA 2JO6A 3H1JE 3L74E 3D6YA 2YMKA 4HM3A 1PP9E 1JB0J 4H44C 1PIXA 4QDCA 4H13D 5L8RJ 3AEFC 3GKEA 3GCEA 3BCCE 1NTME 2WSEJ 2XSOA 1EG9A 1MKMA 5CXMA 2QPZA 1ZMEC 4NBCD 4QUPA 4HM2A 4XFJA 3GTSA 4KT0J 2E74D 4R4MA 2D2CC 1KQFB 3L73E 1TU3F 2NVGA 1VF5C 3Q5RA 3O6QA 4H0LC 4NBHD 1NTZE 2E76C 2A06E 4HM0A 3VMID 2XSHA 2P10A 4QDDA 2HMNA 3DQYA 2DE6D 1Q90C 1SQPE 4HM6A 4IL6X 2IBZE 1RIEA 3GZYA 3AECC 1KILE 4HM8A 4AAYB 2YIUC 3AE1C 2E75D 2NUKA 5KKZC 4NBFD 3FGAD 1KORA 4QCKA 2E76B 1NDOA 2BEZF 2XRXA 2QJKC 1KTMA 3GL0A 1L0LE 3H25A 1NGMB 1DD3A 4PD4E 1BE3E 3AEGC 1HJ0A 3GB4A 3VCAA 2ZT9C 2B24A 3H1IE 2WPVB 3Q1MA 2H89C 4NB8D 2YVJB 3H1LE 1DIPA 1O7PA 1VL2A 3CWBE 1ZOYC 3AEDC 3VCPA 2QJPC 3Q2YA 2V7QJ 1UUVA 4U3FE 2QIWA 2JO1A 2NVEA 3CXHE 4EMJB 4QDFA 1K04A 4P1BH 1Y9BA 3T97B 1VM9A 2BCCE 1EXJA 2QJYC 4HM1A 4GDOA 1ZP0C 1SQQE 4PV1C 4Y28J 3FOUA 3AEEC 5BOKA 3GF3A 2GBWA 4NBGD 1G8KB 2JP3A 2HMOA 3Q5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QUR A;  2IBZ E;  1RIE A;  4I7Z C;  3GZY A;  1SQB E;  3L71 E;  5AEW A;  4AAY B;  4HM8 A;  2DE7 D;  2YIU C;  3D89 A;  2E75 D;  3C0D A;  5AEU A;  2NUK A;  5KKZ C;  4NBF D;  1O7M A;  4HM5 A;  1SJG A;  1ULI A;  3EQQ A;  1NU1 E;  4QCK A;  2CKF A;  1SQV E;  2BMO A;  2B1X A;  1ULJ A;  3CX5 E;  4HKV A;  4NB9 D;  1PPJ E;  1EZV E;  1O7H A;  4QDF B;  2D2C D;  1NDO A;  2E74 C;  4HJL A;  2NWF A;  1G8J B;  4AIV A;  1L0N E;  1VF5 D;  2XRX A;  4H0L D;  2E4P A;  2QJK C;  4OGQ C;  2YFI A;  3L75 E;  1ZRT E;  2E76 D;  3GOB A;  2FYN C;  2JZA A;  3GL0 A;  1NTK E;  3H1K E;  2BMQ A;  4NBD D;  1L0L E;  4PV1 D;  2DE5 D;  1WQL A;  2ZYL A;  4NBA D;  3L70 E;  2JO6 A;  3H1J E;  4NBB D;  4PD4 E;  1SQX E;  1BE3 E;  3L74 E;  1JM1 A;  2GBX A;  1BCC E;  2XR8 A;  3GB4 A;  1O7G A;  2ZT9 C;  2YMK A;  2YFL A;  2B24 A;  4HM3 A;  3H1I E;  3VCA A;  1PP9 E;  4H44 C;  1O7W A;  4QDC A;  4H13 D;  4OGQ D;  2FYU E;  1FQT A;  1VCK A;  3GKE A;  2HMJ A;  3GCE A;  3BCC E;  1NTM E;  2E4Q A;  1KYO E;  4NB8 D;  4P1C H;  2XSO A;  1EG9 A;  2YVJ B;  3H1L E;  1O7P A;  1UUW A;  2Q3W A;  3L72 E;  2YFJ A;  5CXM A;  2E75 C;  3CWB E;  2QPZ A;  4NBE D;  4NBC D;  4QUQ A;  4QUP A;  4HM2 A;  3GTS A;  3VCP A;  2QJP C;  3H1H E;  3GL2 A;  2NUM A;  1UUV A;  2E74 D;  4U3F E;  2NVE A;  3CXH E;  4EMJ B;  4QDF A;  2D2C C;  4P1B H;  2BMR A;  3VMG D;  3L73 E;  3VMH D;  5KLI C;  1VM9 A;  2NVG A;  3EN1 A;  1VF5 C;  4HM4 A;  4H0L C;  1KB9 E;  2BCC E;  1NTZ E;  1RFS A;  4NBH D;  2E76 C;  2QJY C;  4HM7 A;  4HM1 A;  2A06 E;  4HM0 A;  2HMK A;  3GTE A;  1SQQ E;  4PV1 C;  3VMI D;  3AZC A;  2NVF A;  2XSH A;  3N0Q A;  4QDD A;  2HMN A;  2HMM A;  3FOU A;  5HL4 A;  3DQY A;  2DE6 D;  2ZT9 D;  1Q90 C;  5BOK A;  3GZX A;  2GBW A;  4H44 D;  4NBG D;  3TGU E;  1O7N A;  1SQP E;  1G8K B;  5KLV E;  1P84 E;  2I7F A;  1NYK A;  2HML A;  2HMO A;  4HM6 A;  4H13 C; 
#chains in the Genus database with same CATH topology
 3GG2 A;  2J5U A;  2UWJ E;  1X79 B;  1BE3 D;  3RK3 E;  1SQB K;  1BE3 J;  2IFN A;  4GKG A;  4MN4 C;  2QA4 P;  3AE4 C;  2M8R A;  1L2P A;  1EZV E;  4RJT A;  4EYY Q;  3RBX A;  2E4P A;  2YFI A;  1M57 D;  3KDP B;  1URQ B;  2WT7 A;  4K35 A;  1VQO P;  3TGU G;  3CXH D;  4NBB D;  1A02 F;  1VQ5 P;  2GBX A;  5APW A;  2OYH A;  2BCC D;  2YFL A;  2BCC J;  1KB9 H;  3TNU A;  1BE3 G;  2WPQ A;  1YTZ T;  3A5T A;  2POH A;  3PRJ A;  3ZDM A;  1ZV8 A;  2KI7 B;  2M5A B;  4QUQ A;  4O9B A;  4OGQ B;  1L4A D;  1H0T B;  2C9N Y;  4RKU J;  2Y9Y A;  2NUM A;  2WSF J;  3M91 A;  2YIU B;  3RK3 D;  1AVY A;  3B4S A;  5AW7 B;  3V2R A;  1H89 A;  1KB9 E;  2V4H A;  4OH8 B;  2YKP A;  1KC8 Q;  1QLE D;  3B5N D;  1EZV D;  3L37 A;  3FWN A;  2R5D A;  2A45 I;  2BCC G;  4GT1 A;  5CCG A;  3JC2 2;  4I1L A;  1HJB A;  1O7N A;  1ZXG A;  2HML A;  2CPS A;  2KK7 A;  1N73 A;  2ZT9 B;  1UIX A;  1O7M A;  1YQ4 C;  3RL0 C;  1Y8A A;  1EXI A;  1IJD B;  3IAO A;  1RF1 B;  3QH9 A;  3EQQ A;  5M1B A;  1AJY A;  1URQ D;  4L75 A;  4JYC A;  2FFD A;  1G8J B;  2WSS H;  2R5B A;  1VPC A;  2HOD B;  1EZV G;  1JM0 A;  4HYT B;  2W27 A;  4I7Z B;  2IX7 C;  3V4W A;  4UB8 H;  2IBZ G;  3S1K A;  1JM1 A;  1QL1 A;  1Y47 A;  1RQU A;  3HUS B;  1A02 J;  1KB9 D;  1O7G A;  2QJY B;  1FZB A;  3NXS A;  4OGQ D;  3H1L D;  1S1C X;  1FJP A;  3H1L J;  3KPE A;  4IFF A;  3KQG A;  1YHQ P;  1ZLL A;  4NBE D;  3GHG A;  1FZC A;  2FXM A;  3GL2 A;  1LTT C;  1EDL A;  2Q7C A;  5B66 H;  3S9O A;  2W8Z A;  1U7M A;  3WUT A;  2KS1 B;  2C0X A;  3H1I G;  1S4X A;  1VQN P;  2QSI A;  2R44 A;  3GW6 A;  1RQV A;  2KNC A;  3LIE A;  1OVV A;  2W90 A;  2ZT9 D;  3M0D C;  1JTH A;  2OYI B;  1BSN A;  3L71 D;  3H1L G;  3WUU A;  1FZE A;  3MHV A;  3L71 J;  1P84 E;  1KFN A;  1NKN A;  1SQB E;  4TT3 H;  3PP5 A;  3LW5 J;  4BXL A;  2DE7 D;  1BGY E;  3CCU P;  1NTZ K;  4HM5 A;  3VP8 A;  2IZ0 A;  5EFW B;  1ULI A;  3AEA C;  2P2U A;  1JY3 P;  1O7H A;  1DH3 A;  4RO0 A;  3SFE C;  3F5H A;  3L75 E;  3RK2 C;  2WQY C;  1Q82 Q;  2JZA A;  1J1E B;  2BMQ A;  3TK1 A;  4BRY A;  4C46 A;  5CCH D;  2JO6 A;  2N1T A;  3H1J E;  5AW6 B;  1N2D C;  1M7L A;  3L71 G;  3D6Y A;  1FC2 C;  3TF5 A;  1PP9 E;  2E5Y A;  1KIL C;  1W2B O;  1S5L E;  3O6Q B;  2KXP B;  2YKQ A;  1G2C A;  3MGN A;  1NTM E;  3VMY A;  3CC7 P;  1IFI A;  4GOE A;  2QPZ A;  4NBC D;  2Q9I A;  5KAF H;  3GTS A;  1P84 D;  2P58 A;  3C1L A;  5AVX B;  1SQB D;  1SQB J;  2M0B A;  5GTI H;  3F89 A;  3L73 E;  5AVV B;  2NVG A;  1VF5 C;  4BWN A;  4AYC A;  1UII A;  4WB4 A;  1IC2 A;  1LTJ B;  2XSH A;  3JCU E;  5KAF E;  2K9J A;  3L75 D;  3W68 A;  2FKW B;  3L75 J;  1SQP E;  3TNU B;  1GW3 A;  4HM6 A;  3BAS A;  2O01 H;  1LT1 A;  2KUB A;  2NUK A;  2O1J A;  2KOG A;  2CK3 H;  1PP9 D;  1SQB G;  1PP9 J;  2E76 B;  1JCC A;  3W67 A;  1NTM D;  1LT9 C;  3HE5 A;  1T8Z A;  1NTM J;  1VQ9 P;  5APV A;  2XRX A;  2I8D A;  1L0L E;  2PGD A;  2QRX A;  5AVW B;  2Z5I A;  3A0H H;  2IPP A;  3AEG C;  2YO3 A;  3L73 D;  3L73 J;  2O1K A;  4L74 A;  1N73 B;  2QG4 A;  4NB8 D;  2AXT H;  4LGD E;  1VL2 A;  3CWB E;  1SQP D;  3VCP A;  3Q2Y A;  3A0H E;  2K1A A;  1UUV A;  2ZVN B;  1NOH A;  4P1B H;  1Y9B A;  3T97 B;  1VQK P;  2FYZ A;  4DJG A;  2IFM A;  1EXJ A;  3M0D A;  4HM1 A;  1OVU A;  3M9B A;  1E5W A;  3L73 G;  2AXT E;  3CC2 P;  5BOK A;  2GBW A;  3HD7 C;  5APU A;  1L0L D;  4WBA A;  4QUR A;  1L0L J;  3CC4 P;  3CCL P;  3FX0 A;  3E7K A;  1GU4 A;  3C0D A;  3AEB C;  3AE7 C;  3SWF A;  1U57 A;  1JCD A;  1FZC B;  3OA7 A;  3BVH A;  1H8A A;  1K05 A;  2W6B A;  3SFD C;  2QE7 H;  5CCG D;  4AIV A;  3CWB D;  2HPC B;  3CWB J;  2FYN C;  4EI2 A;  5BU8 B;  2WSC J;  2MKV A;  3L74 J;  1NKZ B;  1OW8 A;  2AEF A;  1KIL A;  2XND H;  5APY A;  2FXO A;  4H0L B;  2O3J A;  1N7S C;  1FZF A;  1O7W A;  1CI6 A;  3R4Y A;  5DJU B;  4ZKP A;  3D6Z A;  3MD0 A;  2XKM A;  2XV5 A;  1EDK A;  1NO4 A;  1OVR A;  3H1H E;  4DZO A;  3AE8 C;  3CWB G;  4PJ0 H;  1LP1 B;  2LKM A;  3L74 G;  2J58 A;  1OIP A;  1RFS A;  5AVZ B;  1G1I A;  4HM7 A;  1M1J C;  2N1T B;  4AQR D;  5AVY B;  4EDF A;  4DCK A;  1IO4 A;  2YNY A;  1EZV I;  3MIW A;  4UB6 E;  1NYK A;  1CZQ A;  1G2C B;  5AEW A;  2IBZ I;  1LTB C;  1LT9 A;  4RES B;  4ZNC A;  2CKF A;  1JNM A;  1NTZ G;  2B1X A;  1IFM A;  4NB9 D;  3CX5 E;  1EDI A;  2NWF A;  3H6P A;  4H0L D;  1KQL A;  1OW6 A;  2HR3 A;  3H1H D;  3B71 A;  4NBD D;  3H1H J;  2Q6Q A;  1WQL A;  3P8C E;  1LTI C;  4R4L A;  2BEQ D;  3A0B E;  3GMA A;  4PD4 I;  4IL6 H;  2H43 A;  3TYY A;  3RL0 B;  5KJ7 C;  1WMK A;  2RN0 A;  3IF4 A;  2YXR B;  2HFE D;  4DOJ A;  1HGZ A;  2YFJ A;  1N86 A;  3RBZ A;  4U3F D;  1QVF O;  2PP6 A;  4U3F J;  4H13 B;  4U7J A;  4Y99 B;  4IOI H;  3M9H A;  1GL2 C;  2N1T D;  2H7H A;  4JYB A;  3HE4 B;  5KLI C;  3H1H G;  2PFX A;  3AE9 C;  4OWF A;  1YYC A;  5AVQ B;  4PD4 H;  3HD7 A;  3HTK A;  3TSI A;  2IYP A;  3CX5 D;  1NTM K;  2E74 B;  1T3U A;  3GLM A;  2ZYA A;  1PV3 A;  2WMM A;  3HRN A;  4NPD A;  2KZJ A;  2ITA A;  3CL3 D;  5DJT B;  2OTJ P;  3P8C D;  4ASV A;  2JR8 A;  1USD A;  4U3F G;  2AEM A;  2J59 M;  2WVR A;  3CCV P;  1NU1 E;  1SQV E;  1L4A C;  3SWY A;  2NPS B;  3O8Z A;  3VOP A;  2GM4 A;  4HKV A;  2M3B A;  2E75 B;  2K9Y A;  1FE6 A;  1GMJ A;  1SQP K;  3U59 A;  2OYO A;  5AW4 B;  3G6E P;  1N7S A;  2FBW C;  1IFN A;  2ZYL A;  1IZN B;  1EC5 A;  3L35 A;  5H2F H;  2K37 A;  1BDD A;  4HM3 A;  5E79 H;  1JB0 J;  1RE4 C;  4H13 D;  1MV8 A;  3USS A;  5L8R J;  3AEF C;  3GKE A;  3GCE A;  3OW2 O;  2A45 H;  2XSO A;  1EG9 A;  2PAJ A;  5CXM A;  2KP8 A;  1L0L K;  1DEB A;  3RK2 B;  1LWU B;  3CCJ P;  2E74 D;  1URQ C;  4R4M A;  1GD2 E;  1M1J A;  1J1D B;  1JY3 N;  1P84 I;  2AXC A;  1GW4 A;  1SLQ A;  4ASW A;  1NU1 D;  1SQV D;  1NU1 J;  1SQV J;  2A06 E;  2JEE A;  4HM0 A;  1KIL B;  2P10 A;  3I5C A;  1WRG A;  1Q81 Q;  3DQY A;  2XNX A;  4UB8 E;  1ZR4 A;  4A7P A;  3U1C A;  4IL6 X;  3MP7 B;  4HKZ H;  3GZY A;  1PGJ A;  2NPS D;  5KLV K;  1KIL E;  2WPS A;  2PRR A;  1JEK A;  2YIU C;  3AE1 C;  3BAT A;  2NRG A;  2E75 D;  1T2K D;  4NBF D;  2Q5U A;  3CLQ A;  4QCK A;  3RGU A;  4XA4 A;  3N7N A;  1M8O B;  2BEZ F;  1NU1 G;  1SQV G;  5B66 E;  1OXZ A;  3A7O A;  2O01 N;  2W6A A;  5TIS H;  5AW8 B;  4C7N A;  3CMA P;  1DD3 A;  5KJ7 A;  1HJ0 A;  4N78 E;  2JJL A;  3GB4 A;  2ZT9 C;  3BRV B;  2WPV B;  3JSV C;  3QWO C;  2A06 D;  1RF1 C;  3RK2 D;  1OX3 A;  1O7P A;  1NWQ A;  1GL2 A;  1KYO I;  2WWW A;  1GZL A;  4GOD A;  2B87 B;  3AED C;  4L76 A;  3IFM A;  2Q1K A;  4WY4 B;  1R5S A;  2KLU A;  3SSU A;  3FWL A;  4CPG A;  2NVE A;  4EMJ B;  1KIL D;  1K04 A;  2RMZ A;  4DT0 A;  4NPE A;  4W7Y A;  1AFO A;  3WU2 H;  1PFI A;  4LLH A;  1CSB A;  2QJY C;  2XZR A;  1SVF A;  3B8E B;  1ZP0 C;  1SQQ E;  5CCH C;  4Y28 J;  3FOU A;  2HYN A;  3CCE P;  1NH4 A;  1Q86 Q;  3V4Q A;  1G8K B;  1BGY D;  1KYO H;  1U7J A;  1BGY J;  3CME P;  1RF0 C;  3G9R A;  1L4A A;  2WT7 B;  2HLO A;  4N78 D;  4H44 B;  1HWT C;  2OYH B;  1ULJ A;  1K9M Q;  4HJL A;  3I55 P;  2KSJ A;  3I56 P;  1L0N E;  5GTI E;  1IFJ A;  3H1J D;  2WSE H;  2OYI C;  3H1J J;  3HTK B;  2D2C B;  1RE4 A;  5AW3 B;  2YMY A;  1SQX E;  3P32 A;  1BCC E;  1S9K E;  2XR8 A;  1BGY G;  1JUN A;  2YXQ B;  2FYU E;  1RHZ B;  1KV4 A;  1FQT A;  1SQQ D;  4WY4 D;  1SQQ J;  3V6I A;  1NJI Q;  2E4Q A;  2JDI H;  5AW1 B;  1UUW A;  1DD4 A;  3PHL A;  1GDT A;  1URQ A;  1ZW0 A;  3L72 E;  3C8V A;  1OMI A;  1N7L A;  3V2N A;  2JWA A;  3V2P A;  2R32 A;  2WZ7 A;  3L75 G;  1J1E C;  3AE6 C;  1KMI Z;  5KKZ B;  3H1J G;  3VMH D;  3EN1 A;  3LID A;  4HM4 A;  3GF7 A;  5APS A;  3D70 A;  3VP9 A;  2M5A A;  5AW0 B;  1N7S B;  1VDF A;  1PP9 G;  2NVF A;  3CCM P;  2Z4E A;  5HL4 A;  1L0N D;  2LXB A;  4K3A A;  3Q3D A;  2R3C A;  1NTM G;  1L0N J;  1SQP J;  4HJG H;  1LTA C;  4H44 D;  2FFD B;  5KLV E;  2I7F A;  1D7M A;  1YIJ P;  1JOC A;  1SQX D;  1SQX J;  1SFC C;  1XTG B;  1BCC D;  1S9K D;  2Q3I A;  1FDI A;  1BCC J;  2FYU D;  1KN7 A;  3EWK A;  2D2C D;  1LTJ C;  1S5L X;  3II6 A;  3L72 D;  2O01 J;  3L72 J;  2QJP B;  3GOB A;  2E76 D;  1NTK E;  3H1K E;  2WTY A;  1YBK A;  3BRT B;  2IDB A;  4N6J A;  5APX A;  2BAS A;  1L0N G;  1RH5 B;  1SQP G;  3GHG B;  3SWK A;  1RF1 A;  1JMM A;  3PH0 A;  1Q90 D;  2YKO A;  4D6T E;  1NU1 K;  1SQV K;  2MJZ A;  2B9B A;  4PV1 B;  1SQX G;  1KQG B;  1BCC G;  3CCS P;  4P1C H;  1QX8 A;  2HOD A;  3V2Q A;  1J2J B;  2KB7 P;  3PJS K;  2GA1 A;  5AW5 B;  2KNC B;  1S2E A;  5KLV D;  1QEX A;  5KLV J;  1KQS O;  1N7S D;  1W2E A;  1Z56 A;  1JTH B;  3L72 G;  2KLV A;  1L0L G;  2KYV A;  3VMG D;  3CXH I;  5CCH A;  4YXD C;  5AW9 B;  1YJ9 P;  2HMK A;  4YTP C;  1VQM P;  1PGP A;  3G4S P;  1YI2 P;  1X8Y A;  1VQL P;  1OW7 A;  3OJA B;  3N4X A;  1RF0 A;  3GZX A;  1YJN P;  1NTK D;  1IFP A;  3H1K D;  3TGU E;  1KZU B;  1NTK J;  2LR2 A;  3H1K J;  3NMD A;  5KTB A;  3EFG A;  4BRY B;  1GL2 B;  1X0T A;  4D6T D;  2N9Y B;  4D6T J;  1AVO A;  5KLV G;  1SJG A;  2FXP A;  3KZI H;  3CXH H;  2ZYD A;  2HG5 D;  4C7R A;  3MZW B;  1JY2 O;  1PL5 A;  3KXD A;  2OYI A;  2G3A A;  4JPZ B;  3MUD C;  4W7Z A;  4PJ0 E;  1FZA A;  3UIA A;  4PV1 D;  5B5E H;  2KZI A;  1FS0 E;  3FXD A;  1FBM A;  1NTK G;  2K88 A;  3H1K G;  2WSF H;  1PIX A;  2RKL A;  2K3R A;  5C39 A;  4QDC A;  5APT A;  1AQ5 A;  1RY3 A;  4D6T G;  1L4A B;  3EQ2 A;  5GTH H;  1DEE G;  1MKM A;  5TJH A;  2LXC B;  1T3J A;  1ZME C;  3TGU D;  1AQT A;  4HM2 A;  4KT0 J;  3TGU J;  1KD1 Q;  2K9J B;  1IK9 A;  2AEJ A;  2QM8 A;  2GUV A;  3Q5R A;  3O6Q A;  4H0L C;  1VQ4 P;  2CPB A;  4KJM A;  4NBH D;  2P67 A;  1KB9 I;  3L4F A;  5GTH E;  3VMI D;  1FZG A;  2HMN A;  1KFM A;  4QMA A;  1GL2 D;  3HE5 B;  1SFC A;  2ZXX A;  4N3Y B;  4IL6 E;  2IBZ E;  5CJ4 A;  1QVG O;  4LC1 A;  1GK4 A;  4HM8 A;  4AAY B;  1GK6 A;  1ZR2 A;  1LTJ A;  3ITK A;  3FGA D;  1SQQ K;  2KSE A;  3H32 A;  1NDO A;  3FXE A;  2N1T C;  1H88 A;  3KYQ A;  4GIF A;  5APQ A;  2JKV A;  2QJK C;  2Z5H A;  3E1R A;  3VMX A;  1YJW P;  1VQ6 P;  1NGM B;  1G1J A;  4PD4 E;  1USE A;  4I2L C;  3VCA A;  5AW2 B;  3H1I E;  3Q1M A;  1W5C E;  4JF7 A;  3RK3 C;  2GUS A;  2OAR A;  4ZKU A;  2Y9Z A;  1T6A A;  5CHX A;  1L0N K;  1Q2N A;  4WWI A;  3H1L E;  1DIP A;  3RL0 D;  1M1K Q;  3B5N C;  1NVO A;  2I1J A;  2IBZ D;  1SQX K;  4QDF A;  2ZYG A;  3U1A A;  1VM9 A;  3G71 P;  1PGO A;  1WT6 A;  3VYI A;  2FYU K;  3IR9 A;  3LW5 H;  3L36 A;  3P8M C;  4B86 A;  1JMB A;  1HBW A;  2P7J A;  5H2F E;  2ZFC A;  3T97 A;  2HMO A;  3Q5P A;  4H13 C;  5E79 E;  4Y99 C;  3L71 E;  5BVZ A;  2E42 A;  4PD4 D;  2C9L Y;  1EQ7 A;  1SS1 A;  3H1I D;  3MUD A;  3H1I J;  5CBN A;  1PPJ E;  1YIT P;  2E74 C;  1CI6 B;  4OGQ C;  2Q3E A;  3NTN A;  1HTL C;  2DE5 D;  3L70 E;  2N9B A;  1VF5 B;  3V5B A;  1P84 H;  3MTU E;  2H88 C;  2QEX P;  4M3L A;  2ZJS E;  1JY3 O;  1RE3 C;  2HMJ A;  2HPC A;  2NPS C;  2Y0D A;  2KIK A;  2Q3W A;  1OZH A;  2OGU A;  1T2K C;  2E75 C;  1NTK K;  2NZ2 A;  1AA0 A;  1NAF A;  1QL2 A;  1BDC A;  2BMR A;  2L5G B;  2Y0C A;  1R8E A;  2QVA A;  3M06 A;  1LT9 B;  1IK7 A;  1PPJ D;  3GTE A;  3AZC A;  1FDO A;  5TIS E;  3RL0 g;  3OAK A;  3C9I A;  1Q7Y Q;  2OQQ A;  1OFC X;  1NAY A;  1S5L H;  3CD6 P;  3ABV C;  1LP1 A;  4I7Z C;  3L70 D;  4OVN F;  2XU6 A;  1LWU C;  2SPZ A;  3L70 J;  4IFD K;  2XDJ A;  3HUS C;  3D89 A;  1J1D C;  5AEU A;  3CI9 A;  5AVR B;  3AE3 C;  2H8P D;  1NYH A;  3VMZ A;  3WUV A;  1HF9 A;  1E79 H;  5AVU B;  3WMM 0;  2A06 G;  3CCR P;  2A45 G;  1VF5 D;  3AE2 C;  3WU2 E;  1PPJ G;  1JO5 A;  2W83 C;  1ZN5 A;  2M3E A;  2RH0 A;  4NBA D;  3JCU H;  3M9Q A;  3PLN A;  1YQ3 C;  1K73 Q;  2FY8 A;  1SFC B;  4JQ0 D;  1VQ7 P;  3L70 G;  3EFF K;  1OWA A;  1VCK A;  3B5N A;  3AE5 C;  2R3S A;  1KYO E;  1NHL A;  3HD7 B;  2E5T A;  2ZAE B;  2L91 A;  4W80 A;  5CJ0 A;  4EOT A;  3H32 B;  1FAV A;  2G8Y A;  1MFZ A;  2I1K A;  4GOF A;  3S4R A;  4L73 A;  1X22 A;  3N0Q A;  1HVV A;  1LNQ A;  2HMM A;  2ZVO B;  1GTW A;  5BU5 A;  3D71 A;  2FYN B;  5AVS B;  4WVZ A;  1VQP P;  2VRS A;  3HE4 A;  1S72 P;  4WY4 C;  1MZ9 A;  1LTS C;  2WPR A;  2WSC H;  2YO2 A;  3Q5S A;  1LTG C;  2DW3 A;  3IN6 A;  5AVT B;  2BMO A;  1MUU A;  4XE5 B;  1H0T A;  4Z1M H;  4QDF B;  1SP4 A;  1KYO D;  1SQQ G;  2IZ1 A;  1VQ8 P;  4IFM A;  2P1J A;  3A2A A;  1ZRT E;  1SFC D;  1FJK A;  3M0A A;  3A3Y B;  1HUC A;  1RE3 A;  3L74 E;  1FOS F;  4TLF A;  1LGH B;  3HD7 D;  2NPS A;  2FYU J;  4HH2 A;  2YMK A;  1CW5 A;  1M1J B;  3K5B A;  4H44 C;  5CMZ A;  1HH0 A;  3BCC E;  2E43 A;  5K5G B;  2WSE J;  2OYH C;  1QGK B;  1S3J A;  1FDM A;  4QUP A;  4XFJ A;  2IYO A;  2OTL P;  2V7Q H;  2D2C C;  4JBZ A;  1KQF B;  1PGQ A;  1TU3 F;  1FOS E;  1BSH A;  1NTZ E;  1MFT A;  3E1I A;  2E76 C;  4NPF X;  2WIT A;  2FYU G;  4I6M C;  4QDD A;  3TDK A;  1M90 Q;  2DE6 D;  1LWU A;  1Q90 C;  2JWD A;  4HB1 A;  1ZRT D;  3HUS A;  4ZMD A;  1YTZ I;  5CCG C;  1RIE A;  1IFD A;  3AEC C;  4KHX A;  3L74 D;  3G3Z A;  1AV1 A;  4C7N B;  5KKZ C;  1KOR A;  1N73 C;  1R5L A;  5KAI H;  2QM7 A;  1N8R Q;  3BCC D;  1JY2 N;  3BCC J;  3CX5 I;  1FU1 A;  2B89 A;  1GU5 A;  1KTM A;  3GL0 A;  1HGV A;  2FFD C;  2KS1 A;  3H25 A;  3R2P A;  4YXW H;  3P7K A;  5KLI B;  1BE3 E;  2C0W A;  2ZXE B;  1M56 D;  3VMA A;  4UB6 H;  4EIJ A;  1NTZ D;  2B24 A;  5KAI E;  1NTZ J;  2H89 C;  1PZQ A;  2YVJ B;  1EDJ A;  3CCQ P;  2OTK E;  3CX5 H;  2QJK B;  1ZOY C;  3NFQ A;  1XTC C;  3BCC G;  2QJP C;  1DX7 A;  2B88 A;  2V7Q J;  4U3F E;  3KZI E;  2QIW A;  2JO1 A;  3CXH E;  3KHU A;  3GHG C;  1FZC C;  1LJ2 A;  3PTZ A;  2BCC E;  4YPC A;  2W6J H;  3A0B H;  4GDO A;  2Y0E A;  4PV1 C;  3RK3 B;  5CBO A;  2B87 A;  1JY2 P;  5B5E E;  4WY4 A;  3AEE C;  3VN0 A;  1X9V A;  3VTP C;  3GF3 A;  4NBG D;  5KJ7 D;  3CPW O;  4AUW A;  2JP3 A;  1K8A Q;  3B5N B; 
#chains in the Genus database with same CATH homology
 4QUR A;  3L71 E;  2J5U A;  3G9R A;  3RK3 E;  3C0D A;  3AEB C;  4H44 B;  3AE7 C;  1U57 A;  3AE4 C;  1ULJ A;  1K05 A;  1PPJ E;  1EZV E;  3SFD C;  4HJL A;  2E74 C;  4AIV A;  1L0N E;  2E4P A;  4OGQ C;  2YFI A;  2FYN C;  2WSC J;  2MKV A;  2DE5 D;  2D2C B;  1OW8 A;  3L70 E;  4NBB D;  1SQX E;  1VF5 B;  4H0L B;  2GBX A;  1BCC E;  2XR8 A;  2H88 C;  2YFL A;  1O7W A;  2FYU E;  1FQT A;  2HMJ A;  3R4Y A;  2E4Q A;  3D6Z A;  2Q3W A;  1UUW A;  1DD4 A;  3L72 E;  3C8V A;  2E75 C;  1OMI A;  2NZ2 A;  4QUQ A;  4OGQ B;  3H1H E;  4RKU J;  2NUM A;  2WSF J;  3AE6 C;  3AE8 C;  1KMI Z;  2BMR A;  3VMH D;  3EN1 A;  1R8E A;  4HM4 A;  3GF7 A;  1KB9 E;  1RFS A;  3D70 A;  4HM7 A;  1IK7 A;  3GTE A;  3AZC A;  2NVF A;  1FDO A;  3RL0 g;  5HL4 A;  2OQQ A;  3Q3D A;  4H44 D;  1O7N A;  3ABV C;  5KLV E;  2I7F A;  1NYK A;  2HML A;  4I7Z C;  5AEW A;  3D89 A;  2ZT9 B;  5AEU A;  1UIX A;  1FDI A;  1O7M A;  1YQ4 C;  1EXI A;  3IAO A;  3EQQ A;  3AE3 C;  5M1B A;  2CKF A;  1AJY A;  1NYH A;  2B1X A;  1HF9 A;  3EWK A;  3CX5 E;  4NB9 D;  2D2C D;  2NWF A;  1G8J B;  1S5L X;  1VF5 D;  4H0L D;  2O01 J;  3GOB A;  2E76 D;  1OW6 A;  3AE2 C;  1NTK E;  3H1K E;  3B71 A;  4NBD D;  2IDB A;  1WQL A;  4NBA D;  4R4L A;  2BEQ D;  4I7Z B;  1YQ3 C;  3GMA A;  1JM1 A;  1Q90 D;  1RQU A;  1O7G A;  4OGQ D;  4PV1 B;  1WMK A;  1S1C X;  1VCK A;  3AE5 C;  1KQG B;  1KYO E;  4P1C H;  2YFJ A;  4NBE D;  4H13 B;  4U7J A;  3GL2 A;  3S9O A;  3VMG D;  5KLI C;  2G8Y A;  3AE9 C;  4YXD C;  2E74 B;  2HMK A;  4YTP C;  2QSI A;  3GLM A;  3N0Q A;  4H13 C;  1RQV A;  2HMM A;  1OW7 A;  1PV3 A;  3D71 A;  2ZT9 D;  3GZX A;  3TGU E;  1P84 E;  1SQB E;  4TT3 H;  3LW5 J;  2DE7 D;  3Q5S A;  3IN6 A;  4HM5 A;  1SJG A;  1ULI A;  2FXP A;  1NU1 E;  1SQV E;  2BMO A;  3AEA C;  4Z1M H;  1PL5 A;  4HKV A;  1O7H A;  4QDF B;  2G3A A;  3SFE C;  2E75 B;  2K9Y A;  1GMJ A;  3L75 E;  1ZRT E;  2JZA A;  2WQY C;  2BMQ A;  4PV1 D;  2FBW C;  2ZYL A;  2JO6 A;  3H1J E;  3L74 E;  3D6Y A;  2YMK A;  4HM3 A;  1PP9 E;  1JB0 J;  4H44 C;  1PIX A;  4QDC A;  4H13 D;  5L8R J;  3AEF C;  3GKE A;  3GCE A;  3BCC E;  1NTM E;  2WSE J;  2XSO A;  1EG9 A;  1MKM A;  5CXM A;  2QPZ A;  1ZME C;  4NBC D;  4QUP A;  4HM2 A;  4XFJ A;  3GTS A;  4KT0 J;  2E74 D;  4R4M A;  2D2C C;  1KQF B;  3L73 E;  1TU3 F;  2NVG A;  1VF5 C;  3Q5R A;  3O6Q A;  4H0L C;  4NBH D;  1NTZ E;  2E76 C;  2A06 E;  4HM0 A;  3VMI D;  2XSH A;  2P10 A;  4QDD A;  2HMN A;  3DQY A;  2DE6 D;  1Q90 C;  1SQP E;  4HM6 A;  4IL6 X;  2IBZ E;  1RIE A;  3GZY A;  3AEC C;  1KIL E;  4HM8 A;  4AAY B;  2YIU C;  3AE1 C;  2E75 D;  2NUK A;  5KKZ C;  4NBF D;  3FGA D;  1KOR A;  4QCK A;  2E76 B;  1NDO A;  2BEZ F;  2XRX A;  2QJK C;  1KTM A;  3GL0 A;  1L0L E;  3H25 A;  1NGM B;  1DD3 A;  4PD4 E;  1BE3 E;  3AEG C;  1HJ0 A;  3GB4 A;  3VCA A;  2ZT9 C;  2B24 A;  3H1I E;  2WPV B;  3Q1M A;  2H89 C;  4NB8 D;  2YVJ B;  3H1L E;  1DIP A;  1O7P A;  1VL2 A;  3CWB E;  1ZOY C;  3AED C;  3VCP A;  2QJP C;  3Q2Y A;  2V7Q J;  1UUV A;  4U3F E;  2QIW A;  2JO1 A;  2NVE A;  3CXH E;  4EMJ B;  4QDF A;  1K04 A;  4P1B H;  1Y9B A;  3T97 B;  1VM9 A;  2BCC E;  1EXJ A;  2QJY C;  4HM1 A;  4GDO A;  1ZP0 C;  1SQQ E;  4PV1 C;  4Y28 J;  3FOU A;  3AEE C;  5BOK A;  3GF3 A;  2GBW A;  4NBG D;  1G8K B;  2JP3 A;  2HMO A;  3Q5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...