2E74D

Crystal structure of the cytochrome b6f complex from m.laminosus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 30
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e74D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e74D02
1O7WA 1RFSA 3VCAA 4NBBD 3GCEA 4QCKA 3CXHE 3H1LE 1VF5D 1NDOA 1SQXE 3EN1A 3GL0A 3L74E 4QUQA 4AIVA 4H0LD 1SQBE 4H0LC 1BE3E 5BOKA 2CKFA 4PV1D 2E74C 2Q3WA 2XR8A 4QDFB 1VM9A 4AAYB 3GL2A 4HJLA 4P1CH 3H1JE 5KLVE 3DQYA 5HL4A 2E75D 2YMKA 2ZT9D 1PP9E 3D89A 2BMQA 2GBXA 3AZCA 2QJKC 4EMJB 2DE7D 3GZYA 1PPJE 2HMNA 3N0QA 5CXMA 2YVJB 1O7NA 2HMLA 4P1BH 5KKZC 3GZXA 2DE6D 4H44D 4HM5A 3GB4A 4H44C 1UUWA 3GOBA 2HMJA 4NBHD 2E4QA 3L72E 1L0NE 2BMOA 2E4PA 3GKEA 3VMHD 1UUVA 2D2CC 3VMID 1BCCE 3BCCE 5AEUA 2QJYC 1NYKA 1KYOE 4OGQC 1SQVE 5KLIC 4OGQD 3C0DA 1Q90C 2BMRA 2XSOA 2BCCE 4NBGD 4NBCD 2NVEA 1L0LE 2FYNC 1O7HA 1O7MA 3GTEA 2D2CD 3GTSA 1ULJA 2JO6A 4HM2A 4HM6A 4NBFD 2ZYLA 2QPZA 2HMKA 1KB9E 1O7GA 2FYUE 4HKVA 2E74D 4PV1C 4QDDA 3VMGD 2YFLA 1RIEA 2NUKA 1VCKA 2QJPC 1P84E 3EQQA 2NVFA 1ZRTE 1NU1E 4NBED 1VF5C 3H1KE 2XSHA 2E76D 4HM4A 2E76C 2JZAA 2NVGA 2IBZE 3TGUE 2ZT9C 4NB9D 4NB8D 3L75E 4NBDD 1O7PA 1EZVE 4U3FE 3L70E 4H13C 4HM7A 2NUMA 4I7ZC 4HM0A 1EG9A 2I7FA 3FOUA 1ULIA 1NTKE 3CWBE 4PD4E 4NBAD 4HM8A 1G8JB 2E75C 1G8KB 1SQPE 2B1XA 4H13D 4QUPA 2DE5D 1SQQE 2HMMA 1NTZE 2YFJA 4QDFA 2YFIA 1JM1A 4HM3A 3VCPA 5AEWA 3L71E 4QDCA 2GBWA 2YIUC 2XRXA 1NTME 4QURA 2B24A 3L73E 4HM1A 2A06E 2NWFA 1FQTA 1WQLA 3CX5E 1SJGA 3H1IE 2HMOA 3H1HE
chains in the Genus database with same CATH superfamily
1J1EC 2IBZD 4IL6E 2WTYA 1YITP 5AVRB 3B8EB 2Q6QA 1OZHA 4LGDE 3AEAC 5CJ4A 1CSBA 2FYUD 4PJ0E 5DJUB 3CLQA 5CCHA 1JB0J 1HGZA 1FZCB 1JY2N 2M3EA 1IK7A 1L0LG 1HVVA 2UWJE 2QG4A 1SQQD 2OYIC 2KNCA 2XDJA 2R3SA 1IC2A 4W7ZA 3SWYA 4OGQD 3C0DA 2W6AA 3H1KD 3B5ND 1G2CA 2IYPA 3GW6A 4QDDA 3D6YA 5AW7B 1NAFA 3FWNA 2B87B 5GTHH 2RKLA 5AVWB 3HD7D 1YI2P 3AE8C 2PGDA 1O7PA 3L74D 1EZVE 3L70E 4H13C 2E5YA 4I7ZC 2WITA 3RL0B 4EYYQ 2QIWA 3B5NA 1SQPD 2RMZA 2P2UA 3CI9A 1URQC 3PH0A 4B86A 3RK3D 1PP9D 3G6EP 2HMOA 3H1HE 3L75D 1O7WA 3IN6A 3CCSP 3V5BA 1OW7A 1LT9C 3GL0A 3L74E 1SQBE 1BE3E 2XZRA 1GU4A 4ZMDA 1FJKA 3GL2A 4IFMA 1QX8A 3KQGA 3H1JE 3O8ZA 3EQ2A 3FX0A 1GU5A 3M9QA 3RBXA 1ZV8A 3TK1A 3RL0C 2HPCB 3GZYA 3T97A 4HM5A 1USDA 5AW6B 2E4PA 1EZVI 1YJWP 1UUVA 4C7NA 2FYUK 2IZ0A 2KI7B 4JPZB 1MFZA 2XSOA 2WZ7A 1O7MA 1SP4A 1ULJA 2GUSA 2QPZA 1O7GA 1FBMA 2O01H 1R5SA 2WSSH 1IFPA 3OA7A 4NBED 3EWKA 2E76C 5B5EH 2OYHC 2E76B 3N7NA 1KILD 2WWWA 4ZKUA 1KQLA 5KJ7D 1NTKE 3CXHH 1FU1A 5APTA 1NTMD 2IZ1A 4QUPA 3D70A 3PTZA 3BRTB 1JTHA 2LXCB 2BEZF 3JC22 4L76A 3L73E 1LTJC 4HM1A 3A2AA 1VQ7P 3CWBD 2WSCH 1FDMA 4EDFA 3TNUA 1VF5D 2ZYGA 3I56P 2E74C 1HTLC 1NTKK 1M7LA 1NVOA 4HJLA 2POHA 1DH3A 2ITAA 3RL0g 3L75G 2JEEA 4WY4C 1YTZI 4U3FG 1S2EA 4OH8B 1IZNB 1LTGC 3H1ID 3HE4A 3AEBC 3B4SA 2KZJA 1LGHB 2FYUJ 3AE2C 3RK2D 3VMID 2O01J 2QA4P 3CWBJ 3D6ZA 1JY3N 5AW0B 1KYOI 1L0LE 3A7OA 2VRSA 4HM2A 2P10A 3CCJP 4N3YB 2NPSA 1CI6A 3C1LA 3AE9C 1GD2E 2LR2A 1NU1D 2KNCB 3Q3DA 3PLNA 1JNMA 3CMEP 2K9JB 3LIDA 1U57A 3GG2A 5AVXB 3P8MC 4AUWA 4NB9D 2I1KA 1YYCA 1W2EA 4HM7A 1IFNA 2B89A 2QJKB 1OVRA 1OVUA 1L4AA 1ULIA 2FKWB 2R44A 3L71D 1L0LK 2G3AA 2N9BA 3L72G 3SFDC 2FFDC 2BCCD 2FY8A 3IF4A 3VCPA 1ZMEC 1PV3A 2XNDH 4IFFA 3C9IA 1OMIA 4QCKA 1NTKJ 1NDOA 2HFED 4H0LD 1FOSF 2N1TC 1PP9G 3L71J 1KILC 1HUCA 1SQXG 5KAFE 1FZCC 2BMQA 1GL2B 1LWUA 3E7KA 2WPSA 3KHUA 2KUBA 2ZYAA 2H89C 3NXSA 2E42A 2D2CB 3HD7A 1NWQA 1PPJD 2OQQA 3M06A 1N73C 2QEXP 1NJIQ 1LWUC 4NBGD 2YO3A 3RK2C 3WUTA 2KSJA 2HPCA 1L4AB 2FFDB 3HTKB 2HMKA 1KB9E 1PGPA 2FYUE 3CL3D 4N78E 3F89A 2JKVA 3IAOA 3S4RA 5KAFH 4GIFA 3SWFA 1G1IA 4JF7A 3L75E 2V7QH 5APUA 5KLIB 4U3FE 1HWTC 1LTSC 3UIAA 2JJLA 3FOUA 4WWIA 1PGOA 3CCVP 4HM8A 3PRJA 2N1TB 2O1KA 3VMXA 4R4LA 1P84I 1YJNP 2Z4EA 1MUUA 3AE7C 2YFJA 2QJPB 3MP7B 1JM1A 1T2KC 4AQRD 2A45I 1PL5A 1LNQA 3V2RA 1HJBA 5KLVJ 3V4WA 4IL6H 3P7KA 1L4AD 1L0LD 3NFQA 1VQKP 3CC4P 4P1CH 1SQPG 1NAYA 3WUUA 4DJGA 2N1TD 1NTZG 1JTHB 3AEDC 3D89A 1IO4A 1HJ0A 1JY2P 1A02F 3N0QA 3MZWB 2JWDA 3G3ZA 1N7SB 3KDPB 5KJ7C 5L8RJ 2KLVA 1KILB 3BVHA 5AEUA 1VQ8P 5AW3B 3Q2YA 2FYNC 3ITKA 1FJPA 2JO6A 3M9HA 4K35A 3AE6C 3AE4C 2IFNA 3TSIA 1XTGB 1W2BO 1ZRTE 1VF5C 2HYNA 2XV5A 2A45G 2Z5IA 4NB8D 4YPCA 3CCUP 2O3JA 2NUMA 4HM0A 3L73J 2YKPA 2SPZA 1SQQE 1N7SC 1DEBA 1BCCD 1J1DB 3Q1MA 2KS1B 4RO0A 5AW2B 3CXHE 3H1LE 3O6QB 1ZXGA 3VP9A 3H1IJ 2Y0CA 1MKMA 1N7SA 1H0TA 1EDLA 3CD6P 2C9NY 1FZFA 2ZT9D 4D6TE 1EZVG 2HMNA 1LT9A 1LTJB 2KXPB 4HJGH 2XNXA 2Y9YA 3MGNA 5APQA 2NRGA 1T3JA 1NYKA 3HE5A 5CCGC 1AJYA 1VQOP 3Q5PA 2W6JH 2AEJA 1SQVK 1YQ3C 5APVA 1GDTA 1S9KD 3OJAB 3CCMP 1RIEA 1P84E 1K04A 1FAVA 1YTZT 3H1JG 5EFWB 3G4SP 3CCRP 2YXQB 4RJTA 2FYZA 1SQXK 4I2LC 5APYA 1K8AQ 5TJHA 3CWBE 4LC1A 1VDFA 4NBAD 1SFCD 1E79H 2NPSD 1SQPE 3HTKA 1PGQA 3F5HA 2HMMA 1KYOH 1NTZE 1X79B 3L71E 4XFJA 3PJSK 4PD4H 4K3AA 3L70J 1JY3O 1N8RQ 3ZDMA 3H1JJ 2RN0A 1IFJA 1AVOA 2OYIB 1MV8A 4IFDK 2CKFA 3II6A 3HRNA 4DT0A 3AEGC 2GBXA 3CXHI 2OGUA 3Q5SA 1PIXA 2Z5HA 1ZR2A 2HMLA 4P1BH 2PP6A 1M57D 1VQNP 2H43A 1BCCE 1NO4A 2M3BA 2K3RA 3H1JD 1S9KE 2IBZI 2NVEA 2R5BA 4ZKPA 3L70D 3V4QA 5AW5B 2IYOA 5APSA 1FS0E 4BRYB 1KILE 1KB9D 3H1HD 2QJPC 1VCKA 4M3LA 3C8VA 3A5TA 4EOTA 3P32A 1BE3D 3RK3B 3LW5H 2C0WA 4WVZA 4PJ0H 1X22A 2QM7A 4L73A 1N73B 1Q82Q 1LTAC 1NTMK 1FDIA 3FXDA 1SQVD 5H2FH 1G1JA 5KLVG 4QDCA 3M91A 1FC2C 3E1RA 3Q5RA 1L4AC 1JOCA 1JO5A 5BOKA 1J2JB 1W5CE 3I5CA 1KB9I 1OWAA 1LP1B 1HGVA 1SFCC 3GF3A 3RL0D 1T8ZA 3CWBG 1EC5A 1S72P 3AE5C 2WVRA 1LTBC 3L72E 3GMAA 3GKEA 3GHGB 3CX5I 4EI2A 2WPVB 2W27A 3S1KA 5AVTB 5CCGD 1A02J 1OFCX 2WMMA 4W80A 2B9BA 1G2CB 3MIWA 1OW8A 1NTKD 3A0HE 2K9YA 3NMDA 2YXRB 2WSEJ 1URQB 3QH9A 4HM4A 2IBZE 1ZRTD 3L73D 3H25A 1M90Q 3BCCD 3R2PA 4OWFA 5AVUB 1KYOD 3PHLA 1KQFB 2B1XA 1TU3F 2NZ2A 4XE5B 3A3YB 1YJ9P 1Q90D 1M1JC 5GTHE 3CCEP 2ZT9B 3H1IG 3TF5A 5AW8B 2A06E 2LKMA 4UB8E 1M1KQ 3MUDA 1NTZK 4WY4A 3V2PA 3FXEA 2B88A 3CC7P 1S3JA 3AEFC 2C9LY 1M1JA 1BDCA 3AECC 3VP8A 4L75A 4N78D 5KJ7A 4WBAA 2R5DA 1EQ7A 2L5GB 3K5BA 1NKNA 3CCLP 2ZFCA 2WT7B 1LT1A 1ZP0C 1DEEG 2DE6D 1UUWA 3LW5J 2PRRA 2BMOA 2WSEH 1RF1A 3H1KJ 1N7SD 3HUSA 1X9VA 2L91A 2BCCE 4XA4A 1JUNA 2P58A 2P67A 1L0NK 1J1EB 1SQPJ 5KAIH 4R4MA 3JSVC 2OYHB 1DIPA 1QVGO 1NTZJ 1USEA 1KFMA 5C39A 4U3FJ 1Q2NA 1RF1C 3L35A 4JBZA 2NUKA 2NVFA 2KYVA 2K37A 3OAKA 2Q7CA 2NVGA 1PPJG 1KFNA 1ZR4A 1GZLA 3H1KG 1NTZD 3AEEC 1R5LA 2DW3A 1FZAA 1KMIZ 2OTKE 4NPFX 3H32A 1SS1A 4DZOA 1NTME 3RBZA 2NWFA 3G9RA 2H88C 2V4HA 1WRGA 1SQVJ 1GL2D 2IDBA 3M0AA 3EFGA 2WT7A 4H0LC 4N6JA 4PV1D 4KJMA 2B87A 4QDFB 1M8OB 4AAYB 4W7YA 2V7QJ 1ZW0A 3WU2E 4HH2A 1OXZA 1RF1B 4I1LA 3HD7C 2OARA 1FDOA 3HUSB 1P84H 3A0BE 1AFOA 5CCGA 3B5NB 2IBZG 2DE7D 2P7JA 1KB9H 2JP3A 3HE4B 3GZXA 1BE3G 3VMAA 2IPPA 1VPCA 2E4QA 1CZQA 3TGUG 1DD4A 2GM4A 1KYOE 1L0NJ 4UB6E 1PP9J 3FGAD 2AEMA 1CI6B 3EFFK 3L74G 2QVAA 4NBFD 5KLVD 2M5AB 4HKVA 3BRVB 2WSCJ 1PGJA 3TNUB 3L73G 2KIKA 1K05A 1EXJA 1YQ4C 3H1KE 2FYNB 1HBWA 3G71P 3H32B 3D71A 1NOHA 1YIJP 3T97B 1RE4A 1G8JB 2E75C 1FE6A 1VF5B 1L0LJ 1EZVD 2PAJA 4QDFA 5CCHC 3H1LJ 2GBWA 4D6TG 1S5LE 1SQQG 5GTIE 1WQLA 3H1IE 1NKZB 3IFMA 2WQYC 2ZAEB 2E74B 3EN1A 4AIVA 4RESB 4D6TD 3GHGC 1VM9A 1OX3A 2W83C 3HUSC 1U7MA 1X8YA 1Y8AA 1NTMJ 1GK4A 1PPJE 1KQGB 2YVJB 2JO1A 4KT0J 1O7NA 3W67A 4H44D 4LLHA 3GB4A 1IFDA 4BXLA 3WUVA 4NBHD 4PD4I 2W8ZA 5B5EE 2QJYC 4GOFA 5GTIH 1EXIA 3KXDA 4OGQC 4C7NB 5KLIC 1BDDA 1L2PA 1LTTC 2CK3H 1Q90C 2BMRA 2E5TA 2Q1KA 1PZQA 4HM6A 1BCCG 5E79E 3VTPC 2MKVA 2Q5UA 3AE3C 4JYCA 1JEKA 3H6PA 2JR8A 1NTMG 4GOEA 3VMGD 2KLUA 2CPSA 3EQQA 4U7JA 1CW5A 2ZXEB 1Q86Q 3IR9A 1SVFA 2P1JA 2WPRA 1K9MQ 2IFMA 1KQSO 3KPEA 1JY3P 1RF0C 2KP8A 3KZIE 2Y0DA 3L70G 4TT3H 4DOJA 2K1AA 2YFIA 1URQD 2KOGA 4O9BA 2XRXA 1RE3A 1VQ5P 1WT6A 2YNYA 1GW3A 2HODA 3SFEC 3CX5E 3LIEA 1SQXD 2MJZA 4NBBD 3PP5A 1GTWA 2FFDA 4YXDC 2J58A 2K9JA 4YXWH 3VOPA 1JY2O 1KC8Q 3A0BH 3CC2P 1RE3C 1VQLP 2H8PD 1OW6A 3SWKA 2E75D 1SQBK 2GUVA 2FXPA 5KAIE 2N9YB 3AZCA 3GLMA 1IJDB 5CXMA 5AW4B 1RH5B 4Z1MH 2H7HA 5DJTB 1KILA 2YMYA 2ZYDA 1EDKA 4Y99B 1SQVE 3U1AA 1M56D 2FXMA 3TGUD 5AVQB 3TYYA 3H1LD 2NPSB 1NU1G 2AXTE 1AVYA 2QSIA 2ZXXA 2KSEA 2AEFA 1BCCJ 2E76D 1QVFO 1VQ6P 1JCDA 2XKMA 2HODB 3U1CA 2W90A 2WSFH 3JCUE 1H88A 3VMZA 3MD0A 3CMAP 2M5AA 2DE5D 2OTJP 2ZVOB 4PD4D 1NTKG 2FBWC 4PV1B 5APWA 5K5GB 3MTUE 5APXA 2FYUG 4NPDA 1NHLA 4NPEA 4JYBA 3E1IA 2C0XA 2M0BA 4QUQA 3VMYA 2R3CA 1QLED 1PFIA 1AA0A 3I55P 1VQPP 2XR8A 4EIJA 1AQTA 3TDKA 1FZGA 2A06D 3M0DC 2QJYB 3DQYA 5HL4A 1BE3J 3U59A 5AVZB 2QJKC 3TGUJ 1GL2A 1LWUB 2PFXA 1L0NG 2GA1A 2QE7H 3L72D 3R4YA 2WPQA 4H44C 3GOBA 1H89A 1FZBA 2BEQD 2YO2A 1RQUA 2K88A 3USSA 3HD7B 3GTEA 5TISH 1RQVA 1EDIA 1GL2C 4IOIH 1SQQK 2Y9ZA 3L75J 1KTMA 2BCCG 4PV1C 4HYTB 3CX5D 2G8YA 1BGYE 2JZAA 2O01N 1NU1J 1KORA 4OVNF 2HG5D 2I7FA 4GT1A 3H1LG 3JCUH 3W68A 1GW4A 1KD1Q 2E75B 1S4XA 1LT9B 3OW2O 2N1TA 4U3FD 4C46A 4L74A 3V2QA 2YIUC 4QURA 3HE5B 1BGYD 3B5NC 1T3UA 1DX7A 1AQ5A 3BATA 1RHZB 2A06G 5BVZA 2Q3WA 2WSFJ 2R32A 3KYQA 3B71A 4JQ0D 2BASA 1UIIA 3CCQP 1YHQP 1PP9E 1U7JA 2JWAA 2W6BA 3BASA 3A0HH 4H0LB 3SSUA 5KKZC 5B66E 2JDIH 2QRXA 2HLOA 2HMJA 1KN7A 1UIXA 4AYCA 3S9OA 1HF9A 5CCHD 3FWLA 3VN0A 1SFCA 5AVVB 2KZIA 4NBCD 1GMJA 3O6QA 1D7MA 2IX7C 2ZYLA 1RE4C 1QL2A 2YKOA 3CX5H 2OTLP 1SLQA 4ASWA 5BU8B 4GKGA 1NU1E 2XSHA 3WMM0 2ZT9C 1VQ9P 2BCCJ 1LTJA 4I7ZB 2AXCA 2Q3EA 1FOSE 2OYOA 4PD4E 2J5UA 5CJ0A 4H13D 3MHVA 1QL1A 2FXOA 5AVYB 1Y9BA 1T2KD 4GODA 1JM0A 2YIUB 2XU6A 1L0ND 2Q3IA 3RK2B 2Q9IA 1E5WA 2ZVNB 2A45H 5E79H 1QEXA 3GCEA 2KS1A 5CBNA 1IK9A 1N2DC 4RKUJ 4I6MC 1K73Q 4H13B 1SQXE 1IFMA 1N86A 5M1BA 4WB4A 4GDOA 1JCCA 2AXTH 1H0TB 1VQ4P 1BGYG 3H1HJ 4BWNA 2O1JA 1Q7YQ 3L71G 3L36A 4EMJB 1SQXJ 2NPSC 1S1CX 1AV1A 3GHGA 1MZ9A 3L74J 1L0NE 3VMHD 2D2CC 5B66H 1GK6A 4TLFA 4Y99C 2I1JA 3QWOC 1BSNA 1J1DC 1XTCC 3KZIH 5AVSB 3BCCG 1NH4A 1P84D 1S5LX 1JMMA 3N4XA 2OYIA 1Y47A 2KK7A 3V2NA 1LTIC 2E74D 1X0TA 1S5LH 1MFTA 4CPGA 1SQBJ 2E43A 3TGUE 1RY3A 1T6AA 1NYHA 1LP1A 1FZEA 4ZNCA 1EG9A 1JMBA 2Y0EA 4D6TJ 4Y28J 1G8KB 1VQMP 2QM8A 5CMZA 2J59M 2RH0A 3L4FA 1ZN5A 4HM3A 2HR3A 3RK3C 3P8CD 1FQTA 1ZLLA 1IFIA 5KTBA 1SQBG 3RGUA 1RFSA 1RF0A 3VCAA 4DCKA 1YBKA 1M1JB 4IL6X 1EDJA 1BSHA 4UB6H 4MN4C 1ZOYC 4C7RA 3ABVC 1WMKA 1URQA 5TISE 3CPWO 5KLVE 2M8RA 1SQBD 3L37A 3NTNA 5AW9B 3AE1C 3V6IA 2YMKA 3GF7A 2CPBA 1N73A 2LXBA 1KZUB 3RK3E 3M9BA 4KHXA 4UB8H 1NGMB 1BGYJ 3H1HG 4WY4D 1SQVG 4HKZH 2ZJSE 3WU2H 3BCCE 1FZCA 1OIPA 1N7LA 4OGQB 1OVVA 4ASVA 5KLVK 1HH0A 2I8DA 4QMAA 2OYHA 1O7HA 3GTSA 2D2CD 4YTPC 2YKQA 1KV4A 4WY4B 5KKZB 1Z56A 1LJ2A 1SQQJ 4A7PA 1QGKB 2YFLA 1Q81Q 4BRYA 1H8AA 4HB1A 3BCCJ 5H2FE 5CHXA 2KB7P 1SFCB 4NBDD 1R8EA 3CXHD 3MUDC 1NU1K 4H44B 1VL2A 3VYIA 3P8CE 5AEWA 1SQPK 2B24A 3M0DA 5BU5A 5CBOA 5AW1B 3L72J 1DD3A 1SJGA
chains in the Genus database with same CATH topology
4QUQA 3AEFC 3AEAC 3AECC 2XR8A 1JB0J 4P1CH 3DQYA 5HL4A 3AEDC 3D89A 1IK7A 1HJ0A 2QJKC 3N0QA 1ZP0C 2DE6D 3R4YA 4H44C 1UUWA 3GOBA 3LW5J 2BMOA 5L8RJ 2BEQD 1RQUA 5AEUA 4OGQD 3C0DA 3Q2YA 2BCCE 2FYNC 3GTEA 1RQVA 2JO6A 4R4MA 1DIPA 3AE6C 3AE4C 1KTMA 4PV1C 4QDDA 3D6YA 2NUKA 2G8YA 2NVFA 1ZRTE 1VF5C 2NVGA 2JZAA 3AE8C 4NB8D 1O7PA 1KORA 1EZVE 3L70E 4H13C 2NUMA 4I7ZC 4HM0A 2I7FA 2QIWA 2E75B 3AEEC 1SQQE 1KMIZ 2YIUC 1NTME 4QURA 3Q1MA 2NWFA 3G9RA 2H88C 2HMOA 3H1HE 1O7WA 3IN6A 2IDBA 1OW7A 3CXHE 3H1LE 3GL0A 3L74E 1SQBE 4H0LC 1BE3E 4PV1D 2Q3WA 2WSFJ 1MKMA 4QDFB 4AAYB 2V7QJ 3B71A 3GL2A 3H1JE 1FDOA 2ZT9D 1PP9E 2DE7D 3GZYA 2HMNA 2JP3A 4H0LB 5KKZC 3GZXA 4HM5A 2HMJA 2E4QA 1UIXA 2E4PA 3S9OA 1HF9A 1UUVA 1DD4A 1NYKA 1KYOE 1AJYA 2XSOA 3FGAD 4NBCD 1GMJA 3Q5PA 1O7MA 1ULJA 3O6QA 4NBFD 2ZYLA 2QPZA 1O7GA 4HKVA 1YQ3C 2WSCJ 1RIEA 1P84E 1K05A 4NBED 1NU1E 1EXJA 1YQ4C 3EWKA 1K04A 3H1KE 2XSHA 2E76C 2ZT9C 2E76B 3D71A 3T97B 4I7ZB 1NTKE 3CWBE 4PD4E 4NBAD 1G8JB 2E75C 2J5UA 1SQPE 1VF5B 4H13D 4QUPA 2HMMA 3D70A 1NTZE 4QDFA 1Y9BA 4XFJA 3L71E 2GBWA 2BEZF 3L73E 4HM1A 1WQLA 3H1IE 2WQYC 3GCEA 4RKUJ 1VF5D 2E74B 4H13B 1SQXE 3EN1A 4AIVA 5M1BA 2CKFA 2E74C 1VM9A 4HJLA 4GDOA 3AEGC 3RL0g 2GBXA 4EMJB 1PPJE 1KQGB 3Q5SA 1PIXA 2YVJB 2JO1A 4KT0J 1O7NA 1S1CX 2HMLA 4P1BH 4H44D 3GB4A 3AEBC 4NBHD 1L0NE 3VMHD 3AE2C 2D2CC 3VMID 2O01J 1BCCE 2QJYC 1EXIA 4OGQC 5KLIC 3D6ZA 1Q90C 2BMRA 2NVEA 1L0LE 4HM2A 2P10A 4HM6A 1S5LX 2MKVA 3AE9C 3AE3C 2E74D 1KILE 3VMGD 3Q3DA 2QJPC 1VCKA 3EQQA 3C8VA 4U7JA 1U57A 3TGUE 4NB9D 1NYHA 4HM7A 1EG9A 1ULIA 4Y28J 1G8KB 2G3AA 4TT3H 3SFDC 1FDIA 2YFIA 4HM3A 3VCPA 1ZMEC 4QDCA 1PV3A 2XRXA 3Q5RA 3SFEC 1FQTA 3CX5E 1OMIA 1RFSA 3VCAA 4NBBD 4QCKA 1NDOA 4IL6X 4H0LD 5BOKA 4YXDC 1ZOYC 3ABVC 1WMKA 5KLVE 3AE1C 1OW6A 2E75D 2YMKA 3GF7A 3GF3A 2BMQA 2FXPA 3AZCA 3GLMA 3RK3E 5CXMA 4Z1MH 3AE5C 1NGMB 2H89C 3L72E 3GMAA 3GKEA 2D2CB 2WPVB 3BCCE 2OQQA 4OGQB 1SQVE 4NBGD 1O7HA 3GTSA 2D2CD 4YTPC 1OW8A 2HMKA 1KB9E 2K9YA 2FYUE 2WSEJ 2QSIA 3IAOA 2YFLA 2E76D 4HM4A 2IBZE 3L75E 4NBDD 4U3FE 3H25A 1R8EA 3FOUA 4H44B 4HM8A 1VL2A 1KQFB 1TU3F 2NZ2A 2B1XA 4R4LA 2DE5D 1Q90D 3AE7C 2YFJA 2FBWC 1JM1A 5AEWA 4PV1B 2ZT9B 2B24A 2A06E 1PL5A 1DD3A 1SJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7W A;  1RFS A;  3VCA A;  4NBB D;  3GCE A;  4QCK A;  3CXH E;  3H1L E;  1VF5 D;  1NDO A;  1SQX E;  3EN1 A;  3GL0 A;  3L74 E;  4QUQ A;  4AIV A;  4H0L D;  1SQB E;  4H0L C;  1BE3 E;  5BOK A;  2CKF A;  4PV1 D;  2E74 C;  2Q3W A;  2XR8 A;  4QDF B;  1VM9 A;  4AAY B;  3GL2 A;  4HJL A;  4P1C H;  3H1J E;  5KLV E;  3DQY A;  5HL4 A;  2E75 D;  2YMK A;  2ZT9 D;  1PP9 E;  3D89 A;  2BMQ A;  2GBX A;  3AZC A;  2QJK C;  4EMJ B;  2DE7 D;  3GZY A;  1PPJ E;  2HMN A;  3N0Q A;  5CXM A;  2YVJ B;  1O7N A;  2HML A;  4P1B H;  5KKZ C;  3GZX A;  2DE6 D;  4H44 D;  4HM5 A;  3GB4 A;  4H44 C;  1UUW A;  3GOB A;  2HMJ A;  4NBH D;  2E4Q A;  3L72 E;  1L0N E;  2BMO A;  2E4P A;  3GKE A;  3VMH D;  1UUV A;  2D2C C;  3VMI D;  1BCC E;  3BCC E;  5AEU A;  2QJY C;  1NYK A;  1KYO E;  4OGQ C;  1SQV E;  5KLI C;  4OGQ D;  3C0D A;  1Q90 C;  2BMR A;  2XSO A;  2BCC E;  4NBG D;  4NBC D;  2NVE A;  1L0L E;  2FYN C;  1O7H A;  1O7M A;  3GTE A;  2D2C D;  3GTS A;  1ULJ A;  2JO6 A;  4HM2 A;  4HM6 A;  4NBF D;  2ZYL A;  2QPZ A;  2HMK A;  1KB9 E;  1O7G A;  2FYU E;  4HKV A;  2E74 D;  4PV1 C;  4QDD A;  3VMG D;  2YFL A;  1RIE A;  2NUK A;  1VCK A;  2QJP C;  1P84 E;  3EQQ A;  2NVF A;  1ZRT E;  1NU1 E;  4NBE D;  1VF5 C;  3H1K E;  2XSH A;  2E76 D;  4HM4 A;  2E76 C;  2JZA A;  2NVG A;  2IBZ E;  3TGU E;  2ZT9 C;  4NB9 D;  4NB8 D;  3L75 E;  4NBD D;  1O7P A;  1EZV E;  4U3F E;  3L70 E;  4H13 C;  4HM7 A;  2NUM A;  4I7Z C;  4HM0 A;  1EG9 A;  2I7F A;  3FOU A;  1ULI A;  1NTK E;  3CWB E;  4PD4 E;  4NBA D;  4HM8 A;  1G8J B;  2E75 C;  1G8K B;  1SQP E;  2B1X A;  4H13 D;  4QUP A;  2DE5 D;  1SQQ E;  2HMM A;  1NTZ E;  2YFJ A;  4QDF A;  2YFI A;  1JM1 A;  4HM3 A;  3VCP A;  5AEW A;  3L71 E;  4QDC A;  2GBW A;  2YIU C;  2XRX A;  1NTM E;  4QUR A;  2B24 A;  3L73 E;  4HM1 A;  2A06 E;  2NWF A;  1FQT A;  1WQL A;  3CX5 E;  1SJG A;  3H1I E;  2HMO A;  3H1H E; 
#chains in the Genus database with same CATH topology
 1J1E C;  2IBZ D;  4IL6 E;  2WTY A;  1YIT P;  5AVR B;  3B8E B;  2Q6Q A;  1OZH A;  4LGD E;  3AEA C;  5CJ4 A;  1CSB A;  2FYU D;  4PJ0 E;  5DJU B;  3CLQ A;  5CCH A;  1JB0 J;  1HGZ A;  1FZC B;  1JY2 N;  2M3E A;  1IK7 A;  1L0L G;  1HVV A;  2UWJ E;  2QG4 A;  1SQQ D;  2OYI C;  2KNC A;  2XDJ A;  2R3S A;  1IC2 A;  4W7Z A;  3SWY A;  4OGQ D;  3C0D A;  2W6A A;  3H1K D;  3B5N D;  1G2C A;  2IYP A;  3GW6 A;  4QDD A;  3D6Y A;  5AW7 B;  1NAF A;  3FWN A;  2B87 B;  5GTH H;  2RKL A;  5AVW B;  3HD7 D;  1YI2 P;  3AE8 C;  2PGD A;  1O7P A;  3L74 D;  1EZV E;  3L70 E;  4H13 C;  2E5Y A;  4I7Z C;  2WIT A;  3RL0 B;  4EYY Q;  2QIW A;  3B5N A;  1SQP D;  2RMZ A;  2P2U A;  3CI9 A;  1URQ C;  3PH0 A;  4B86 A;  3RK3 D;  1PP9 D;  3G6E P;  2HMO A;  3H1H E;  3L75 D;  1O7W A;  3IN6 A;  3CCS P;  3V5B A;  1OW7 A;  1LT9 C;  3GL0 A;  3L74 E;  1SQB E;  1BE3 E;  2XZR A;  1GU4 A;  4ZMD A;  1FJK A;  3GL2 A;  4IFM A;  1QX8 A;  3KQG A;  3H1J E;  3O8Z A;  3EQ2 A;  3FX0 A;  1GU5 A;  3M9Q A;  3RBX A;  1ZV8 A;  3TK1 A;  3RL0 C;  2HPC B;  3GZY A;  3T97 A;  4HM5 A;  1USD A;  5AW6 B;  2E4P A;  1EZV I;  1YJW P;  1UUV A;  4C7N A;  2FYU K;  2IZ0 A;  2KI7 B;  4JPZ B;  1MFZ A;  2XSO A;  2WZ7 A;  1O7M A;  1SP4 A;  1ULJ A;  2GUS A;  2QPZ A;  1O7G A;  1FBM A;  2O01 H;  1R5S A;  2WSS H;  1IFP A;  3OA7 A;  4NBE D;  3EWK A;  2E76 C;  5B5E H;  2OYH C;  2E76 B;  3N7N A;  1KIL D;  2WWW A;  4ZKU A;  1KQL A;  5KJ7 D;  1NTK E;  3CXH H;  1FU1 A;  5APT A;  1NTM D;  2IZ1 A;  4QUP A;  3D70 A;  3PTZ A;  3BRT B;  1JTH A;  2LXC B;  2BEZ F;  3JC2 2;  4L76 A;  3L73 E;  1LTJ C;  4HM1 A;  3A2A A;  1VQ7 P;  3CWB D;  2WSC H;  1FDM A;  4EDF A;  3TNU A;  1VF5 D;  2ZYG A;  3I56 P;  2E74 C;  1HTL C;  1NTK K;  1M7L A;  1NVO A;  4HJL A;  2POH A;  1DH3 A;  2ITA A;  3RL0 g;  3L75 G;  2JEE A;  4WY4 C;  1YTZ I;  4U3F G;  1S2E A;  4OH8 B;  1IZN B;  1LTG C;  3H1I D;  3HE4 A;  3AEB C;  3B4S A;  2KZJ A;  1LGH B;  2FYU J;  3AE2 C;  3RK2 D;  3VMI D;  2O01 J;  2QA4 P;  3CWB J;  3D6Z A;  1JY3 N;  5AW0 B;  1KYO I;  1L0L E;  3A7O A;  2VRS A;  4HM2 A;  2P10 A;  3CCJ P;  4N3Y B;  2NPS A;  1CI6 A;  3C1L A;  3AE9 C;  1GD2 E;  2LR2 A;  1NU1 D;  2KNC B;  3Q3D A;  3PLN A;  1JNM A;  3CME P;  2K9J B;  3LID A;  1U57 A;  3GG2 A;  5AVX B;  3P8M C;  4AUW A;  4NB9 D;  2I1K A;  1YYC A;  1W2E A;  4HM7 A;  1IFN A;  2B89 A;  2QJK B;  1OVR A;  1OVU A;  1L4A A;  1ULI A;  2FKW B;  2R44 A;  3L71 D;  1L0L K;  2G3A A;  2N9B A;  3L72 G;  3SFD C;  2FFD C;  2BCC D;  2FY8 A;  3IF4 A;  3VCP A;  1ZME C;  1PV3 A;  2XND H;  4IFF A;  3C9I A;  1OMI A;  4QCK A;  1NTK J;  1NDO A;  2HFE D;  4H0L D;  1FOS F;  2N1T C;  1PP9 G;  3L71 J;  1KIL C;  1HUC A;  1SQX G;  5KAF E;  1FZC C;  2BMQ A;  1GL2 B;  1LWU A;  3E7K A;  2WPS A;  3KHU A;  2KUB A;  2ZYA A;  2H89 C;  3NXS A;  2E42 A;  2D2C B;  3HD7 A;  1NWQ A;  1PPJ D;  2OQQ A;  3M06 A;  1N73 C;  2QEX P;  1NJI Q;  1LWU C;  4NBG D;  2YO3 A;  3RK2 C;  3WUT A;  2KSJ A;  2HPC A;  1L4A B;  2FFD B;  3HTK B;  2HMK A;  1KB9 E;  1PGP A;  2FYU E;  3CL3 D;  4N78 E;  3F89 A;  2JKV A;  3IAO A;  3S4R A;  5KAF H;  4GIF A;  3SWF A;  1G1I A;  4JF7 A;  3L75 E;  2V7Q H;  5APU A;  5KLI B;  4U3F E;  1HWT C;  1LTS C;  3UIA A;  2JJL A;  3FOU A;  4WWI A;  1PGO A;  3CCV P;  4HM8 A;  3PRJ A;  2N1T B;  2O1K A;  3VMX A;  4R4L A;  1P84 I;  1YJN P;  2Z4E A;  1MUU A;  3AE7 C;  2YFJ A;  2QJP B;  3MP7 B;  1JM1 A;  1T2K C;  4AQR D;  2A45 I;  1PL5 A;  1LNQ A;  3V2R A;  1HJB A;  5KLV J;  3V4W A;  4IL6 H;  3P7K A;  1L4A D;  1L0L D;  3NFQ A;  1VQK P;  3CC4 P;  4P1C H;  1SQP G;  1NAY A;  3WUU A;  4DJG A;  2N1T D;  1NTZ G;  1JTH B;  3AED C;  3D89 A;  1IO4 A;  1HJ0 A;  1JY2 P;  1A02 F;  3N0Q A;  3MZW B;  2JWD A;  3G3Z A;  1N7S B;  3KDP B;  5KJ7 C;  5L8R J;  2KLV A;  1KIL B;  3BVH A;  5AEU A;  1VQ8 P;  5AW3 B;  3Q2Y A;  2FYN C;  3ITK A;  1FJP A;  2JO6 A;  3M9H A;  4K35 A;  3AE6 C;  3AE4 C;  2IFN A;  3TSI A;  1XTG B;  1W2B O;  1ZRT E;  1VF5 C;  2HYN A;  2XV5 A;  2A45 G;  2Z5I A;  4NB8 D;  4YPC A;  3CCU P;  2O3J A;  2NUM A;  4HM0 A;  3L73 J;  2YKP A;  2SPZ A;  1SQQ E;  1N7S C;  1DEB A;  1BCC D;  1J1D B;  3Q1M A;  2KS1 B;  4RO0 A;  5AW2 B;  3CXH E;  3H1L E;  3O6Q B;  1ZXG A;  3VP9 A;  3H1I J;  2Y0C A;  1MKM A;  1N7S A;  1H0T A;  1EDL A;  3CD6 P;  2C9N Y;  1FZF A;  2ZT9 D;  4D6T E;  1EZV G;  2HMN A;  1LT9 A;  1LTJ B;  2KXP B;  4HJG H;  2XNX A;  2Y9Y A;  3MGN A;  5APQ A;  2NRG A;  1T3J A;  1NYK A;  3HE5 A;  5CCG C;  1AJY A;  1VQO P;  3Q5P A;  2W6J H;  2AEJ A;  1SQV K;  1YQ3 C;  5APV A;  1GDT A;  1S9K D;  3OJA B;  3CCM P;  1RIE A;  1P84 E;  1K04 A;  1FAV A;  1YTZ T;  3H1J G;  5EFW B;  3G4S P;  3CCR P;  2YXQ B;  4RJT A;  2FYZ A;  1SQX K;  4I2L C;  5APY A;  1K8A Q;  5TJH A;  3CWB E;  4LC1 A;  1VDF A;  4NBA D;  1SFC D;  1E79 H;  2NPS D;  1SQP E;  3HTK A;  1PGQ A;  3F5H A;  2HMM A;  1KYO H;  1NTZ E;  1X79 B;  3L71 E;  4XFJ A;  3PJS K;  4PD4 H;  4K3A A;  3L70 J;  1JY3 O;  1N8R Q;  3ZDM A;  3H1J J;  2RN0 A;  1IFJ A;  1AVO A;  2OYI B;  1MV8 A;  4IFD K;  2CKF A;  3II6 A;  3HRN A;  4DT0 A;  3AEG C;  2GBX A;  3CXH I;  2OGU A;  3Q5S A;  1PIX A;  2Z5H A;  1ZR2 A;  2HML A;  4P1B H;  2PP6 A;  1M57 D;  1VQN P;  2H43 A;  1BCC E;  1NO4 A;  2M3B A;  2K3R A;  3H1J D;  1S9K E;  2IBZ I;  2NVE A;  2R5B A;  4ZKP A;  3L70 D;  3V4Q A;  5AW5 B;  2IYO A;  5APS A;  1FS0 E;  4BRY B;  1KIL E;  1KB9 D;  3H1H D;  2QJP C;  1VCK A;  4M3L A;  3C8V A;  3A5T A;  4EOT A;  3P32 A;  1BE3 D;  3RK3 B;  3LW5 H;  2C0W A;  4WVZ A;  4PJ0 H;  1X22 A;  2QM7 A;  4L73 A;  1N73 B;  1Q82 Q;  1LTA C;  1NTM K;  1FDI A;  3FXD A;  1SQV D;  5H2F H;  1G1J A;  5KLV G;  4QDC A;  3M91 A;  1FC2 C;  3E1R A;  3Q5R A;  1L4A C;  1JOC A;  1JO5 A;  5BOK A;  1J2J B;  1W5C E;  3I5C A;  1KB9 I;  1OWA A;  1LP1 B;  1HGV A;  1SFC C;  3GF3 A;  3RL0 D;  1T8Z A;  3CWB G;  1EC5 A;  1S72 P;  3AE5 C;  2WVR A;  1LTB C;  3L72 E;  3GMA A;  3GKE A;  3GHG B;  3CX5 I;  4EI2 A;  2WPV B;  2W27 A;  3S1K A;  5AVT B;  5CCG D;  1A02 J;  1OFC X;  2WMM A;  4W80 A;  2B9B A;  1G2C B;  3MIW A;  1OW8 A;  1NTK D;  3A0H E;  2K9Y A;  3NMD A;  2YXR B;  2WSE J;  1URQ B;  3QH9 A;  4HM4 A;  2IBZ E;  1ZRT D;  3L73 D;  3H25 A;  1M90 Q;  3BCC D;  3R2P A;  4OWF A;  5AVU B;  1KYO D;  3PHL A;  1KQF B;  2B1X A;  1TU3 F;  2NZ2 A;  4XE5 B;  3A3Y B;  1YJ9 P;  1Q90 D;  1M1J C;  5GTH E;  3CCE P;  2ZT9 B;  3H1I G;  3TF5 A;  5AW8 B;  2A06 E;  2LKM A;  4UB8 E;  1M1K Q;  3MUD A;  1NTZ K;  4WY4 A;  3V2P A;  3FXE A;  2B88 A;  3CC7 P;  1S3J A;  3AEF C;  2C9L Y;  1M1J A;  1BDC A;  3AEC C;  3VP8 A;  4L75 A;  4N78 D;  5KJ7 A;  4WBA A;  2R5D A;  1EQ7 A;  2L5G B;  3K5B A;  1NKN A;  3CCL P;  2ZFC A;  2WT7 B;  1LT1 A;  1ZP0 C;  1DEE G;  2DE6 D;  1UUW A;  3LW5 J;  2PRR A;  2BMO A;  2WSE H;  1RF1 A;  3H1K J;  1N7S D;  3HUS A;  1X9V A;  2L91 A;  2BCC E;  4XA4 A;  1JUN A;  2P58 A;  2P67 A;  1L0N K;  1J1E B;  1SQP J;  5KAI H;  4R4M A;  3JSV C;  2OYH B;  1DIP A;  1QVG O;  1NTZ J;  1USE A;  1KFM A;  5C39 A;  4U3F J;  1Q2N A;  1RF1 C;  3L35 A;  4JBZ A;  2NUK A;  2NVF A;  2KYV A;  2K37 A;  3OAK A;  2Q7C A;  2NVG A;  1PPJ G;  1KFN A;  1ZR4 A;  1GZL A;  3H1K G;  1NTZ D;  3AEE C;  1R5L A;  2DW3 A;  1FZA A;  1KMI Z;  2OTK E;  4NPF X;  3H32 A;  1SS1 A;  4DZO A;  1NTM E;  3RBZ A;  2NWF A;  3G9R A;  2H88 C;  2V4H A;  1WRG A;  1SQV J;  1GL2 D;  2IDB A;  3M0A A;  3EFG A;  2WT7 A;  4H0L C;  4N6J A;  4PV1 D;  4KJM A;  2B87 A;  4QDF B;  1M8O B;  4AAY B;  4W7Y A;  2V7Q J;  1ZW0 A;  3WU2 E;  4HH2 A;  1OXZ A;  1RF1 B;  4I1L A;  3HD7 C;  2OAR A;  1FDO A;  3HUS B;  1P84 H;  3A0B E;  1AFO A;  5CCG A;  3B5N B;  2IBZ G;  2DE7 D;  2P7J A;  1KB9 H;  2JP3 A;  3HE4 B;  3GZX A;  1BE3 G;  3VMA A;  2IPP A;  1VPC A;  2E4Q A;  1CZQ A;  3TGU G;  1DD4 A;  2GM4 A;  1KYO E;  1L0N J;  4UB6 E;  1PP9 J;  3FGA D;  2AEM A;  1CI6 B;  3EFF K;  3L74 G;  2QVA A;  4NBF D;  5KLV D;  2M5A B;  4HKV A;  3BRV B;  2WSC J;  1PGJ A;  3TNU B;  3L73 G;  2KIK A;  1K05 A;  1EXJ A;  1YQ4 C;  3H1K E;  2FYN B;  1HBW A;  3G71 P;  3H32 B;  3D71 A;  1NOH A;  1YIJ P;  3T97 B;  1RE4 A;  1G8J B;  2E75 C;  1FE6 A;  1VF5 B;  1L0L J;  1EZV D;  2PAJ A;  4QDF A;  5CCH C;  3H1L J;  2GBW A;  4D6T G;  1S5L E;  1SQQ G;  5GTI E;  1WQL A;  3H1I E;  1NKZ B;  3IFM A;  2WQY C;  2ZAE B;  2E74 B;  3EN1 A;  4AIV A;  4RES B;  4D6T D;  3GHG C;  1VM9 A;  1OX3 A;  2W83 C;  3HUS C;  1U7M A;  1X8Y A;  1Y8A A;  1NTM J;  1GK4 A;  1PPJ E;  1KQG B;  2YVJ B;  2JO1 A;  4KT0 J;  1O7N A;  3W67 A;  4H44 D;  4LLH A;  3GB4 A;  1IFD A;  4BXL A;  3WUV A;  4NBH D;  4PD4 I;  2W8Z A;  5B5E E;  2QJY C;  4GOF A;  5GTI H;  1EXI A;  3KXD A;  4OGQ C;  4C7N B;  5KLI C;  1BDD A;  1L2P A;  1LTT C;  2CK3 H;  1Q90 C;  2BMR A;  2E5T A;  2Q1K A;  1PZQ A;  4HM6 A;  1BCC G;  5E79 E;  3VTP C;  2MKV A;  2Q5U A;  3AE3 C;  4JYC A;  1JEK A;  3H6P A;  2JR8 A;  1NTM G;  4GOE A;  3VMG D;  2KLU A;  2CPS A;  3EQQ A;  4U7J A;  1CW5 A;  2ZXE B;  1Q86 Q;  3IR9 A;  1SVF A;  2P1J A;  2WPR A;  1K9M Q;  2IFM A;  1KQS O;  3KPE A;  1JY3 P;  1RF0 C;  2KP8 A;  3KZI E;  2Y0D A;  3L70 G;  4TT3 H;  4DOJ A;  2K1A A;  2YFI A;  1URQ D;  2KOG A;  4O9B A;  2XRX A;  1RE3 A;  1VQ5 P;  1WT6 A;  2YNY A;  1GW3 A;  2HOD A;  3SFE C;  3CX5 E;  3LIE A;  1SQX D;  2MJZ A;  4NBB D;  3PP5 A;  1GTW A;  2FFD A;  4YXD C;  2J58 A;  2K9J A;  4YXW H;  3VOP A;  1JY2 O;  1KC8 Q;  3A0B H;  3CC2 P;  1RE3 C;  1VQL P;  2H8P D;  1OW6 A;  3SWK A;  2E75 D;  1SQB K;  2GUV A;  2FXP A;  5KAI E;  2N9Y B;  3AZC A;  3GLM A;  1IJD B;  5CXM A;  5AW4 B;  1RH5 B;  4Z1M H;  2H7H A;  5DJT B;  1KIL A;  2YMY A;  2ZYD A;  1EDK A;  4Y99 B;  1SQV E;  3U1A A;  1M56 D;  2FXM A;  3TGU D;  5AVQ B;  3TYY A;  3H1L D;  2NPS B;  1NU1 G;  2AXT E;  1AVY A;  2QSI A;  2ZXX A;  2KSE A;  2AEF A;  1BCC J;  2E76 D;  1QVF O;  1VQ6 P;  1JCD A;  2XKM A;  2HOD B;  3U1C A;  2W90 A;  2WSF H;  3JCU E;  1H88 A;  3VMZ A;  3MD0 A;  3CMA P;  2M5A A;  2DE5 D;  2OTJ P;  2ZVO B;  4PD4 D;  1NTK G;  2FBW C;  4PV1 B;  5APW A;  5K5G B;  3MTU E;  5APX A;  2FYU G;  4NPD A;  1NHL A;  4NPE A;  4JYB A;  3E1I A;  2C0X A;  2M0B A;  4QUQ A;  3VMY A;  2R3C A;  1QLE D;  1PFI A;  1AA0 A;  3I55 P;  1VQP P;  2XR8 A;  4EIJ A;  1AQT A;  3TDK A;  1FZG A;  2A06 D;  3M0D C;  2QJY B;  3DQY A;  5HL4 A;  1BE3 J;  3U59 A;  5AVZ B;  2QJK C;  3TGU J;  1GL2 A;  1LWU B;  2PFX A;  1L0N G;  2GA1 A;  2QE7 H;  3L72 D;  3R4Y A;  2WPQ A;  4H44 C;  3GOB A;  1H89 A;  1FZB A;  2BEQ D;  2YO2 A;  1RQU A;  2K88 A;  3USS A;  3HD7 B;  3GTE A;  5TIS H;  1RQV A;  1EDI A;  1GL2 C;  4IOI H;  1SQQ K;  2Y9Z A;  3L75 J;  1KTM A;  2BCC G;  4PV1 C;  4HYT B;  3CX5 D;  2G8Y A;  1BGY E;  2JZA A;  2O01 N;  1NU1 J;  1KOR A;  4OVN F;  2HG5 D;  2I7F A;  4GT1 A;  3H1L G;  3JCU H;  3W68 A;  1GW4 A;  1KD1 Q;  2E75 B;  1S4X A;  1LT9 B;  3OW2 O;  2N1T A;  4U3F D;  4C46 A;  4L74 A;  3V2Q A;  2YIU C;  4QUR A;  3HE5 B;  1BGY D;  3B5N C;  1T3U A;  1DX7 A;  1AQ5 A;  3BAT A;  1RHZ B;  2A06 G;  5BVZ A;  2Q3W A;  2WSF J;  2R32 A;  3KYQ A;  3B71 A;  4JQ0 D;  2BAS A;  1UII A;  3CCQ P;  1YHQ P;  1PP9 E;  1U7J A;  2JWA A;  2W6B A;  3BAS A;  3A0H H;  4H0L B;  3SSU A;  5KKZ C;  5B66 E;  2JDI H;  2QRX A;  2HLO A;  2HMJ A;  1KN7 A;  1UIX A;  4AYC A;  3S9O A;  1HF9 A;  5CCH D;  3FWL A;  3VN0 A;  1SFC A;  5AVV B;  2KZI A;  4NBC D;  1GMJ A;  3O6Q A;  1D7M A;  2IX7 C;  2ZYL A;  1RE4 C;  1QL2 A;  2YKO A;  3CX5 H;  2OTL P;  1SLQ A;  4ASW A;  5BU8 B;  4GKG A;  1NU1 E;  2XSH A;  3WMM 0;  2ZT9 C;  1VQ9 P;  2BCC J;  1LTJ A;  4I7Z B;  2AXC A;  2Q3E A;  1FOS E;  2OYO A;  4PD4 E;  2J5U A;  5CJ0 A;  4H13 D;  3MHV A;  1QL1 A;  2FXO A;  5AVY B;  1Y9B A;  1T2K D;  4GOD A;  1JM0 A;  2YIU B;  2XU6 A;  1L0N D;  2Q3I A;  3RK2 B;  2Q9I A;  1E5W A;  2ZVN B;  2A45 H;  5E79 H;  1QEX A;  3GCE A;  2KS1 A;  5CBN A;  1IK9 A;  1N2D C;  4RKU J;  4I6M C;  1K73 Q;  4H13 B;  1SQX E;  1IFM A;  1N86 A;  5M1B A;  4WB4 A;  4GDO A;  1JCC A;  2AXT H;  1H0T B;  1VQ4 P;  1BGY G;  3H1H J;  4BWN A;  2O1J A;  1Q7Y Q;  3L71 G;  3L36 A;  4EMJ B;  1SQX J;  2NPS C;  1S1C X;  1AV1 A;  3GHG A;  1MZ9 A;  3L74 J;  1L0N E;  3VMH D;  2D2C C;  5B66 H;  1GK6 A;  4TLF A;  4Y99 C;  2I1J A;  3QWO C;  1BSN A;  1J1D C;  1XTC C;  3KZI H;  5AVS B;  3BCC G;  1NH4 A;  1P84 D;  1S5L X;  1JMM A;  3N4X A;  2OYI A;  1Y47 A;  2KK7 A;  3V2N A;  1LTI C;  2E74 D;  1X0T A;  1S5L H;  1MFT A;  4CPG A;  1SQB J;  2E43 A;  3TGU E;  1RY3 A;  1T6A A;  1NYH A;  1LP1 A;  1FZE A;  4ZNC A;  1EG9 A;  1JMB A;  2Y0E A;  4D6T J;  4Y28 J;  1G8K B;  1VQM P;  2QM8 A;  5CMZ A;  2J59 M;  2RH0 A;  3L4F A;  1ZN5 A;  4HM3 A;  2HR3 A;  3RK3 C;  3P8C D;  1FQT A;  1ZLL A;  1IFI A;  5KTB A;  1SQB G;  3RGU A;  1RFS A;  1RF0 A;  3VCA A;  4DCK A;  1YBK A;  1M1J B;  4IL6 X;  1EDJ A;  1BSH A;  4UB6 H;  4MN4 C;  1ZOY C;  4C7R A;  3ABV C;  1WMK A;  1URQ A;  5TIS E;  3CPW O;  5KLV E;  2M8R A;  1SQB D;  3L37 A;  3NTN A;  5AW9 B;  3AE1 C;  3V6I A;  2YMK A;  3GF7 A;  2CPB A;  1N73 A;  2LXB A;  1KZU B;  3RK3 E;  3M9B A;  4KHX A;  4UB8 H;  1NGM B;  1BGY J;  3H1H G;  4WY4 D;  1SQV G;  4HKZ H;  2ZJS E;  3WU2 H;  3BCC E;  1FZC A;  1OIP A;  1N7L A;  4OGQ B;  1OVV A;  4ASV A;  5KLV K;  1HH0 A;  2I8D A;  4QMA A;  2OYH A;  1O7H A;  3GTS A;  2D2C D;  4YTP C;  2YKQ A;  1KV4 A;  4WY4 B;  5KKZ B;  1Z56 A;  1LJ2 A;  1SQQ J;  4A7P A;  1QGK B;  2YFL A;  1Q81 Q;  4BRY A;  1H8A A;  4HB1 A;  3BCC J;  5H2F E;  5CHX A;  2KB7 P;  1SFC B;  4NBD D;  1R8E A;  3CXH D;  3MUD C;  1NU1 K;  4H44 B;  1VL2 A;  3VYI A;  3P8C E;  5AEW A;  1SQP K;  2B24 A;  3M0D A;  5BU5 A;  5CBO A;  5AW1 B;  3L72 J;  1DD3 A;  1SJG A; 
#chains in the Genus database with same CATH homology
 4QUQ A;  3AEF C;  3AEA C;  3AEC C;  2XR8 A;  1JB0 J;  4P1C H;  3DQY A;  5HL4 A;  3AED C;  3D89 A;  1IK7 A;  1HJ0 A;  2QJK C;  3N0Q A;  1ZP0 C;  2DE6 D;  3R4Y A;  4H44 C;  1UUW A;  3GOB A;  3LW5 J;  2BMO A;  5L8R J;  2BEQ D;  1RQU A;  5AEU A;  4OGQ D;  3C0D A;  3Q2Y A;  2BCC E;  2FYN C;  3GTE A;  1RQV A;  2JO6 A;  4R4M A;  1DIP A;  3AE6 C;  3AE4 C;  1KTM A;  4PV1 C;  4QDD A;  3D6Y A;  2NUK A;  2G8Y A;  2NVF A;  1ZRT E;  1VF5 C;  2NVG A;  2JZA A;  3AE8 C;  4NB8 D;  1O7P A;  1KOR A;  1EZV E;  3L70 E;  4H13 C;  2NUM A;  4I7Z C;  4HM0 A;  2I7F A;  2QIW A;  2E75 B;  3AEE C;  1SQQ E;  1KMI Z;  2YIU C;  1NTM E;  4QUR A;  3Q1M A;  2NWF A;  3G9R A;  2H88 C;  2HMO A;  3H1H E;  1O7W A;  3IN6 A;  2IDB A;  1OW7 A;  3CXH E;  3H1L E;  3GL0 A;  3L74 E;  1SQB E;  4H0L C;  1BE3 E;  4PV1 D;  2Q3W A;  2WSF J;  1MKM A;  4QDF B;  4AAY B;  2V7Q J;  3B71 A;  3GL2 A;  3H1J E;  1FDO A;  2ZT9 D;  1PP9 E;  2DE7 D;  3GZY A;  2HMN A;  2JP3 A;  4H0L B;  5KKZ C;  3GZX A;  4HM5 A;  2HMJ A;  2E4Q A;  1UIX A;  2E4P A;  3S9O A;  1HF9 A;  1UUV A;  1DD4 A;  1NYK A;  1KYO E;  1AJY A;  2XSO A;  3FGA D;  4NBC D;  1GMJ A;  3Q5P A;  1O7M A;  1ULJ A;  3O6Q A;  4NBF D;  2ZYL A;  2QPZ A;  1O7G A;  4HKV A;  1YQ3 C;  2WSC J;  1RIE A;  1P84 E;  1K05 A;  4NBE D;  1NU1 E;  1EXJ A;  1YQ4 C;  3EWK A;  1K04 A;  3H1K E;  2XSH A;  2E76 C;  2ZT9 C;  2E76 B;  3D71 A;  3T97 B;  4I7Z B;  1NTK E;  3CWB E;  4PD4 E;  4NBA D;  1G8J B;  2E75 C;  2J5U A;  1SQP E;  1VF5 B;  4H13 D;  4QUP A;  2HMM A;  3D70 A;  1NTZ E;  4QDF A;  1Y9B A;  4XFJ A;  3L71 E;  2GBW A;  2BEZ F;  3L73 E;  4HM1 A;  1WQL A;  3H1I E;  2WQY C;  3GCE A;  4RKU J;  1VF5 D;  2E74 B;  4H13 B;  1SQX E;  3EN1 A;  4AIV A;  5M1B A;  2CKF A;  2E74 C;  1VM9 A;  4HJL A;  4GDO A;  3AEG C;  3RL0 g;  2GBX A;  4EMJ B;  1PPJ E;  1KQG B;  3Q5S A;  1PIX A;  2YVJ B;  2JO1 A;  4KT0 J;  1O7N A;  1S1C X;  2HML A;  4P1B H;  4H44 D;  3GB4 A;  3AEB C;  4NBH D;  1L0N E;  3VMH D;  3AE2 C;  2D2C C;  3VMI D;  2O01 J;  1BCC E;  2QJY C;  1EXI A;  4OGQ C;  5KLI C;  3D6Z A;  1Q90 C;  2BMR A;  2NVE A;  1L0L E;  4HM2 A;  2P10 A;  4HM6 A;  1S5L X;  2MKV A;  3AE9 C;  3AE3 C;  2E74 D;  1KIL E;  3VMG D;  3Q3D A;  2QJP C;  1VCK A;  3EQQ A;  3C8V A;  4U7J A;  1U57 A;  3TGU E;  4NB9 D;  1NYH A;  4HM7 A;  1EG9 A;  1ULI A;  4Y28 J;  1G8K B;  2G3A A;  4TT3 H;  3SFD C;  1FDI A;  2YFI A;  4HM3 A;  3VCP A;  1ZME C;  4QDC A;  1PV3 A;  2XRX A;  3Q5R A;  3SFE C;  1FQT A;  3CX5 E;  1OMI A;  1RFS A;  3VCA A;  4NBB D;  4QCK A;  1NDO A;  4IL6 X;  4H0L D;  5BOK A;  4YXD C;  1ZOY C;  3ABV C;  1WMK A;  5KLV E;  3AE1 C;  1OW6 A;  2E75 D;  2YMK A;  3GF7 A;  3GF3 A;  2BMQ A;  2FXP A;  3AZC A;  3GLM A;  3RK3 E;  5CXM A;  4Z1M H;  3AE5 C;  1NGM B;  2H89 C;  3L72 E;  3GMA A;  3GKE A;  2D2C B;  2WPV B;  3BCC E;  2OQQ A;  4OGQ B;  1SQV E;  4NBG D;  1O7H A;  3GTS A;  2D2C D;  4YTP C;  1OW8 A;  2HMK A;  1KB9 E;  2K9Y A;  2FYU E;  2WSE J;  2QSI A;  3IAO A;  2YFL A;  2E76 D;  4HM4 A;  2IBZ E;  3L75 E;  4NBD D;  4U3F E;  3H25 A;  1R8E A;  3FOU A;  4H44 B;  4HM8 A;  1VL2 A;  1KQF B;  1TU3 F;  2NZ2 A;  2B1X A;  4R4L A;  2DE5 D;  1Q90 D;  3AE7 C;  2YFJ A;  2FBW C;  1JM1 A;  5AEW A;  4PV1 B;  2ZT9 B;  2B24 A;  2A06 E;  1PL5 A;  1DD3 A;  1SJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...